Citrus Sinensis ID: 020103

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-
MESQDPPNPNPNPPTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGTTSSSSVLESIEAKKAMDPDKLAELWTVDPKRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKSEGPSISASESSSTF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccccEEEccccccccccccccccccccccccccHHHHccccHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHcccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccHHHHHHccccccccccEcccccccEEccccccEEEccccccc
mesqdppnpnpnpptrgpyhrrsqsevqyripddmdlvsdpisdplfdgpggseddlfcsymdmdkigskptgddpkhenanvsvgarprhrysnsidgttsssSVLESIeakkamdpdklaelwtvDPKRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFqrdttdlstENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVAtgemmtptdtynlgmqpipynqslfyphhpqtgpgdtqivqlpefhpfqpnmstphqpmlataNSHAFSEMlqqdplgrlqgldingrnshlvksegpsisasessstf
mesqdppnpnpnpptrgpyhrrSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGskptgddpkhenanvsvgarprhrysnsidgttssssVLESIEakkamdpdklaelwtvdpkrakrilanrqsaarskerkaRYISELERKVQTLQTEATtlsaqltlfqrdttdLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNshlvksegpsisasessstf
MESQDppnpnpnppTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGttssssVLESIEAKKAMDPDKLAELWTVDPKRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKsegpsisasesssTF
*********************************************************FCS****************************************************************W************************************************LTLF*****************************************************DTYNLGMQPIPYNQSLFYP**********************************************************************************
************************SEVQYRIPDDMDL******************************************************************************************************************YISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELK*******************************************************************************************************************************************
**************************VQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGTTSSSSVLESIEAKKAMDPDKLAELWTVDPKRAKRILA*************RYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHL*****************
******************************IPDDMDLVS***************DDLFCSYMDMDKIG***********************************************MDPDKLAELWTVDPKRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPT*TYNLGMQPIPYNQSLFYP**********************************************QDPLGRLQGLDINGRNS*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESQDPPNPNPNPPTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGARPRHRYSNSIDGTTSSSSVLESIEAKKAMDPDKLAELWTVDPKRAKRILANRQSAARSxxxxxxxxxxxxxxxxxxxxxxxxxxxxLTLFQRDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKSEGPSISASESSSTF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query331 2.2.26 [Sep-21-2011]
Q6S4P4329 Transcription factor RF2b yes no 0.885 0.890 0.553 1e-81
Q04088398 Probable transcription fa no no 0.706 0.587 0.489 6e-54
Q69IL4380 Transcription factor RF2a no no 0.637 0.555 0.516 5e-53
Q9MA75341 Transcription factor VIP1 no no 0.410 0.398 0.639 9e-44
P23922349 Transcription factor HBP- N/A no 0.199 0.189 0.363 3e-05
Q54Q90 530 Probable basic-leucine zi yes no 0.244 0.152 0.363 0.0002
Q9FUD3277 Basic leucine zipper 9 OS no no 0.244 0.292 0.333 0.0003
O24646168 Transcription factor HY5 no no 0.268 0.529 0.315 0.0007
>sp|Q6S4P4|RF2B_ORYSJ Transcription factor RF2b OS=Oryza sativa subsp. japonica GN=RF2b PE=1 SV=1 Back     alignment and function desciption
 Score =  303 bits (776), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 176/318 (55%), Positives = 230/318 (72%), Gaps = 25/318 (7%)

Query: 4   QDPPNPNPNPPTRGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMD 63
           Q+P + +P    RG +HRR++SEV +R+PDD+DL         FD  G SEDDLF ++MD
Sbjct: 2   QEPKHTDP-AAMRGAHHRRARSEVAFRLPDDLDLGGGGAGA--FDEIG-SEDDLFSTFMD 57

Query: 64  MDKIGSKPT--GDDPKHENANVSVGARPRHRYSNSIDGT--------TSSSSVLESIEAK 113
           ++KI S P   G   +   A  S   RP+HR+S+S+DG+         +++S+ E +EAK
Sbjct: 58  IEKISSGPAAAGGSDRDRAAETSSPPRPKHRHSSSVDGSGFFAAARKDAAASLAEVMEAK 117

Query: 114 KAMDPDKLAELWTVDPKRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQ 173
           KAM P++L++L  +DPKRAKRILANRQSAARSKERKARYI+ELERKVQTLQTEATTLSAQ
Sbjct: 118 KAMTPEQLSDLAAIDPKRAKRILANRQSAARSKERKARYITELERKVQTLQTEATTLSAQ 177

