Citrus Sinensis ID: 020168
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 330 | ||||||
| 108864706 | 544 | Heat shock cognate 70 kDa protein, putat | 1.0 | 0.606 | 0.930 | 1e-179 | |
| 108864705 | 602 | Heat shock cognate 70 kDa protein, putat | 1.0 | 0.548 | 0.930 | 1e-179 | |
| 115486793 | 649 | Os11g0703900 [Oryza sativa Japonica Grou | 1.0 | 0.508 | 0.930 | 1e-179 | |
| 125578088 | 632 | hypothetical protein OsJ_34853 [Oryza sa | 1.0 | 0.522 | 0.930 | 1e-179 | |
| 211906496 | 648 | heat shock protein 70 [Gossypium hirsutu | 0.996 | 0.507 | 0.936 | 1e-178 | |
| 356542451 | 560 | PREDICTED: heat shock cognate 70 kDa pro | 1.0 | 0.589 | 0.945 | 1e-178 | |
| 356539018 | 649 | PREDICTED: heat shock cognate 70 kDa pro | 1.0 | 0.508 | 0.942 | 1e-178 | |
| 21664287 | 648 | heat shock protein 70 [Oryza sativa Indi | 1.0 | 0.509 | 0.927 | 1e-178 | |
| 224098390 | 648 | predicted protein [Populus trichocarpa] | 0.996 | 0.507 | 0.930 | 1e-177 | |
| 45331281 | 649 | 70 kDa heat shock cognate protein 1 [Vig | 1.0 | 0.508 | 0.936 | 1e-177 |
| >gi|108864706|gb|ABG22609.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Score = 634 bits (1635), Expect = e-179, Method: Compositional matrix adjust.
Identities = 307/330 (93%), Positives = 317/330 (96%)
Query: 1 MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA 60
MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIP+VQQLLQDFFNGKELCK+INPDEAVAYGA
Sbjct: 215 MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQDFFNGKELCKNINPDEAVAYGA 274
Query: 61 AVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSD 120
AVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSD
Sbjct: 275 AVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSD 334
Query: 121 NQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDK 180
NQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDK
Sbjct: 335 NQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDK 394
Query: 181 TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTI 240
TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYK+ED+EHKKKVE+KNALENYAYNMRNTI
Sbjct: 395 TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNTI 454
Query: 241 KDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQG 300
KDEKI++KLP ADKKKIEDAI++AIQWLDGNQLAEADEF+DKMKELEGICNPIIAKMYQG
Sbjct: 455 KDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELEGICNPIIAKMYQG 514
Query: 301 GGADAGASMDEDGPSAGAGSGAGPKIEEVD 330
GAD MDED GSGAGPKIEEVD
Sbjct: 515 AGADMAGGMDEDDAPPAGGSGAGPKIEEVD 544
|
Source: Oryza sativa Japonica Group Species: Oryza sativa Genus: Oryza Family: Poaceae Order: Poales Class: Liliopsida Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|108864705|gb|ABG22608.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|115486793|ref|NP_001068540.1| Os11g0703900 [Oryza sativa Japonica Group] gi|62733235|gb|AAX95352.1| dnaK-type molecular chaperone hsp70 - rice (fragment) [Oryza sativa Japonica Group] gi|77552703|gb|ABA95500.1| Heat shock cognate 70 kDa protein, putative, expressed [Oryza sativa Japonica Group] gi|113645762|dbj|BAF28903.1| Os11g0703900 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|125578088|gb|EAZ19310.1| hypothetical protein OsJ_34853 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|211906496|gb|ACJ11741.1| heat shock protein 70 [Gossypium hirsutum] | Back alignment and taxonomy information |
|---|
| >gi|356542451|ref|XP_003539680.1| PREDICTED: heat shock cognate 70 kDa protein-like [Glycine max] gi|345646046|gb|AEO13403.1| heat shock 70 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356539018|ref|XP_003537997.1| PREDICTED: heat shock cognate 70 kDa protein-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|21664287|emb|CAA47948.2| heat shock protein 70 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
| >gi|224098390|ref|XP_002311161.1| predicted protein [Populus trichocarpa] gi|222850981|gb|EEE88528.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|45331281|gb|AAS57912.1| 70 kDa heat shock cognate protein 1 [Vigna radiata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 330 | ||||||
| TAIR|locus:2101222 | 650 | HSP70 "heat shock protein 70" | 0.996 | 0.506 | 0.819 | 4.3e-141 | |
| TAIR|locus:2181833 | 651 | HSC70-1 "heat shock cognate pr | 0.993 | 0.503 | 0.820 | 3.9e-140 | |
| TAIR|locus:2181818 | 653 | Hsp70-2 [Arabidopsis thaliana | 0.996 | 0.503 | 0.8 | 2.4e-138 | |
| TAIR|locus:2074984 | 649 | AT3G09440 [Arabidopsis thalian | 0.993 | 0.505 | 0.795 | 1.2e-134 | |
| TAIR|locus:2200462 | 646 | Hsp70b "heat shock protein 70B | 0.993 | 0.507 | 0.754 | 1.9e-129 | |
| TAIR|locus:2010713 | 617 | ERD2 "EARLY-RESPONSIVE TO DEHY | 0.903 | 0.482 | 0.756 | 1.8e-117 | |
| DICTYBASE|DDB_G0269144 | 640 | hspB "heat shock cognate prote | 0.996 | 0.514 | 0.630 | 1.3e-109 | |
| UNIPROTKB|Q27965 | 641 | HSPA1B "Heat shock 70 kDa prot | 0.927 | 0.477 | 0.677 | 1.3e-109 | |
| UNIPROTKB|Q27975 | 641 | HSPA1A "Heat shock 70 kDa prot | 0.927 | 0.477 | 0.677 | 1.3e-109 | |
| UNIPROTKB|F1NRW7 | 647 | HSPA8 "Heat shock cognate 71 k | 0.927 | 0.472 | 0.676 | 3.4e-109 |
| TAIR|locus:2101222 HSP70 "heat shock protein 70" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1380 (490.8 bits), Expect = 4.3e-141, P = 4.3e-141
Identities = 272/332 (81%), Positives = 285/332 (85%)
Query: 1 MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEXXXXXX 60
MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDE
Sbjct: 320 MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA 379
Query: 61 XXXXXILSGEGNEKVQDXXXXXXXXXXXXXETAGGVMTVLIPRNTTIPTKKEQVFSTYSD 120
ILSGEGNEKVQD ETAGGVMTVLIPRNTTIPTKKEQ+FSTYSD
Sbjct: 380 AVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQIFSTYSD 439
Query: 121 NQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDK 180
NQPGVLIQVYEGER RT+DNNLLGKFELSGIPPAPRGVPQI VCFDIDANGILNVSAEDK
Sbjct: 440 NQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDK 499
Query: 181 TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTI 240
TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAED+EHKKKV+AKNALENYAYNMRNTI
Sbjct: 500 TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEHKKKVDAKNALENYAYNMRNTI 559
Query: 241 KDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQG 300
KDEKI++KL ADKKKIEDAI++AI+WLDGNQLAEADEFEDKMKELE +CNPIIA+MYQG
Sbjct: 560 KDEKIASKLDAADKKKIEDAIDQAIEWLDGNQLAEADEFEDKMKELESLCNPIIARMYQG 619
Query: 301 GGADAGAS--MDEDXXXXXXXXXXXXKIEEVD 330
G D G + MD+D KIEEVD
Sbjct: 620 AGPDMGGAGGMDDDTPAGGSGGAGP-KIEEVD 650
|
|
| TAIR|locus:2181833 HSC70-1 "heat shock cognate protein 70-1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2181818 Hsp70-2 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074984 AT3G09440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2200462 Hsp70b "heat shock protein 70B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010713 ERD2 "EARLY-RESPONSIVE TO DEHYDRATION 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0269144 hspB "heat shock cognate protein Hsc70-1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q27965 HSPA1B "Heat shock 70 kDa protein 1B" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q27975 HSPA1A "Heat shock 70 kDa protein 1A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NRW7 HSPA8 "Heat shock cognate 71 kDa protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 330 | |||
| PTZ00009 | 653 | PTZ00009, PTZ00009, heat shock 70 kDa protein; Pro | 0.0 | |
| pfam00012 | 598 | pfam00012, HSP70, Hsp70 protein | 1e-154 | |
| PRK00290 | 627 | PRK00290, dnaK, molecular chaperone DnaK; Provisio | 1e-144 | |
| TIGR02350 | 595 | TIGR02350, prok_dnaK, chaperone protein DnaK | 1e-127 | |
| PRK13411 | 653 | PRK13411, PRK13411, molecular chaperone DnaK; Prov | 1e-108 | |
| CHL00094 | 621 | CHL00094, dnaK, heat shock protein 70 | 1e-107 | |
| COG0443 | 579 | COG0443, DnaK, Molecular chaperone [Posttranslatio | 1e-107 | |
| PTZ00400 | 663 | PTZ00400, PTZ00400, DnaK-type molecular chaperone; | 1e-105 | |
| PRK13410 | 668 | PRK13410, PRK13410, molecular chaperone DnaK; Prov | 4e-98 | |
| PLN03184 | 673 | PLN03184, PLN03184, chloroplast Hsp70; Provisional | 1e-96 | |
| TIGR01991 | 599 | TIGR01991, HscA, Fe-S protein assembly chaperone H | 9e-80 | |
| PRK05183 | 616 | PRK05183, hscA, chaperone protein HscA; Provisiona | 1e-78 | |
| PTZ00186 | 657 | PTZ00186, PTZ00186, heat shock 70 kDa precursor pr | 8e-73 | |
| cd10233 | 376 | cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding | 2e-46 | |
| PRK01433 | 595 | PRK01433, hscA, chaperone protein HscA; Provisiona | 5e-46 | |