Query: 174 LTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTY 233
           LTLFQRDTT LS EN ELK+RLQAMEQQAQLRDALN+ALK+E+ERLK+ATGEM    +TY
Sbjct: 178 LTLFQRDTTGLSAENAELKIRLQAMEQQAQLRDALNDALKQELERLKLATGEMTNSNETY 237

Query: 234 NLGMQPIPYNQSLFYP---HHPQTGPGDTQIVQLPEFHPFQPNMSTPHQPMLATANSHAF 290
           ++G+Q +PYN + F+P   H+     G TQ+   P+F P +PN+     P    ++ +  
Sbjct: 238 SMGLQHVPYN-TPFFPLAQHNAARQNGGTQLP--PQFQPPRPNV-----PNHMLSHPNGL 289

Query: 291 SEMLQQDPLGRLQGLDIN 308
            +++QQDPLGRLQGLDI+
Sbjct: 290 QDIMQQDPLGRLQGLDIS 307
Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q04088|POF21_ARATH Probable transcription factor PosF21 OS=Arabidopsis thaliana GN=POSF21 PE=2 SV=1 Back     alignment and function description
>sp|Q69IL4|RF2A_ORYSJ Transcription factor RF2a OS=Oryza sativa subsp. japonica GN=RF2a PE=1 SV=1 Back     alignment and function description
>sp|Q9MA75|VIP1_ARATH Transcription factor VIP1 OS=Arabidopsis thaliana GN=VIP1 PE=1 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q54Q90|BZPL_DICDI Probable basic-leucine zipper transcription factor L OS=Dictyostelium discoideum GN=bzpL PE=3 SV=1 Back     alignment and function description
>sp|Q9FUD3|BZIP9_ARATH Basic leucine zipper 9 OS=Arabidopsis thaliana GN=BZIP9 PE=1 SV=1 Back     alignment and function description
>sp|O24646|HY5_ARATH Transcription factor HY5 OS=Arabidopsis thaliana GN=HY5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
225448679359 PREDICTED: transcription factor RF2b [Vi 0.972 0.896 0.659 1e-121
255559691355 Transcription factor RF2b, putative [Ric 0.921 0.859 0.635 1e-114
147769462412 hypothetical protein VITISV_012579 [Viti 0.975 0.783 0.572 1e-112
449457399344 PREDICTED: transcription factor RF2b-lik 0.960 0.924 0.633 1e-107
307135840335 b-zip DNA binding protein [Cucumis melo 0.933 0.922 0.638 1e-105
225434335344 PREDICTED: transcription factor RF2b-lik 0.942 0.906 0.640 1e-104
147770946342 hypothetical protein VITISV_035032 [Viti 0.942 0.912 0.640 1e-104
224126595318 predicted protein [Populus trichocarpa] 0.900 0.937 0.643 1e-104
356553170362 PREDICTED: transcription factor RF2b [Gl 0.894 0.817 0.627 1e-100
449444530396 PREDICTED: transcription factor RF2b-lik 0.942 0.787 0.630 1e-100
>gi|225448679|ref|XP_002280180.1| PREDICTED: transcription factor RF2b [Vitis vinifera] Back     alignment and taxonomy information
 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 240/364 (65%), Positives = 277/364 (76%), Gaps = 42/364 (11%)

Query: 4   QDPPNPNP--------NPPT----------RGPYHRRSQSEVQYRIPDDMDLVSDPISDP 45
           QDP NPNP         PP+          RG +HRR+ SEV +RIP+D+ LVSDP    
Sbjct: 2   QDPSNPNPISHSHNAHQPPSTSFPNTATSLRGGHHRRAHSEVNFRIPEDLHLVSDP---- 57

Query: 46  LFDGPG------GSEDDLFCSYMDMDKIGSKPTGDDPKHENANVSVGA---------RPR 90
            FD P       GSEDDLFC+Y+D+DK GS+P GD  + +NA   + A         RPR
Sbjct: 58  -FDVPSASFEEMGSEDDLFCTYIDIDKFGSRPEGD-ARIDNAGGGLAAESGDGEKSSRPR 115

Query: 91  HRYSNSIDGTTSS---SSVLESIEAKKAMDPDKLAELWTVDPKRAKRILANRQSAARSKE 147
           HR+SNS+DG++ S   S  +++IEAKKAM PDKLAELWT+DPKRAKRILANRQSAARSKE
Sbjct: 116 HRHSNSVDGSSMSRGESLFVDTIEAKKAMAPDKLAELWTLDPKRAKRILANRQSAARSKE 175