| cd10241 | 374 | cd10241, HSPA5-like_NBD, Nucleotide-binding domain | 2e-33 | |
| cd10234 | 376 | cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding d | 2e-24 | |
| cd10170 | 369 | cd10170, HSP70_NBD, Nucleotide-binding domain of t | 3e-23 | |
| cd11733 | 377 | cd11733, HSPA9-like_NBD, Nucleotide-binding domain | 8e-21 | |
| cd10228 | 381 | cd10228, HSPA4_like_NDB, Nucleotide-binding domain | 3e-20 | |
| cd10238 | 375 | cd10238, HSPA14-like_NBD, Nucleotide-binding domai | 2e-19 | |
| cd10235 | 339 | cd10235, HscC_like_NBD, Nucleotide-binding domain | 3e-19 | |
| cd11734 | 373 | cd11734, Ssq1_like_NBD, Nucleotide-binding domain | 3e-19 | |
| cd10236 | 355 | cd10236, HscA_like_NBD, Nucleotide-binding domain | 4e-18 | |
| cd10237 | 417 | cd10237, HSPA13-like_NBD, Nucleotide-binding domai | 5e-17 | |
| cd10230 | 388 | cd10230, HYOU1-like_NBD, Nucleotide-binding domain | 2e-15 | |
| cd11732 | 377 | cd11732, HSP105-110_like_NBD, Nucleotide-binding d | 4e-12 | |
| cd11737 | 383 | cd11737, HSPA4_NBD, Nucleotide-binding domain of H | 5e-12 | |
| cd11738 | 383 | cd11738, HSPA4L_NBD, Nucleotide-binding domain of | 2e-09 | |
| cd11739 | 383 | cd11739, HSPH1_NBD, Nucleotide-binding domain of H | 1e-08 | |
| cd10232 | 386 | cd10232, ScSsz1p_like_NBD, Nucleotide-binding doma | 3e-08 | |
| TIGR01312 | 481 | TIGR01312, XylB, D-xylulose kinase | 2e-06 | |
| cd07809 | 487 | cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup | 1e-04 | |
| cd10231 | 415 | cd10231, YegD_like, Escherichia coli YegD, a putat | 0.002 |
| >gnl|CDD|240227 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
Score = 558 bits (1439), Expect = 0.0
Identities = 240/338 (71%), Positives = 281/338 (83%), Gaps = 8/338 (2%)
Query: 1 MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA 60
++PVEK L+DA MDK SVH+VVLVGGSTRIPKVQ L++DFFNGKE CKSINPDEAVAYGA
Sbjct: 316 LQPVEKVLKDAGMDKRSVHEVVLVGGSTRIPKVQSLIKDFFNGKEPCKSINPDEAVAYGA 375
Query: 61 AVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSD 120
AVQAAIL+GE + +VQDLLLLDVTPLSLGLETAGGVMT LI RNTTIPTKK Q+F+TY+D
Sbjct: 376 AVQAAILTGEQSSQVQDLLLLDVTPLSLGLETAGGVMTKLIERNTTIPTKKSQIFTTYAD 435
Query: 121 NQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDK 180
NQPGVLIQV+EGER T+DNNLLGKF L GIPPAPRGVPQI V FDIDANGILNVSAEDK
Sbjct: 436 NQPGVLIQVFEGERAMTKDNNLLGKFHLDGIPPAPRGVPQIEVTFDIDANGILNVSAEDK 495
Query: 181 TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTI 240
+TG+ NKITITNDKGRLSK +I++MV EAEKYKAED+ ++++VEAKN LENY Y+M+NT+
Sbjct: 496 STGKSNKITITNDKGRLSKADIDRMVNEAEKYKAEDEANRERVEAKNGLENYCYSMKNTL 555
Query: 241 KDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQG 300
+DEK+ KL +DK IE AI+EA++WL+ NQLAE +EFE K KE+E +CNPI+ KMYQ
Sbjct: 556 QDEKVKGKLSDSDKATIEKAIDEALEWLEKNQLAEKEEFEHKQKEVESVCNPIMTKMYQA 615
Query: 301 -GGADAGA-------SMDEDGPSAGAGSGAGPKIEEVD 330
GG G M AGAG+ +GP +EEVD
Sbjct: 616 AGGGMPGGMPGGMPGGMPGGAGPAGAGASSGPTVEEVD 653
|
Length = 653 |
| >gnl|CDD|215656 pfam00012, HSP70, Hsp70 protein | Back alignment and domain information |
|---|
| >gnl|CDD|234715 PRK00290, dnaK, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233830 TIGR02350, prok_dnaK, chaperone protein DnaK | Back alignment and domain information |
|---|
| >gnl|CDD|184039 PRK13411, PRK13411, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214360 CHL00094, dnaK, heat shock protein 70 | Back alignment and domain information |
|---|
| >gnl|CDD|223520 COG0443, DnaK, Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240403 PTZ00400, PTZ00400, DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184038 PRK13410, PRK13410, molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215618 PLN03184, PLN03184, chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233673 TIGR01991, HscA, Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >gnl|CDD|235360 PRK05183, hscA, chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140213 PTZ00186, PTZ00186, heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212675 cd10233, HSPA1-2_6-8-like_NBD, Nucleotide-binding domain of HSPA1-A, -B, -L, HSPA-2, -6, -7, -8, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|234955 PRK01433, hscA, chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212681 cd10241, HSPA5-like_NBD, Nucleotide-binding domain of human HSPA5 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212676 cd10234, HSPA9-Ssq1-like_NBD, Nucleotide-binding domain of human HSPA9 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212667 cd10170, HSP70_NBD, Nucleotide-binding domain of the HSP70 family | Back alignment and domain information |
|---|
| >gnl|CDD|212683 cd11733, HSPA9-like_NBD, Nucleotide-binding domain of human HSPA9, Escherichia coli DnaK, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212670 cd10228, HSPA4_like_NDB, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212680 cd10238, HSPA14-like_NBD, Nucleotide-binding domain of human HSPA14 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212677 cd10235, HscC_like_NBD, Nucleotide-binding domain of Escherichia coli HscC and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212684 cd11734, Ssq1_like_NBD, Nucleotide-binding domain of Saccharomyces cerevisiae Ssq1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212678 cd10236, HscA_like_NBD, Nucleotide-binding domain of HscA and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212679 cd10237, HSPA13-like_NBD, Nucleotide-binding domain of human HSPA13 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212672 cd10230, HYOU1-like_NBD, Nucleotide-binding domain of human HYOU1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212682 cd11732, HSP105-110_like_NBD, Nucleotide-binding domain of 105/110 kDa heat shock proteins including HSPA4, HYOU1, and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212687 cd11737, HSPA4_NBD, Nucleotide-binding domain of HSPA4 | Back alignment and domain information |
|---|
| >gnl|CDD|212688 cd11738, HSPA4L_NBD, Nucleotide-binding domain of HSPA4L | Back alignment and domain information |
|---|
| >gnl|CDD|212689 cd11739, HSPH1_NBD, Nucleotide-binding domain of HSPH1 | Back alignment and domain information |
|---|
| >gnl|CDD|212674 cd10232, ScSsz1p_like_NBD, Nucleotide-binding domain of Saccharmomyces cerevisiae Ssz1pp and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase | Back alignment and domain information |
|---|
| >gnl|CDD|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212673 cd10231, YegD_like, Escherichia coli YegD, a putative chaperone protein, and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 330 | |||
| KOG0100 | 663 | consensus Molecular chaperones GRP78/BiP/KAR2, HSP | 100.0 | |
| PTZ00009 | 653 | heat shock 70 kDa protein; Provisional | 100.0 | |
| PLN03184 | 673 | chloroplast Hsp70; Provisional | 100.0 | |
| PRK13411 | 653 | molecular chaperone DnaK; Provisional | 100.0 | |
| PRK00290 | 627 | dnaK molecular chaperone DnaK; Provisional | 100.0 | |
| PRK13410 | 668 | molecular chaperone DnaK; Provisional | 100.0 | |
| KOG0101 | 620 | consensus Molecular chaperones HSP70/HSC70, HSP70 | 100.0 | |
| PTZ00400 | 663 | DnaK-type molecular chaperone; Provisional | 100.0 | |
| CHL00094 | 621 | dnaK heat shock protein 70 | 100.0 | |
| TIGR02350 | 595 | prok_dnaK chaperone protein DnaK. Members of this | 100.0 | |
| PTZ00186 | 657 | heat shock 70 kDa precursor protein; Provisional | 100.0 | |
| TIGR01991 | 599 | HscA Fe-S protein assembly chaperone HscA. The Hea | 100.0 | |
| PRK05183 | 616 | hscA chaperone protein HscA; Provisional | 100.0 | |
| PRK01433 | 595 | hscA chaperone protein HscA; Provisional | 100.0 | |
| PF00012 | 602 | HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho | 100.0 | |
| KOG0103 | 727 | consensus Molecular chaperones HSP105/HSP110/SSE1, | 100.0 | |
| KOG0102 | 640 | consensus Molecular chaperones mortalin/PBP74/GRP7 | 100.0 | |
| COG0443 | 579 | DnaK Molecular chaperone [Posttranslational modifi | 100.0 | |
| KOG0104 | 902 | consensus Molecular chaperones GRP170/SIL1, HSP70 | 100.0 | |
| PRK11678 | 450 | putative chaperone; Provisional | 98.84 | |
| PRK13928 | 336 | rod shape-determining protein Mbl; Provisional | 98.84 | |
| PRK13927 | 334 | rod shape-determining protein MreB; Provisional | 98.53 | |
| TIGR00904 | 333 | mreB cell shape determining protein, MreB/Mrl fami | 98.46 | |
| PRK13929 | 335 | rod-share determining protein MreBH; Provisional | 98.39 | |
| PRK13930 | 335 | rod shape-determining protein MreB; Provisional | 98.34 | |
| PRK15080 | 267 | ethanolamine utilization protein EutJ; Provisional | 98.28 | |
| TIGR02529 | 239 | EutJ ethanolamine utilization protein EutJ family | 98.14 | |
| PRK09472 | 420 | ftsA cell division protein FtsA; Reviewed | 97.83 | |
| TIGR01174 | 371 | ftsA cell division protein FtsA. This bacterial ce | 97.66 | |
| PF02782 | 198 | FGGY_C: FGGY family of carbohydrate kinases, C-ter | 96.57 | |
| PLN02669 | 556 | xylulokinase | 96.19 | |
| PRK15027 | 484 | xylulokinase; Provisional | 96.15 | |
| KOG2531 | 545 | consensus Sugar (pentulose and hexulose) kinases [ | 95.93 | |
| PF06723 | 326 | MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba | 95.77 | |
| TIGR00241 | 248 | CoA_E_activ CoA-substrate-specific enzyme activase | 95.5 | |
| TIGR03192 | 293 | benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s | 95.45 | |
| PRK04123 | 548 | ribulokinase; Provisional | 95.41 | |
| TIGR01234 | 536 | L-ribulokinase L-ribulokinase. This enzyme catalyz | 95.39 | |
| PRK00047 | 498 | glpK glycerol kinase; Provisional | 95.29 | |
| TIGR02628 | 465 | fuculo_kin_coli L-fuculokinase. Members of this fa | 95.26 | |
| PLN02295 | 512 | glycerol kinase | 95.25 | |
| TIGR01312 | 481 | XylB D-xylulose kinase. D-xylulose kinase (XylB) g | 95.21 | |
| TIGR01311 | 493 | glycerol_kin glycerol kinase. This model describes | 95.07 | |
| TIGR01315 | 541 | 5C_CHO_kinase FGGY-family pentulose kinase. This m | 94.95 | |
| PRK13917 | 344 | plasmid segregation protein ParM; Provisional | 94.9 | |
| TIGR03286 | 404 | methan_mark_15 putative methanogenesis marker prot | 94.82 | |
| TIGR02259 | 432 | benz_CoA_red_A benzoyl-CoA reductase, bcr type, su | 94.79 | |
| PTZ00294 | 504 | glycerol kinase-like protein; Provisional | 94.76 | |
| TIGR02261 | 262 | benz_CoA_red_D benzoyl-CoA reductase, bcr type, su | 94.75 | |
| TIGR01314 | 505 | gntK_FGGY gluconate kinase, FGGY type. Gluconate i | 94.58 | |
| PRK10939 | 520 | autoinducer-2 (AI-2) kinase; Provisional | 94.55 | |
| PRK10331 | 470 | L-fuculokinase; Provisional | 94.34 | |
| TIGR02627 | 454 | rhamnulo_kin rhamnulokinase. This model describes | 94.2 | |
| PRK13317 | 277 | pantothenate kinase; Provisional | 93.87 | |
| COG1924 | 396 | Activator of 2-hydroxyglutaryl-CoA dehydratase (HS | 93.87 | |
| PRK10640 | 471 | rhaB rhamnulokinase; Provisional | 93.66 | |
| PF11104 | 340 | PilM_2: Type IV pilus assembly protein PilM;; PDB: | 92.67 | |
| KOG2517 | 516 | consensus Ribulose kinase and related carbohydrate | 92.17 | |
| cd00012 | 371 | ACTIN Actin; An ubiquitous protein involved in the | 92.02 | |
| COG1069 | 544 | AraB Ribulose kinase [Energy production and conver | 91.81 | |
| PF00022 | 393 | Actin: Actin; InterPro: IPR004000 Actin [, ] is a | 90.82 | |
| COG1070 | 502 | XylB Sugar (pentulose and hexulose) kinases [Carbo | 89.85 | |
| TIGR01175 | 348 | pilM type IV pilus assembly protein PilM. This pro | 89.64 | |
| COG0849 | 418 | ftsA Cell division ATPase FtsA [Cell division and | 89.29 | |
| COG1077 | 342 | MreB Actin-like ATPase involved in cell morphogene | 89.0 | |
| TIGR03739 | 320 | PRTRC_D PRTRC system protein D. A novel genetic sy | 88.57 | |
| TIGR03281 | 326 | methan_mark_12 putative methanogenesis marker prot | 80.05 |
| >KOG0100 consensus Molecular chaperones GRP78/BiP/KAR2, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-64 Score=454.72 Aligned_cols=301 Identities=67% Similarity=1.052 Sum_probs=292.7
Q ss_pred CcHHHHHHHHcCCCCCCCCeEEEEcCCCCcHHHHHHHHHHhCCCCccccCCchhhHHhHHHHHHHHHhCCCCccccccee
Q 020168 1 MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLL 80 (330)
Q Consensus 1 i~~i~~~l~~a~l~~~dI~~V~lvGGsSriP~V~~~l~~~f~~~~~~~~ln~deaVA~GAa~~a~~~s~~~~~~~~~~~~ 80 (330)
|.|++++|++++|+++|||.|+|||||||||.||+.|+++|+|+++++.+|||||||+|||.+|..+||. ....++++
T Consensus 346 lkPv~kvl~Ds~lkKsdideiVLVGGsTrIPKvQqllk~fF~GKepskGinPdEAVAYGAAVQaGvlsGe--e~t~divL 423 (663)
T KOG0100|consen 346 LKPVQKVLEDSDLKKSDIDEIVLVGGSTRIPKVQQLLKDFFNGKEPSKGINPDEAVAYGAAVQAGVLSGE--EDTGDIVL 423 (663)
T ss_pred hHHHHHHHhhcCcccccCceEEEecCcccChhHHHHHHHHhCCCCccCCCChHHHHHhhhhhhhcccccc--cCcCcEEE
Confidence 5799999999999999999999999999999999999999999999999999999999999999999954 56789999
Q ss_pred eeccceeeEEEEecceeEEEeeCCCCCCceeEEEEeecCCCCCeEEEEEeeccccccCCCceeeEEEecCCCCCCCCCCe
Q 020168 81 LDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQ 160 (330)
Q Consensus 81 ~d~~~~~igi~~~~~~~~~l~~~g~~lP~~~~~~~~~~~d~q~~i~i~i~~g~~~~~~~~~~ig~~~i~~i~~~~~~~~~ 160 (330)
.|++|.++||+..+|.+..|||+++.+|++++..|++..|+|+.+.|.+|+|++.+..+|+.+|.|.++|+|++|+|.++
T Consensus 424 LDv~pLtlGIETvGGVMTklI~RNTviPTkKSQvFsTa~DnQ~tV~I~vyEGER~mtkdn~lLGkFdltGipPAPRGvpq 503 (663)
T KOG0100|consen 424 LDVNPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFSTAQDNQPTVTIQVYEGERPMTKDNHLLGKFDLTGIPPAPRGVPQ 503 (663)
T ss_pred EeeccccceeeeecceeeccccCCcccCccccceeeecccCCceEEEEEeeccccccccccccccccccCCCCCCCCCcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEEEeeCCccEEEEEEeccCCcceeeeeccCCCCCCHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHHHHHHHh
Q 020168 161 INVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTI 240 (330)
Q Consensus 161 i~v~~~~d~~G~l~v~~~~~~t~~~~~~~i~~~~~~ls~~ei~~~~~~~~~~~~~D~~~~~~~~a~N~LE~~i~~~r~~l 240 (330)
|+|+|.+|.||+|+|++.++.+|++..++|+++.++|+.++|++|....++|..+|+..+++.++||.||+|.|.++..+
T Consensus 504 IEVtFevDangiL~VsAeDKgtg~~~kitItNd~~rLt~EdIerMv~eAekFAeeDk~~KekieaRN~LE~YayslKnqi 583 (663)
T KOG0100|consen 504 IEVTFEVDANGILQVSAEDKGTGKKEKITITNDKGRLTPEDIERMVNEAEKFAEEDKKLKEKIEARNELESYAYSLKNQI 583 (663)
T ss_pred EEEEEEEccCceEEEEeeccCCCCcceEEEecCCCCCCHHHHHHHHHHHHHHhhhhHHHHHHHHhHHHHHHHHHHhhhcc
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hh-hhhhccCChhhHHHHHHHHHHHHHHHccCCccchHHHHHHHHHHHHHHHHHHHHHHhcCCC
Q 020168 241 KD-EKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGGGA 303 (330)
Q Consensus 241 ~~-~~~~~~~~~~e~~~i~~~l~e~~~Wl~~~~~a~~ee~~~kl~~L~~~~~~i~~R~~e~~~~ 303 (330)
.+ +.+...+++++++.+..+++++.+||+++++|+.++|.++.++|+..+.||..+++..+|+
T Consensus 584 ~dkekLg~Kl~~edKe~~e~av~e~~eWL~~n~~a~~Ee~~ek~kele~vv~PiisklY~~ag~ 647 (663)
T KOG0100|consen 584 GDKEKLGGKLSDEDKETIEDAVEEALEWLESNQDASKEEFKEKKKELEAVVQPIISKLYGGAGG 647 (663)
T ss_pred CchhHhcccCChhHHHHHHHHHHHHHHHHhhcccccHHHHHHHHHHHHHHHHHHHHHHhhhcCC
Confidence 87 7788999999999999999999999999999999999999999999999999999996644
|
|
| >PTZ00009 heat shock 70 kDa protein; Provisional | Back alignment and domain information |
|---|
| >PLN03184 chloroplast Hsp70; Provisional | Back alignment and domain information |
|---|
| >PRK13411 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK00290 dnaK molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >PRK13410 molecular chaperone DnaK; Provisional | Back alignment and domain information |
|---|
| >KOG0101 consensus Molecular chaperones HSP70/HSC70, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00400 DnaK-type molecular chaperone; Provisional | Back alignment and domain information |
|---|
| >CHL00094 dnaK heat shock protein 70 | Back alignment and domain information |
|---|
| >TIGR02350 prok_dnaK chaperone protein DnaK | Back alignment and domain information |
|---|
| >PTZ00186 heat shock 70 kDa precursor protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01991 HscA Fe-S protein assembly chaperone HscA | Back alignment and domain information |
|---|
| >PRK05183 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >PRK01433 hscA chaperone protein HscA; Provisional | Back alignment and domain information |
|---|
| >PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins | Back alignment and domain information |
|---|
| >KOG0103 consensus Molecular chaperones HSP105/HSP110/SSE1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0102 consensus Molecular chaperones mortalin/PBP74/GRP75, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0104 consensus Molecular chaperones GRP170/SIL1, HSP70 superfamily [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK11678 putative chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK13928 rod shape-determining protein Mbl; Provisional | Back alignment and domain information |
|---|
| >PRK13927 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >TIGR00904 mreB cell shape determining protein, MreB/Mrl family | Back alignment and domain information |
|---|
| >PRK13929 rod-share determining protein MreBH; Provisional | Back alignment and domain information |
|---|
| >PRK13930 rod shape-determining protein MreB; Provisional | Back alignment and domain information |
|---|
| >PRK15080 ethanolamine utilization protein EutJ; Provisional | Back alignment and domain information |
|---|
| >TIGR02529 EutJ ethanolamine utilization protein EutJ family protein | Back alignment and domain information |