Query: 148 RKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENTELKLRLQAMEQQAQLRDA 207
           RKARYI ELERKVQTLQTEATTLSAQLTLFQRDTT L+TENTELKLRLQAMEQQAQLRDA
Sbjct: 176 RKARYILELERKVQTLQTEATTLSAQLTLFQRDTTGLTTENTELKLRLQAMEQQAQLRDA 235

Query: 208 LNEALKKEVERLKVATGEMMTPTDTYNLGMQPIPYNQSLFYPHHPQTGPGDTQIVQLPEF 267
           LNEALKKEVERLK+ATGE+MT +D YNLGM  +PY QS F+ H  Q GP ++Q +Q+P+F
Sbjct: 236 LNEALKKEVERLKIATGEIMTSSDAYNLGMHHVPYTQSSFFSHQSQPGPSESQNIQMPQF 295

Query: 268 HPFQPNMSTPHQPMLATANSHAFSEMLQQDPLGRLQGLDINGRNSHLVKSEGPSISASES 327
           HPF  NM T HQP+L  A+S+A S+MLQQDPLGRLQGLDI+ R   LVKSEGPSISASES
Sbjct: 296 HPFPSNMLTHHQPLLGAAHSNALSDMLQQDPLGRLQGLDISSRGPSLVKSEGPSISASES 355

Query: 328 SSTF 331
           SSTF
Sbjct: 356 SSTF 359

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255559691|ref|XP_002520865.1| Transcription factor RF2b, putative [Ricinus communis] gi|223539996|gb|EEF41574.1| Transcription factor RF2b, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147769462|emb|CAN70347.1| hypothetical protein VITISV_012579 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449457399|ref|XP_004146436.1| PREDICTED: transcription factor RF2b-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|307135840|gb|ADN33710.1| b-zip DNA binding protein [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|225434335|ref|XP_002266792.1| PREDICTED: transcription factor RF2b-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147770946|emb|CAN65087.1| hypothetical protein VITISV_035032 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224126595|ref|XP_002319876.1| predicted protein [Populus trichocarpa] gi|222858252|gb|EEE95799.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553170|ref|XP_003544931.1| PREDICTED: transcription factor RF2b [Glycine max] Back     alignment and taxonomy information
>gi|449444530|ref|XP_004140027.1| PREDICTED: transcription factor RF2b-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query331
TAIR|locus:2061908367 AT2G40620 "AT2G40620" [Arabido 0.752 0.678 0.644 1.2e-79
TAIR|locus:2033123337 bZIP52 "AT1G06850" [Arabidopsi 0.839 0.824 0.521 8.2e-67
TAIR|locus:2061340398 AT2G31370 [Arabidopsis thalian 0.685 0.570 0.502 2.3e-52
TAIR|locus:2141826553 AT4G38900 "AT4G38900" [Arabido 0.398 0.238 0.641 2.5e-41
TAIR|locus:2198856423 AT1G06070 "AT1G06070" [Arabido 0.486 0.380 0.575 7.5e-41
TAIR|locus:2031123341 VIP1 "VIRE2-interacting protei 0.435 0.422 0.615 1.6e-38
TAIR|locus:2047082525 AT2G21230 "AT2G21230" [Arabido 0.347 0.219 0.661 1.7e-37
TAIR|locus:2053761321 BZIP34 "AT2G42380" [Arabidopsi 0.326 0.336 0.467 1.2e-19
TAIR|locus:2085425329 BZIP61 [Arabidopsis thaliana ( 0.280 0.282 0.516 2.5e-19
TAIR|locus:2057030264 AT2G12900 "AT2G12900" [Arabido 0.353 0.443 0.398 3.1e-19
TAIR|locus:2061908 AT2G40620 "AT2G40620" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 800 (286.7 bits), Expect = 1.2e-79, P = 1.2e-79
 Identities = 178/276 (64%), Positives = 202/276 (73%)

Query:    16 RGPYHRRSQSEVQYRIPDDMDLVSDPISDPLFDGPGGSEDDLFCSYMDMDKIGS------ 69
             RGPYHRR+ SEVQ+R+P+D+DL S+P     FD  G SEDDLFCSYMD++K+GS      
Sbjct:    30 RGPYHRRAHSEVQFRLPEDLDL-SEPFGG--FDELG-SEDDLFCSYMDIEKLGSGSGSAS 85