|---|
| >PRK09472 ftsA cell division protein FtsA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01174 ftsA cell division protein FtsA | Back alignment and domain information |
|---|
| >PF02782 FGGY_C: FGGY family of carbohydrate kinases, C-terminal domain; InterPro: IPR018485 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related | Back alignment and domain information |
|---|
| >PLN02669 xylulokinase | Back alignment and domain information |
|---|
| >PRK15027 xylulokinase; Provisional | Back alignment and domain information |
|---|
| >KOG2531 consensus Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes | Back alignment and domain information |
|---|
| >TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative | Back alignment and domain information |
|---|
| >TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit | Back alignment and domain information |
|---|
| >PRK04123 ribulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01234 L-ribulokinase L-ribulokinase | Back alignment and domain information |
|---|
| >PRK00047 glpK glycerol kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02628 fuculo_kin_coli L-fuculokinase | Back alignment and domain information |
|---|
| >PLN02295 glycerol kinase | Back alignment and domain information |
|---|
| >TIGR01312 XylB D-xylulose kinase | Back alignment and domain information |
|---|
| >TIGR01311 glycerol_kin glycerol kinase | Back alignment and domain information |
|---|
| >TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase | Back alignment and domain information |
|---|
| >PRK13917 plasmid segregation protein ParM; Provisional | Back alignment and domain information |
|---|
| >TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 | Back alignment and domain information |
|---|
| >TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A | Back alignment and domain information |
|---|
| >PTZ00294 glycerol kinase-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D | Back alignment and domain information |
|---|
| >TIGR01314 gntK_FGGY gluconate kinase, FGGY type | Back alignment and domain information |
|---|
| >PRK10939 autoinducer-2 (AI-2) kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10331 L-fuculokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02627 rhamnulo_kin rhamnulokinase | Back alignment and domain information |
|---|
| >PRK13317 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK10640 rhaB rhamnulokinase; Provisional | Back alignment and domain information |
|---|
| >PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A | Back alignment and domain information |
|---|
| >KOG2517 consensus Ribulose kinase and related carbohydrate kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton | Back alignment and domain information |
|---|
| >COG1069 AraB Ribulose kinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton | Back alignment and domain information |
|---|
| >COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01175 pilM type IV pilus assembly protein PilM | Back alignment and domain information |
|---|
| >COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR03739 PRTRC_D PRTRC system protein D | Back alignment and domain information |
|---|
| >TIGR03281 methan_mark_12 putative methanogenesis marker protein 12 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 330 | ||||
| 1yuw_A | 554 | Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214 | 2e-99 | ||
| 3c7n_B | 554 | Structure Of The Hsp110:hsc70 Nucleotide Exchange C | 3e-99 | ||
| 2v7z_A | 543 | Crystal Structure Of The 70-Kda Heat Shock Cognate | 6e-95 | ||
| 1ckr_A | 159 | High Resolution Solution Structure Of The Heat Shoc | 2e-64 | ||
| 2kho_A | 605 | Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAP | 9e-56 | ||
| 3h0x_A | 152 | Crystal Structure Of Peptide-Binding Domain Of Kar2 | 3e-53 | ||
| 3dob_A | 152 | Peptide-Binding Domain Of Heat Shock 70 Kda Protein | 5e-53 | ||
| 4b9q_A | 605 | Open Conformation Of Atp-Bound Hsp70 Homolog Dnak L | 2e-52 | ||
| 2v7y_A | 509 | Crystal Structure Of The Molecular Chaperone Dnak F | 2e-49 | ||
| 2op6_A | 152 | Peptide-Binding Domain Of Heat Shock 70 Kda Protein | 1e-47 | ||
| 3dpo_A | 219 | Crystal Structure Of The Substrate Binding Domain O | 1e-42 | ||
| 1dky_A | 219 | The Substrate Binding Domain Of Dnak In Complex Wit | 2e-42 | ||
| 1dkx_A | 219 | The Substrate Binding Domain Of Dnak In Complex Wit | 2e-42 | ||
| 3dqg_A | 151 | Peptide-Binding Domain Of Heat Shock 70 Kda Protein | 3e-41 | ||
| 3n8e_A | 182 | Substrate Binding Domain Of The Human Heat Shock 70 | 9e-41 | ||
| 1bpr_A | 191 | Nmr Structure Of The Substrate Binding Domain Of Dn | 4e-39 | ||
| 1dg4_A | 115 | Nmr Structure Of The Substrate Binding Domain Of Dn | 1e-32 | ||
| 1q5l_A | 135 | Nmr Structure Of The Substrate Binding Domain Of Dn | 1e-32 | ||
| 2qw9_B | 394 | Crystal Structure Of Bovine Hsc70 (1-394aa)in The A | 2e-25 | ||
| 2qwn_A | 394 | Crystal Structure Of Disulfide-Bond-Crosslinked Com | 3e-25 | ||
| 1u00_A | 227 | Hsca Substrate Binding Domain Complexed With The Is | 2e-24 | ||
| 1ba1_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 9e-24 | ||
| 1ngg_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-23 | ||
| 1ngc_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-23 | ||
| 1nge_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-23 | ||
| 1nga_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-23 | ||
| 1ba0_A | 386 | Heat-Shock Cognate 70kd Protein 44kd Atpase N-Termi | 1e-23 | ||
| 1ngd_A | 386 | Structural Basis Of The 70-kilodalton Heat Shock Co | 1e-23 | ||
| 1ngf_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-23 | ||
| 1ngh_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-23 | ||
| 1bup_A | 386 | T13s Mutant Of Bovine 70 Kilodalton Heat Shock Prot | 1e-23 | ||
| 1hpm_A | 386 | How Potassium Affects The Activity Of The Molecular | 1e-23 | ||
| 1ngb_A | 386 | Structural Basis Of The 70-Kilodalton Heat Shock Co | 1e-23 | ||
| 1ats_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 1e-23 | ||
| 1atr_A | 386 | Threonine 204 Of The Chaperone Protein Hsc70 Influe | 1e-23 | ||
| 3fe1_A | 403 | Crystal Structure Of The Human 70kda Heat Shock Pro | 1e-22 | ||
| 2e8a_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 1e-22 | ||
| 2e88_A | 391 | Crystal Structure Of The Human Hsp70 Atpase Domain | 1e-22 | ||
| 3a8y_A | 392 | Crystal Structure Of The Complex Between The Bag5 B | 1e-22 | ||
| 1qqn_A | 378 | D206s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 1e-22 | ||
| 1qqm_A | 378 | D199s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 1e-22 | ||
| 1kaz_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71e | 2e-22 | ||
| 1kay_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71a | 2e-22 | ||
| 1qqo_A | 378 | E175s Mutant Of Bovine 70 Kilodalton Heat Shock Pro | 2e-22 | ||
| 1kax_A | 381 | 70kd Heat Shock Cognate Protein Atpase Domain, K71m | 2e-22 | ||
| 3cqx_A | 386 | Chaperone Complex Length = 386 | 2e-22 | ||
| 3fzf_A | 381 | Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP | 2e-22 | ||
| 1hx1_A | 400 | Crystal Structure Of A Bag Domain In Complex With T | 2e-22 | ||
| 2bup_A | 381 | T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 | 2e-22 | ||
| 3jxu_A | 409 | Crystal Structure Of The Human 70kda Heat Shock Pro | 3e-22 | ||
| 3gdq_A | 408 | Crystal Structure Of The Human 70kda Heat Shock Pro | 4e-22 | ||
| 3d2e_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70, | 7e-22 | ||
| 3d2f_B | 382 | Crystal Structure Of A Complex Of Sse1p And Hsp70 L | 9e-22 | ||
| 1s3x_A | 382 | The Crystal Structure Of The Human Hsp70 Atpase Dom | 9e-22 | ||
| 1hjo_A | 380 | Atpase Domain Of Human Heat Shock 70kda Protein 1 L | 1e-21 | ||
| 3kvg_A | 400 | Crystal Structure Of The N-Terminal Domain Of Hsp70 | 1e-21 | ||
| 1xqs_C | 191 | Crystal Structure Of The Hspbp1 Core Domain Complex | 5e-21 | ||
| 4fsv_A | 387 | Crystal Structure Of A Heat Shock 70kda Protein 2 ( | 1e-20 | ||
| 3i33_A | 404 | Crystal Structure Of The Human 70kda Heat Shock Pro | 1e-20 | ||
| 3lof_A | 113 | C-Terminal Domain Of Human Heat Shock 70kda Protein | 5e-20 | ||
| 2lmg_A | 75 | Solution Structure Of The C-Terminal Domain (537-61 | 3e-19 | ||
| 2p32_A | 120 | Crystal Structure Of The C-Terminal 10 Kda Subdomai | 2e-18 | ||
| 3gl1_A | 387 | Crystal Structure Of Atpase Domain Of Ssb1 Chaperon | 1e-17 | ||
| 1ud0_A | 113 | Crystal Structure Of The C-Terminal 10-Kda Subdomai | 6e-17 | ||
| 3iuc_A | 408 | Crystal Structure Of The Human 70kda Heat Shock Pro | 6e-16 | ||
| 3ldl_A | 384 | Crystal Structure Of Human Grp78 (70kda Heat Shock | 8e-16 | ||
| 3qfp_A | 390 | Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE D | 4e-15 | ||
| 3qfu_A | 394 | Crystal Structure Of Yeast Hsp70 (BipKAR2) COMPLEXE | 4e-15 | ||
| 1dkg_D | 383 | Crystal Structure Of The Nucleotide Exchange Factor | 2e-07 | ||
| 3d2f_A | 675 | Crystal Structure Of A Complex Of Sse1p And Hsp70 L | 8e-07 | ||
| 3d2e_A | 675 | Crystal Structure Of A Complex Of Sse1p And Hsp70, | 3e-06 | ||
| 3c7n_A | 668 | Structure Of The Hsp110:hsc70 Nucleotide Exchange C | 7e-05 | ||
| 2qxl_A | 658 | Crystal Structure Analysis Of Sse1, A Yeast Hsp110 | 8e-05 |
| >pdb|1YUW|A Chain A, Crystal Structure Of Bovine Hsc70(Aa1-554)e213aD214A MUTANT Length = 554 | Back alignment and structure |
|
| >pdb|3C7N|B Chain B, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 554 | Back alignment and structure |
| >pdb|2V7Z|A Chain A, Crystal Structure Of The 70-Kda Heat Shock Cognate Protein From Rattus Norvegicus In Post-Atp Hydrolysis State Length = 543 | Back alignment and structure |
| >pdb|1CKR|A Chain A, High Resolution Solution Structure Of The Heat Shock Cognate-70 Kd Substrate Binding Domain Obtained By Multidimensional Nmr Techniques Length = 159 | Back alignment and structure |
| >pdb|2KHO|A Chain A, Nmr-Rdc XRAY STRUCTURE OF E. COLI HSP70 (DNAK) CHAPERONE (1-605) Complexed With Adp And Substrate Length = 605 | Back alignment and structure |
| >pdb|3H0X|A Chain A, Crystal Structure Of Peptide-Binding Domain Of Kar2 Protein From Saccharomyces Cerevisiae Length = 152 | Back alignment and structure |
| >pdb|3DOB|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F44e5.5 From C.Elegans. Length = 152 | Back alignment and structure |
| >pdb|4B9Q|A Chain A, Open Conformation Of Atp-Bound Hsp70 Homolog Dnak Length = 605 | Back alignment and structure |
| >pdb|2V7Y|A Chain A, Crystal Structure Of The Molecular Chaperone Dnak From Geobacillus Kaustophilus Hta426 In Post-Atp Hydrolysis State Length = 509 | Back alignment and structure |
| >pdb|2OP6|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein D Precursor From C.Elegans Length = 152 | Back alignment and structure |
| >pdb|3DPO|A Chain A, Crystal Structure Of The Substrate Binding Domain Of E. Coli Dnak In Complex With A Short Pyrrhocoricin-Derived Inhibitor Peptide Length = 219 | Back alignment and structure |
| >pdb|1DKY|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 2 Native Crystals Length = 219 | Back alignment and structure |
| >pdb|1DKX|A Chain A, The Substrate Binding Domain Of Dnak In Complex With A Substrate Peptide, Determined From Type 1 Selenomethionyl Crystals Length = 219 | Back alignment and structure |
| >pdb|3DQG|A Chain A, Peptide-Binding Domain Of Heat Shock 70 Kda Protein F, Mitochondrial Precursor, From Caenorhabditis Elegans. Length = 151 | Back alignment and structure |
| >pdb|3N8E|A Chain A, Substrate Binding Domain Of The Human Heat Shock 70kda Prote (Mortalin) Length = 182 | Back alignment and structure |
| >pdb|1BPR|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak, Minimized Average Structure Length = 191 | Back alignment and structure |
| >pdb|1DG4|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak In The Apo Form Length = 115 | Back alignment and structure |
| >pdb|1Q5L|A Chain A, Nmr Structure Of The Substrate Binding Domain Of Dnak Bound To The Peptide Nrllltg Length = 135 | Back alignment and structure |
| >pdb|2QWN|A Chain A, Crystal Structure Of Disulfide-Bond-Crosslinked Complex Of Bovine Hsc70 (1-386aa)r171c And Bovine Auxilin (810-910aa)d876c In The AdpPi State Length = 394 | Back alignment and structure |
| >pdb|1U00|A Chain A, Hsca Substrate Binding Domain Complexed With The Iscu Recognition Peptide Elppvkihc Length = 227 | Back alignment and structure |
| >pdb|1BA1|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal Mutant With Cys 17 Replaced By Lys Length = 386 | Back alignment and structure |
| >pdb|1NGG|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGC|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGE|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGA|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1BA0|A Chain A, Heat-Shock Cognate 70kd Protein 44kd Atpase N-Terminal 1nge 3 Length = 386 | Back alignment and structure |
| >pdb|1NGD|A Chain A, Structural Basis Of The 70-kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGF|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1NGH|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1BUP|A Chain A, T13s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 386 | Back alignment and structure |
| >pdb|1HPM|A Chain A, How Potassium Affects The Activity Of The Molecular Chaperone Hsc70. Ii. Potassium Binds Specifically In The Atpase Active Site Length = 386 | Back alignment and structure |
| >pdb|1NGB|A Chain A, Structural Basis Of The 70-Kilodalton Heat Shock Cognate Protein Atp Hydrolytic Activity, Ii. Structure Of The Active Site With Adp Or Atp Bound To Wild Type And Mutant Atpase Fragment Length = 386 | Back alignment and structure |
| >pdb|1ATS|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|1ATR|A Chain A, Threonine 204 Of The Chaperone Protein Hsc70 Influences The Structure Of The Active Site But Is Not Essential For Atp Hydrolysis Length = 386 | Back alignment and structure |
| >pdb|3FE1|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 6 (Hsp70b') Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 403 | Back alignment and structure |
| >pdb|2E8A|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In Complex With Amp-Pnp Length = 391 | Back alignment and structure |
| >pdb|2E88|A Chain A, Crystal Structure Of The Human Hsp70 Atpase Domain In The Apo Form Length = 391 | Back alignment and structure |
| >pdb|3A8Y|A Chain A, Crystal Structure Of The Complex Between The Bag5 Bd5 And Hsp70 Nbd Length = 392 | Back alignment and structure |
| >pdb|1QQN|A Chain A, D206s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|1QQM|A Chain A, D199s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|1KAZ|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71e Mutant Length = 381 | Back alignment and structure |
| >pdb|1KAY|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71a Mutant Length = 381 | Back alignment and structure |
| >pdb|1QQO|A Chain A, E175s Mutant Of Bovine 70 Kilodalton Heat Shock Protein Length = 378 | Back alignment and structure |
| >pdb|1KAX|A Chain A, 70kd Heat Shock Cognate Protein Atpase Domain, K71m Mutant Length = 381 | Back alignment and structure |
| >pdb|3CQX|A Chain A, Chaperone Complex Length = 386 | Back alignment and structure |
| >pdb|3FZF|A Chain A, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP Length = 381 | Back alignment and structure |
| >pdb|1HX1|A Chain A, Crystal Structure Of A Bag Domain In Complex With The Hsc70 Atpase Domain Length = 400 | Back alignment and structure |
| >pdb|2BUP|A Chain A, T13g Mutant Of The Atpase Fragment Of Bovine Hsc70 Length = 381 | Back alignment and structure |
| >pdb|3JXU|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1a (Hsp70-1) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 409 | Back alignment and structure |
| >pdb|3GDQ|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 1-Like Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 408 | Back alignment and structure |
| >pdb|3D2E|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 382 | Back alignment and structure |
| >pdb|3D2F|B Chain B, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 382 | Back alignment and structure |
| >pdb|1S3X|A Chain A, The Crystal Structure Of The Human Hsp70 Atpase Domain Length = 382 | Back alignment and structure |
| >pdb|1HJO|A Chain A, Atpase Domain Of Human Heat Shock 70kda Protein 1 Length = 380 | Back alignment and structure |
| >pdb|3KVG|A Chain A, Crystal Structure Of The N-Terminal Domain Of Hsp70 (Cgd2_20) From Cryptosporidium Parvum In Complex With Amppnp Length = 400 | Back alignment and structure |
| >pdb|1XQS|C Chain C, Crystal Structure Of The Hspbp1 Core Domain Complexed With The Fragment Of Hsp70 Atpase Domain Length = 191 | Back alignment and structure |
| >pdb|4FSV|A Chain A, Crystal Structure Of A Heat Shock 70kda Protein 2 (Hspa2) From Homo Sapiens At 1.80 A Resolution Length = 387 | Back alignment and structure |
| >pdb|3I33|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 2 (Hsp70-2) Atpase Domain In Complex With Adp And Inorganic Phosphate Length = 404 | Back alignment and structure |