Query:    70 ------KPTGDDP-KHENANVSVG-ARPRHRYSNSIDGXXXXXXVLESIEAKKAMDPDKL 121
                    P  D+P   EN     G +RPRHR+S S+DG       LESIEAKKAM PDKL
Sbjct:    86 DSAGPSAPRSDNPFSAENGGAEAGNSRPRHRHSLSVDGSST----LESIEAKKAMAPDKL 141

Query:   122 AELWTVDPKRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDT 181
             AELW VDPKRAKRI+ANRQSAARSKERKARYI ELERKVQTLQTEATTLSAQL+LFQRDT
Sbjct:   142 AELWVVDPKRAKRIIANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDT 201

Query:   182 TDLSTENTELKLRLQAMEQQAQLRDALNEALKKEVERLKVATGEMMTPTDTYNLGMQPIP 241
             T LS+ENTELKLRLQ MEQQA+LRDALNE LKKEVERLK ATGE+ +P D YNLGM  + 
Sbjct:   202 TGLSSENTELKLRLQVMEQQAKLRDALNEQLKKEVERLKFATGEV-SPADAYNLGMAHMQ 260

Query:   242 YNQS---LFYPHHPQTGPGDTQIVQLP-EFHPFQPN 273
             Y Q     F+ HH Q       + Q+  +FH FQPN
Sbjct:   261 YQQQPQQSFFQHHHQQQTDAQNLQQMTHQFHLFQPN 296
GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
TAIR|locus:2033123 bZIP52 "AT1G06850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061340 AT2G31370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141826 AT4G38900 "AT4G38900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2198856 AT1G06070 "AT1G06070" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031123 VIP1 "VIRE2-interacting protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2047082 AT2G21230 "AT2G21230" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053761 BZIP34 "AT2G42380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2085425 BZIP61 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057030 AT2G12900 "AT2G12900" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6S4P4RF2B_ORYSJNo assigned EC number0.55340.88510.8905yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
smart0033865 smart00338, BRLZ, basic region leucin zipper 1e-14
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 2e-07
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-05
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 2e-04
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 0.001
pfam04156186 pfam04156, IncA, IncA protein 0.002
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 67.2 bits (165), Expect = 1e-14
 Identities = 26/63 (41%), Positives = 37/63 (58%)

Query: 128 DPKRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTE 187
           D KR +R   NR++A RS+ERK   I ELERKV+ L+ E   L  ++   +R+   L +E
Sbjct: 3   DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62