| >pdb|3LOF|A Chain A, C-Terminal Domain Of Human Heat Shock 70kda Protein 1b. Length = 113 | Back alignment and structure |
| >pdb|2LMG|A Chain A, Solution Structure Of The C-Terminal Domain (537-610) Of Human Heat Shock Protein 70 Length = 75 | Back alignment and structure |
| >pdb|2P32|A Chain A, Crystal Structure Of The C-Terminal 10 Kda Subdomain From C. Elegans Hsp70 Length = 120 | Back alignment and structure |
| >pdb|3GL1|A Chain A, Crystal Structure Of Atpase Domain Of Ssb1 Chaperone, A Member Of The Hsp70 Family, From Saccharomyces Cerevisiae Length = 387 | Back alignment and structure |
| >pdb|1UD0|A Chain A, Crystal Structure Of The C-Terminal 10-Kda Subdomain Of Hsc70 Length = 113 | Back alignment and structure |
| >pdb|3IUC|A Chain A, Crystal Structure Of The Human 70kda Heat Shock Protein 5 (BipGRP78) ATPASE DOMAIN IN COMPLEX WITH ADP Length = 408 | Back alignment and structure |
| >pdb|3LDL|A Chain A, Crystal Structure Of Human Grp78 (70kda Heat Shock Protein 5 BIP) Atpase Domain In Complex With Atp Length = 384 | Back alignment and structure |
| >pdb|3QFP|A Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) ATPASE DOMAIN Length = 390 | Back alignment and structure |
| >pdb|1DKG|D Chain D, Crystal Structure Of The Nucleotide Exchange Factor Grpe Bound To The Atpase Domain Of The Molecular Chaperone Dnak Length = 383 | Back alignment and structure |
| >pdb|3D2F|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70 Length = 675 | Back alignment and structure |
| >pdb|3D2E|A Chain A, Crystal Structure Of A Complex Of Sse1p And Hsp70, Selenomethionine- Labeled Crystals Length = 675 | Back alignment and structure |
| >pdb|3C7N|A Chain A, Structure Of The Hsp110:hsc70 Nucleotide Exchange Complex Length = 668 | Back alignment and structure |
| >pdb|2QXL|A Chain A, Crystal Structure Analysis Of Sse1, A Yeast Hsp110 Length = 658 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 330 | |||
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 0.0 | |
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 1e-178 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 1e-133 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 1e-121 | |
| 3dob_A | 152 | Heat shock 70 kDa protein F44E5.5; structural geno | 1e-114 | |
| 3h0x_A | 152 | 78 kDa glucose-regulated protein homolog; structur | 1e-113 | |
| 2op6_A | 152 | Heat shock 70 kDa protein D; HSP70/peptide-binding | 1e-112 | |
| 4e81_A | 219 | Chaperone protein DNAK; chaperone; 1.90A {Escheric | 2e-95 | |
| 3n8e_A | 182 | Stress-70 protein, mitochondrial; beta-sandwich, h | 6e-92 | |
| 1u00_A | 227 | HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A | 1e-91 | |
| 3dqg_A | 151 | Heat shock 70 kDa protein F; structural genomics, | 7e-81 | |
| 1q5l_A | 135 | Chaperone protein DNAK; HSP70, chaperone, heat sho | 7e-71 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 5e-51 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 2e-49 | |
| 2p32_A | 120 | Heat shock 70 kDa protein A; three-helix bundle, c | 4e-47 | |
| 3lof_A | 113 | Heat shock 70 kDa protein 1; structural genomics, | 1e-43 | |
| 1ud0_A | 113 | HSC70, 70 kDa heat-shock-like protein; chaperone; | 6e-41 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 3e-27 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 | |
| 3i8b_A | 515 | Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 | 6e-05 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 2e-04 |
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Length = 554 | Back alignment and structure |
|---|
Score = 537 bits (1387), Expect = 0.0
Identities = 195/241 (80%), Positives = 224/241 (92%)
Query: 1 MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGA 60
++PVEK LRDAK+DKS +HD+VLVGGSTRIPK+Q+LLQDFFNGKEL KSINPDEAVAYGA
Sbjct: 314 LDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELNKSINPDEAVAYGA 373
Query: 61 AVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSD 120
AVQAAILSG+ +E VQDLLLLDVTPLSLG+ETAGGVMTVLI RNTTIPTK+ Q F+TYSD
Sbjct: 374 AVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSD 433
Query: 121 NQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDK 180
NQPGVLIQVYEGER T+DNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA DK
Sbjct: 434 NQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDK 493
Query: 181 TTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTI 240
+TG++NKITITNDKGRLSKE+IE+MVQEAEKYKAED++ + KV +KN+LE+YA+NM+ T+
Sbjct: 494 STGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLESYAFNMKATV 553
Query: 241 K 241
+
Sbjct: 554 E 554
|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Length = 675 | Back alignment and structure |
|---|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Length = 605 | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Length = 509 | Back alignment and structure |
|---|
| >3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} Length = 152 | Back alignment and structure |
|---|
| >3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A Length = 152 | Back alignment and structure |
|---|
| >2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} Length = 152 | Back alignment and structure |
|---|
| >4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A Length = 219 | Back alignment and structure |
|---|
| >3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} Length = 182 | Back alignment and structure |
|---|
| >1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 Length = 227 | Back alignment and structure |
|---|
| >3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} Length = 151 | Back alignment and structure |
|---|
| >1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 Length = 135 | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* 1ngf_A* ... Length = 404 | Back alignment and structure |
|---|
| >2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans} Length = 120 | Back alignment and structure |
|---|
| >3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A Length = 113 | Back alignment and structure |
|---|
| >1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1 Length = 113 | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Length = 383 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Length = 272 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 330 | |||
| 4b9q_A | 605 | Chaperone protein DNAK; HET: ATP; 2.40A {Escherich | 100.0 | |
| 2kho_A | 605 | Heat shock protein 70; molecular chaperone, HSP70, | 100.0 | |
| 3d2f_A | 675 | Heat shock protein homolog SSE1; nucleotide exchan | 100.0 | |
| 4e81_A | 219 | Chaperone protein DNAK; chaperone; 1.90A {Escheric | 100.0 | |
| 1yuw_A | 554 | Heat shock cognate 71 kDa protein; chaperone; 2.60 | 100.0 | |
| 1u00_A | 227 | HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A | 100.0 | |
| 2v7y_A | 509 | Chaperone protein DNAK; HSP70, heat shock protein, | 100.0 | |
| 3n8e_A | 182 | Stress-70 protein, mitochondrial; beta-sandwich, h | 100.0 | |
| 3h0x_A | 152 | 78 kDa glucose-regulated protein homolog; structur | 99.97 | |
| 3dob_A | 152 | Heat shock 70 kDa protein F44E5.5; structural geno | 99.97 | |
| 3dqg_A | 151 | Heat shock 70 kDa protein F; structural genomics, | 99.97 | |
| 2op6_A | 152 | Heat shock 70 kDa protein D; HSP70/peptide-binding | 99.96 | |
| 1q5l_A | 135 | Chaperone protein DNAK; HSP70, chaperone, heat sho | 99.9 | |
| 3lof_A | 113 | Heat shock 70 kDa protein 1; structural genomics, | 99.79 | |
| 1ud0_A | 113 | HSC70, 70 kDa heat-shock-like protein; chaperone; | 99.72 | |
| 2p32_A | 120 | Heat shock 70 kDa protein A; three-helix bundle, c | 99.68 | |
| 3i33_A | 404 | Heat shock-related 70 kDa protein 2; protein-ADP c | 99.3 | |
| 3qfu_A | 394 | 78 kDa glucose-regulated protein homolog; HSP70, K | 99.25 | |
| 4gni_A | 409 | Putative heat shock protein; HSP70-type ATPase, AT | 99.25 | |
| 1dkg_D | 383 | Molecular chaperone DNAK; HSP70, GRPE, nucleotide | 99.17 | |
| 1jce_A | 344 | ROD shape-determining protein MREB; MBL, actin, HS | 98.57 | |
| 4ehu_A | 276 | Activator of 2-hydroxyisocaproyl-COA dehydratase; | 98.53 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 98.19 | |
| 2zgy_A | 320 | Plasmid segregation protein PARM; plasmid partitio | 97.78 | |
| 2fsj_A | 346 | Hypothetical protein TA0583; actin homologs, archa | 97.64 | |
| 4a2a_A | 419 | Cell division protein FTSA, putative; cell cycle, | 97.63 | |
| 2ych_A | 377 | Competence protein PILM; cell cycle, type IV pilus | 97.58 | |
| 2fxu_A | 375 | Alpha-actin-1, actin, alpha skeletal muscle; actin | 97.43 | |
| 4apw_A | 329 | ALP12; actin-like protein; 19.70A {Clostridium tet | 96.91 | |
| 1k8k_A | 418 | ARP3, actin-like protein 3, actin-2; beta-propelle | 96.81 | |
| 3js6_A | 355 | Uncharacterized PARM protein; partition, segregati | 96.67 | |
| 1hux_A | 270 | Activator of (R)-2-hydroxyglutaryl-COA dehydratase | 96.09 | |
| 4bc3_A | 538 | Xylulose kinase; transferase, glucuronate xyluloki | 95.9 | |
| 3i8b_A | 515 | Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 | 95.76 | |
| 3ll3_A | 504 | Gluconate kinase; xylulose kinase, nysgx, ATP, ADP | 95.73 | |
| 2itm_A | 484 | Xylulose kinase, xylulokinase; ATPase, FGGY kinase | 95.62 | |
| 3hz6_A | 511 | Xylulokinase; xylulose, structural genomic, chromo | 95.59 | |
| 2zf5_O | 497 | Glycerol kinase; hyperthermophilic archaeon, ATP-b | 95.52 | |
| 3ezw_A | 526 | Glycerol kinase; glycerol metabolism, allosteric r | 95.5 | |
| 3l0q_A | 554 | Xylulose kinase; xlylulose kinase, SGX, PSI, struc | 95.33 | |
| 3ifr_A | 508 | Carbohydrate kinase, FGGY; xylulose kinase, SGX, s | 95.19 | |
| 1k8k_B | 394 | ARP2, actin-like protein 2; beta-propeller, struct | 95.06 | |
| 3g25_A | 501 | Glycerol kinase; IDP00743, ATP-binding, glycerol m | 95.05 | |
| 4e1j_A | 520 | Glycerol kinase; structural genomics, PSI-biology, | 94.95 | |
| 3h3n_X | 506 | Glycerol kinase; ATP-binding, glycerol metabolism, | 94.89 | |
| 2p3r_A | 510 | Glycerol kinase; glycerol metabolism, allosteric r | 94.7 | |
| 3jvp_A | 572 | Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su | 94.58 | |
| 2dpn_A | 495 | Glycerol kinase; thermus thermophilus HB8, structu | 94.37 | |
| 2d4w_A | 504 | Glycerol kinase; alpha and beta protein, ribonucle | 94.18 | |
| 2w40_A | 503 | Glycerol kinase, putative; closed conformation, ma | 94.11 | |
| 2ews_A | 287 | Pantothenate kinase; PANK, structural genomics, st | 93.84 | |
| 1nbw_A | 607 | Glycerol dehydratase reactivase alpha subunit; mol | 93.63 | |
| 2uyt_A | 489 | Rhamnulokinase; rhamnose degradation, IN-LINE phos | 93.38 | |
| 2d0o_A | 610 | DIOL dehydratase-reactivating factor large subunit | 92.77 | |
| 3h6e_A | 482 | Carbohydrate kinase, FGGY; novosphingobium aromati | 91.68 | |
| 2i7n_A | 360 | Pantothenate kinase 1; PANK, transferase; HET: ACO | 87.0 |
| >4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D | Back alignment and structure |
|---|
Probab=100.00 E-value=1e-51 Score=412.22 Aligned_cols=288 Identities=50% Similarity=0.784 Sum_probs=274.6
Q ss_pred CcHHHHHHHHcCCCCCCCCeEEEEcCCCCcHHHHHHHHHHhCCCCccccCCchhhHHhHHHHHHHHHhCCCCccccccee
Q 020168 1 MEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLL 80 (330)
Q Consensus 1 i~~i~~~l~~a~l~~~dI~~V~lvGGsSriP~V~~~l~~~f~~~~~~~~ln~deaVA~GAa~~a~~~s~~~~~~~~~~~~ 80 (330)
+.+|+++|+++++++.+|+.|+||||+||||.|++.|++.| +.++..++|||+|||+|||++|+.+++. ++++.+
T Consensus 317 ~~~v~~~L~~a~~~~~~i~~VvLvGG~sriP~v~~~l~~~f-g~~~~~~~nPdeaVA~GAai~a~~l~~~----~~~~~l 391 (605)
T 4b9q_A 317 IEPLKVALQDAGLSVSDIDDVILVGGQTRMPMVQKKVAEFF-GKEPRKDVNPDEAVAIGAAVQGGVLTGD----VKDVLL 391 (605)
T ss_dssp THHHHHHHHHTTCCGGGCSEEEEESGGGGSHHHHHHHHHHH-TSCCCSSSCTTTHHHHHHHHHHHHHHTS----SCSEEE
T ss_pred HHHHHHHHHHcCCCHHHCcEEEEeCCccCchHHHHHHHHHh-ccCcCCCcChhHHHHHhHHHHHHHhcCC----CCceEE
Confidence 46899999999999999999999999999999999999999 7789999999999999999999999954 578999
Q ss_pred eeccceeeEEEEecceeEEEeeCCCCCCceeEEEEeecCCCCCeEEEEEeeccccccCCCceeeEEEecCCCCCCCCCCe
Q 020168 81 LDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQ 160 (330)
Q Consensus 81 ~d~~~~~igi~~~~~~~~~l~~~g~~lP~~~~~~~~~~~d~q~~i~i~i~~g~~~~~~~~~~ig~~~i~~i~~~~~~~~~ 160 (330)
.|++|++||++..+|.+.+|||+|+++|++++.+|++..|+|+.+.|+||||+.....+|..||+|.|+|+|+.|.|.++
T Consensus 392 ~dv~p~slgie~~~g~~~~ii~rnt~iP~~~~~~f~t~~d~q~~v~i~v~~ge~~~~~~n~~lg~~~l~~i~~~~~g~~~ 471 (605)
T 4b9q_A 392 LDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQ 471 (605)
T ss_dssp ECBCSSCEEEEETTTEEEEEECTTCBSSEEEEEEECCSSTTCCEEEEEEEESSCSBGGGSEEEEEEEEECCCCCSTTCCC
T ss_pred EeeeeeEEEEEEcCCEEEEEEeCCCcCCcceEEEeeeecccCceEEEEEEeccccccccCCEeeEEEEeCCCCCcCCCce
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEEEEeeCCccEEEEEEeccCCcceeeeeccCCCCCCHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHHHHHHHHHHHh
Q 020168 161 INVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTI 240 (330)
Q Consensus 161 i~v~~~~d~~G~l~v~~~~~~t~~~~~~~i~~~~~~ls~~ei~~~~~~~~~~~~~D~~~~~~~~a~N~LE~~i~~~r~~l 240 (330)
|+|+|.+|.||+|+|++.+..||++.+++|.+. ..||+++++++++++.++..+|+..+++.+++|+||+|+|.+|+.|
T Consensus 472 i~v~f~id~~gil~v~a~~~~tg~~~~i~i~~~-~~ls~~ei~~~~~~~~~~~~~d~~~~~~~~~~n~~e~~~~~~~~~~ 550 (605)
T 4b9q_A 472 IEVTFDIDADGILHVSAKDKNSGKEQKITIKAS-SGLNEDEIQKMVRDAEANAEADRKCEELVQTRNQGDHLLHSTRKQV 550 (605)
T ss_dssp EEEEEEECTTSCEEEEEEETTTCCEECCEEESC-CSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred EEEEEEEcCCcEEEEEEEecCCCcEEEEEecCC-CCCCHHHHHHHHHHhhhhHhhHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 999999999999999999999999999999877 6899999999999999999999999999999999999999999999
Q ss_pred hhhhhhccCChhhHHHHHHHHHHHHHHHccCCccchHHHHHHHHHHHHHHHHHHHHHHh
Q 020168 241 KDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQ 299 (330)
Q Consensus 241 ~~~~~~~~~~~~e~~~i~~~l~e~~~Wl~~~~~a~~ee~~~kl~~L~~~~~~i~~R~~e 299 (330)
.+ +..++++++++++...++++++||+.+ +.++|++++++|++.+.||..++++
T Consensus 551 ~~--~~~~~~~~~~~~~~~~~~~~~~~l~~~---~~~~~~~~~~~l~~~~~~~~~~~~~ 604 (605)
T 4b9q_A 551 EE--AGDKLPADDKTAIESALTALETALKGE---DKAAIEAKMQELAQVSQKLMEIAQQ 604 (605)
T ss_dssp HH--HGGGSCHHHHHHHHHHHHHHHHHHHSS---CHHHHHHHHHHHHHHTHHHHHHC--
T ss_pred Hh--hhhhCCHHHHHHHHHHHHHHHHHHhcC---CHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 75 788999999999999999999999987 6899999999999999999999775
|
| >2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* | Back alignment and structure |
|---|
| >4e81_A Chaperone protein DNAK; chaperone; 1.90A {Escherichia coli} PDB: 3dpp_A* 3dpq_A* 3qnj_A 3dpo_A 1dkz_A 1dky_A 1dkx_A 1bpr_A 2bpr_A 1dg4_A | Back alignment and structure |
|---|
| >1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* | Back alignment and structure |
|---|
| >1u00_A HSC66, chaperone protein HSCA; DNAK, HSP70; 1.95A {Escherichia coli} SCOP: a.8.4.1 b.130.1.1 | Back alignment and structure |
|---|
| >2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3n8e_A Stress-70 protein, mitochondrial; beta-sandwich, helix, substrate binding domain, structural G consortium, SGC, chaperone; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3h0x_A 78 kDa glucose-regulated protein homolog; structural genomics, APC89502.3, peptide binding, chaperone, BIP, PSI-2; 1.92A {Saccharomyces cerevisiae} PDB: 1ckr_A 7hsc_A | Back alignment and structure |
|---|
| >3dob_A Heat shock 70 kDa protein F44E5.5; structural genomics, APC90015.11, peptide-binding domain, HS 2, protein structure initiative; 2.39A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3dqg_A Heat shock 70 kDa protein F; structural genomics, APC90008.12, HSP70 protein, peptide-BIN domain, PSI-2, protein structure initiative; 1.72A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2op6_A Heat shock 70 kDa protein D; HSP70/peptide-binding domain, structural genomics, APC90014. 2, protein structure initiative; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1q5l_A Chaperone protein DNAK; HSP70, chaperone, heat shock protein; NMR {Escherichia coli} SCOP: b.130.1.1 | Back alignment and structure |
|---|
| >3lof_A Heat shock 70 kDa protein 1; structural genomics, HSPA1B, HSP70, PSI-2, prote structure initiative; 2.40A {Homo sapiens} PDB: 2lmg_A | Back alignment and structure |
|---|
| >1ud0_A HSC70, 70 kDa heat-shock-like protein; chaperone; 3.45A {Rattus norvegicus} SCOP: a.8.4.1 | Back alignment and structure |
|---|
| >2p32_A Heat shock 70 kDa protein A; three-helix bundle, chaperone; 3.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... | Back alignment and structure |
|---|
| >4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 | Back alignment and structure |
|---|
| >1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A | Back alignment and structure |
|---|
| >4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} | Back alignment and structure |
|---|
| >2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A | Back alignment and structure |
|---|
| >2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* | Back alignment and structure |
|---|
| >4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* | Back alignment and structure |
|---|
| >2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... | Back alignment and structure |