Query: 188 NTE 190
             E
Sbjct: 63  LEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|217933 pfam04156, IncA, IncA protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 331
smart0033865 BRLZ basic region leucin zipper. 99.38
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.3
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 99.16
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.08
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.04
KOG3584348 consensus cAMP response element binding protein an 98.9
KOG0709472 consensus CREB/ATF family transcription factor [Tr 98.78
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.07
KOG0837279 consensus Transcriptional activator of the JUN fam 97.89
KOG4571294 consensus Activating transcription factor 4 [Trans 97.31
KOG4196135 consensus bZIP transcription factor MafK [Transcri 97.02
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 96.4
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.35
KOG3119269 consensus Basic region leucine zipper transcriptio 96.33
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 96.32
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.88
PRK13169110 DNA replication intiation control protein YabA; Re 95.73
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 95.11
PRK10884206 SH3 domain-containing protein; Provisional 95.1
PF14662193 CCDC155: Coiled-coil region of CCDC155 94.7
TIGR0244965 conserved hypothetical protein TIGR02449. Members 94.6
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.51
COG307479 Uncharacterized protein conserved in bacteria [Fun 93.78
PRK1542279 septal ring assembly protein ZapB; Provisional 93.64
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 93.51
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 93.46
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.33
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 93.32
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 93.32
PF14662193 CCDC155: Coiled-coil region of CCDC155 93.09
PF1374789 DUF4164: Domain of unknown function (DUF4164) 92.93
PF05911 769 DUF869: Plant protein of unknown function (DUF869) 92.65
PRK0029568 hypothetical protein; Provisional 92.36
TIGR0244965 conserved hypothetical protein TIGR02449. Members 92.28
PRK0211973 hypothetical protein; Provisional 92.13
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 92.11
PRK0279372 phi X174 lysis protein; Provisional 92.09
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 92.09
COG4467114 Regulator of replication initiation timing [Replic 92.09
PF10186302 Atg14: UV radiation resistance protein and autopha 92.08
PRK0073668 hypothetical protein; Provisional 91.97
PRK10884206 SH3 domain-containing protein; Provisional 91.95
PRK0432574 hypothetical protein; Provisional 91.8
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 91.57
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 91.52
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.51
PRK0440675 hypothetical protein; Provisional 91.46
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 91.42
PRK11637428 AmiB activator; Provisional 91.42
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 91.39
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 91.26
COG2433652 Uncharacterized conserved protein [Function unknow 91.09
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.04
PF1271186 Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 90.84
COG307479 Uncharacterized protein conserved in bacteria [Fun 90.8
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 90.54
PF13851201 GAS: Growth-arrest specific micro-tubule binding 90.52
PRK09039343 hypothetical protein; Validated 90.39
PRK0084677 hypothetical protein; Provisional 90.31
PRK11637428 AmiB activator; Provisional 90.26
COG4942 420 Membrane-bound metallopeptidase [Cell division and 90.19
KOG4807593 consensus F-actin binding protein, regulates actin 90.14
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 89.85
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 89.56
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 89.53
KOG0239 670 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] 89.2
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 89.11
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 89.1
KOG0288 459 consensus WD40 repeat protein TipD [General functi 88.75
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 88.51
PRK04863 1486 mukB cell division protein MukB; Provisional 88.36
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 88.28
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 88.27
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 88.09
KOG0995 581 consensus Centromere-associated protein HEC1 [Cell 87.96
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 87.59
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 87.34
KOG0982502 consensus Centrosomal protein Nuf [Cell cycle cont 86.96
PRK09039343 hypothetical protein; Validated 86.93
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 86.61
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 86.57
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 86.4
KOG0243 1041 consensus Kinesin-like protein [Cytoskeleton] 86.36
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 86.11
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 86.0
PF05837106 CENP-H: Centromere protein H (CENP-H); InterPro: I 85.89
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 85.83
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 85.52
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 85.47
KOG1962216 consensus B-cell receptor-associated protein and r 85.28
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 85.26
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 85.03
PF00038312 Filament: Intermediate filament protein; InterPro: 84.64
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 84.58
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 84.26
PHA02562562 46 endonuclease subunit; Provisional 84.21
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 84.11
PF15058200 Speriolin_N: Speriolin N terminus 83.99
PRK10698222 phage shock protein PspA; Provisional 83.94
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 83.93
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 83.89
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 83.72
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 83.47
PF04111314 APG6: Autophagy protein Apg6; InterPro: IPR007243 82.99
PF06428100 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IP 82.93
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 82.87
KOG0250 1074 consensus DNA repair protein RAD18 (SMC family pro 82.58
TIGR02977219 phageshock_pspA phage shock protein A. Members of 82.41
COG4026290 Uncharacterized protein containing TOPRIM domain, 82.36
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 82.15
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 82.15
PRK1542279 septal ring assembly protein ZapB; Provisional 81.97
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 81.93
COG2433652 Uncharacterized conserved protein [Function unknow 81.9
PRK05431 425 seryl-tRNA synthetase; Provisional 81.67
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 81.59
KOG4571294 consensus Activating transcription factor 4 [Trans 81.5
smart0033865 BRLZ basic region leucin zipper. 81.41
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 81.38
PF09738302 DUF2051: Double stranded RNA binding protein (DUF2 81.37
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 81.26
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 81.23
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 80.95
PRK13922276 rod shape-determining protein MreC; Provisional 80.81
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 80.77
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 80.65
PF10211189 Ax_dynein_light: Axonemal dynein light chain; Inte 80.6
PRK13169110 DNA replication intiation control protein YabA; Re 80.4
KOG4643 1195 consensus Uncharacterized coiled-coil protein [Fun 80.39
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 80.37
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 80.3
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 80.19
TIGR03495135 phage_LysB phage lysis regulatory protein, LysB fa 80.16
KOG4360 596 consensus Uncharacterized coiled coil protein [Fun 80.09
KOG0288 459 consensus WD40 repeat protein TipD [General functi 80.02
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.38  E-value=3.4e-12  Score=96.50  Aligned_cols=62  Identities=40%  Similarity=0.546  Sum_probs=55.0

Q ss_pred             CChHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHH
Q 020103          127 VDPKRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTEN  188 (331)
Q Consensus       127 ~D~KR~KRiLaNRESArRSReRKkqyleeLE~kVq~Lq~ENs~L~~qlt~Lqr~~~~L~~EN  188 (331)
                      .|+|+.||+++||+||++||+||+.|+.+||.+|..|+.+|..|..++..|..++..|..++
T Consensus         2 ~~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        2 EDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             ccHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            57899999999999999999999999999999999999999999999888766655555443

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4807 consensus F-actin binding protein, regulates actin cytoskeletal organization [Cytoskeleton] Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>KOG0239 consensus Kinesin (KAR3 subfamily) [Cytoskeleton] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0243 consensus Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>PRK10698 phage shock protein PspA; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF06428 Sec2p: GDP/GTP exchange factor Sec2p; InterPro: IPR009449 In Saccharomyces cerevisiae, Sec2p is a GDP/GTP exchange factor for Sec4p, which is required for vesicular transport at the post-Golgi stage of yeast secretion [] Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] Back     alignment and domain information
>TIGR02977 phageshock_pspA phage shock protein A Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family Back     alignment and domain information
>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query331
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 2e-11
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 3e-11
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 8e-09
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 1e-07
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 2e-07
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 5e-07
2wt7_B90 Transcription factor MAFB; transcription, transcri 8e-07
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 2e-05
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 6e-05
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-05
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
 Score = 57.7 bits (140), Expect = 2e-11
 Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 7/68 (10%)

Query: 130 KRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDTTDLSTENT 189
           KR K +  NR +A+RS++++  ++  LE+K + L +    L +++       T L  E  
Sbjct: 1   KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEV-------TLLRNEVA 53

Query: 190 ELKLRLQA 197
           +LK  L A
Sbjct: 54  QLKQLLLA 61
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.5
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.28
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.25
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.12
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.04
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 99.0
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.83
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.35
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.33
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.2
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.13
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.14
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.43
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.17
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 94.83
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.48
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 93.38
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.83
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 92.43
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 92.35
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 91.8
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 91.66
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 91.16
2ve7_C250 Kinetochore protein NUF2, kinetochore protein SPC; 89.49
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 89.38
3cve_A72 Homer protein homolog 1; coiled coil, alternative 89.13
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 89.06
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 88.9
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 88.89
4ath_A83 MITF, microphthalmia-associated transcription fact 88.18
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 87.57
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 87.29
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 87.21
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 87.15
1deb_A54 APC protein, adenomatous polyposis coli protein; c 86.94
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 86.89
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 86.8
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 86.21
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 85.85
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 85.85
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 85.49
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 84.42
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 84.25
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 84.12
3m48_A33 General control protein GCN4; leucine zipper, synt 84.09
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 84.08
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 84.06
3mq9_A471 Bone marrow stromal antigen 2 fused to maltose-BI 83.99
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 83.45
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 83.29
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 83.06
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 82.46
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 82.2
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 81.98
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 81.73
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 81.53
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 81.18
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 81.13
2ocy_A154 RAB guanine nucleotide exchange factor SEC2; RAB, 81.05
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 80.84
4ati_A118 MITF, microphthalmia-associated transcription fact 80.59
1wle_A 501 Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo 80.46
3cve_A72 Homer protein homolog 1; coiled coil, alternative 80.38
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.50  E-value=3.3e-14  Score=105.09  Aligned_cols=52  Identities=31%  Similarity=0.514  Sum_probs=49.0

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 020103          130 KRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLFQRDT  181 (331)
Q Consensus       130 KR~KRiLaNRESArRSReRKkqyleeLE~kVq~Lq~ENs~L~~qlt~Lqr~~  181 (331)
                      ||.+|+++||+||++||+||++|+++||.+|..|+.+|..|..++..|+..+
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~   52 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY   52 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            6899999999999999999999999999999999999999999999887654
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query331
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 80.39
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=80.39  E-value=0.39  Score=35.66  Aligned_cols=27  Identities=15%  Similarity=0.246  Sum_probs=23.3

Q ss_pred             hHHHHHHHHhHHHHHHHHHHHHHHHHH
Q 020103          129 PKRAKRILANRQSAARSKERKARYISE  155 (331)
Q Consensus       129 ~KR~KRiLaNRESArRSReRKkqylee  155 (331)
                      -+-+||.=+|+.+|++.|+||....++
T Consensus        47 irDIRRRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          47 IRKIRRRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence            467889999999999999999886654