|---|
| >4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} | Back alignment and structure |
|---|
| >1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A | Back alignment and structure |
|---|
| >3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 | Back alignment and structure |
|---|
| >4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} | Back alignment and structure |
|---|
| >3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* | Back alignment and structure |
|---|
| >2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A | Back alignment and structure |
|---|
| >3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* | Back alignment and structure |
|---|
| >2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} | Back alignment and structure |
|---|
| >3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* | Back alignment and structure |
|---|
| >3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* | Back alignment and structure |
|---|
| >3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* | Back alignment and structure |
|---|
| >3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* | Back alignment and structure |
|---|
| >4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O | Back alignment and structure |
|---|
| >2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} | Back alignment and structure |
|---|
| >2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* | Back alignment and structure |
|---|
| >2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 | Back alignment and structure |
|---|
| >1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 | Back alignment and structure |
|---|
| >2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* | Back alignment and structure |
|---|
| >2d0o_A DIOL dehydratase-reactivating factor large subunit; chaperone; HET: ADP; 2.00A {Klebsiella oxytoca} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 PDB: 2d0p_A | Back alignment and structure |
|---|
| >3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2i7n_A Pantothenate kinase 1; PANK, transferase; HET: ACO; 1.90A {Homo sapiens} SCOP: c.55.1.14 c.55.1.14 PDB: 3smp_A* 3sms_A* 2i7p_A* 3mk6_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 330 | ||||
| d1yuwa1 | 159 | b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus | 4e-76 | |
| d1dkza2 | 118 | b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxI | 2e-57 | |
| d1u00a2 | 115 | b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc6 | 3e-51 | |
| d1ud0a_ | 84 | a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: | 1e-33 | |
| d1bupa2 | 193 | c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATP | 3e-29 | |
| d1dkgd2 | 198 | c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATP | 5e-25 | |
| d1dkza1 | 97 | a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: | 3e-21 | |
| d1u00a1 | 112 | a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) | 2e-20 | |
| d1jcea2 | 196 | c.55.1.1 (A:141-336) Prokaryotic actin homolog Mre | 5e-12 | |
| d2zgya2 | 163 | c.55.1.1 (A:158-320) Plasmid segregation protein P | 8e-04 |
| >d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Heat shock protein 70kD (HSP70), peptide-binding domain superfamily: Heat shock protein 70kD (HSP70), peptide-binding domain family: Heat shock protein 70kD (HSP70), peptide-binding domain domain: DnaK species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 228 bits (583), Expect = 4e-76
Identities = 131/159 (82%), Positives = 147/159 (92%)
Query: 72 NEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYE 131
+E VQDLLLLDVTPLSLG+ETAGGVMTVLI RNTTIPTK+ Q F+TYSDNQPGVLIQVYE
Sbjct: 1 SENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYE 60
Query: 132 GERTRTRDNNLLGKFELSGIPPAPRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITIT 191
GER T+DNNLLGKFEL+GIPPAPRGVPQI V FDIDANGILNVSA DK+TG++NKITIT
Sbjct: 61 GERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITIT 120
Query: 192 NDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALE 230
NDKGRLSKE+IE+MVQEAEKYKAED++ + KV +KN+LE
Sbjct: 121 NDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLE 159
|
| >d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} Length = 118 | Back information, alignment and structure |
|---|
| >d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 115 | Back information, alignment and structure |
|---|
| >d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 84 | Back information, alignment and structure |
|---|
| >d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Length = 193 | Back information, alignment and structure |
|---|
| >d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Length = 198 | Back information, alignment and structure |
|---|
| >d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} Length = 97 | Back information, alignment and structure |
|---|
| >d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} Length = 112 | Back information, alignment and structure |
|---|
| >d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Length = 196 | Back information, alignment and structure |
|---|
| >d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Length = 163 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 330 | |||
| d1yuwa1 | 159 | DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.98 | |
| d1dkza2 | 118 | DnaK {Escherichia coli [TaxId: 562]} | 99.93 | |
| d1u00a2 | 115 | Chaperone protein hscA (Hsc66) {Escherichia coli [ | 99.92 | |
| d1ud0a_ | 84 | DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.74 | |
| d1bupa2 | 193 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 99.64 | |
| d1dkgd2 | 198 | Heat shock protein 70kDa, ATPase fragment {Escheri | 99.61 | |
| d1dkza1 | 97 | DnaK {Escherichia coli [TaxId: 562]} | 99.25 | |
| d1u00a1 | 112 | Chaperone protein hscA (Hsc66) {Escherichia coli [ | 99.23 | |
| d1jcea2 | 196 | Prokaryotic actin homolog MreB {Thermotoga maritim | 99.17 | |
| d2zgya2 | 163 | Plasmid segregation protein ParM {Escherichia coli | 97.69 | |
| d1huxa_ | 259 | Hydroxyglutaryl-CoA dehydratase component A {Acida | 97.22 | |
| d2fsja1 | 161 | Hypothetical protein Ta0583 {Archaeon Thermoplasma | 96.2 | |
| d2p3ra2 | 247 | Glycerol kinase {Escherichia coli [TaxId: 562]} | 95.88 | |
| d1e4ft2 | 191 | Cell division protein FtsA {Thermotoga maritima [T | 95.79 | |
| d1r59o2 | 235 | Glycerol kinase {Enterococcus casseliflavus [TaxId | 95.62 | |
| d2ewsa1 | 267 | Type II pantothenate kinase, CoaW {Staphylococcus | 93.27 | |
| d2fxua2 | 225 | Actin {Cow (Bos taurus) [TaxId: 9913]} | 88.62 | |
| d1k8ka2 | 258 | Actin-related protein 3, Arp3 {Cow (Bos taurus) [T | 87.67 | |
| d1ub7a1 | 172 | Ketoacyl-ACP synthase III (FabH) {Thermus thermoph | 85.22 |
| >d1yuwa1 b.130.1.1 (A:385-543) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Heat shock protein 70kD (HSP70), peptide-binding domain superfamily: Heat shock protein 70kD (HSP70), peptide-binding domain family: Heat shock protein 70kD (HSP70), peptide-binding domain domain: DnaK species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.98 E-value=1.4e-32 Score=224.73 Aligned_cols=157 Identities=83% Similarity=1.209 Sum_probs=149.9
Q ss_pred ccccceeeeccceeeEEEEecceeEEEeeCCCCCCceeEEEEeecCCCCCeEEEEEeeccccccCCCceeeEEEecCCCC
Q 020168 74 KVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPP 153 (330)
Q Consensus 74 ~~~~~~~~d~~~~~igi~~~~~~~~~l~~~g~~lP~~~~~~~~~~~d~q~~i~i~i~~g~~~~~~~~~~ig~~~i~~i~~ 153 (330)
.++++.+.|++|+++||.+.+|.+.+|||+|++||++++..|+|..|+|+.+.|.||||++..+.+|.+||+|.|+|+|+
T Consensus 3 ~v~~~~l~DV~p~slGie~~gg~~~~iI~rnt~iP~~~~~~f~T~~d~Q~~v~i~i~qGe~~~~~~n~~lg~f~l~~ip~ 82 (159)
T d1yuwa1 3 NVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTIPTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPP 82 (159)
T ss_dssp CTTSSCCCCBCSSCEEEEETTTEEEEEECTTCBSSEEEEEEEEESSTTCSEEEEEEEESSSSBGGGSEEEEEEEEECCCC
T ss_pred ccceEEEEEecCCceEEEEcCCEEEEEEcCCcccceeeeEEEeeccCCCcEEEEEEEcCchhhccCccEEEEEEECCCCc
Confidence 47899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCeEEEEEEeeCCccEEEEEEeccCCcceeeeeccCCCCCCHHHHHHHHHHHHHHhhhcHHHHHHHHHHHHHH
Q 020168 154 APRGVPQINVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALE 230 (330)
Q Consensus 154 ~~~~~~~i~v~~~~d~~G~l~v~~~~~~t~~~~~~~i~~~~~~ls~~ei~~~~~~~~~~~~~D~~~~~~~~a~N~LE 230 (330)
.|+|.++|.|+|++|.||+|+|++.+..||+...+.+.+..+.|++++++++++++.++..+|+..+++.++||.||
T Consensus 83 ~~~G~~~I~Vtf~id~nGil~V~A~d~~Tg~~~~i~I~~~~~~Ls~eEIek~i~eae~~~~eDe~~r~~ieakn~lE 159 (159)
T d1yuwa1 83 APRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKNSLE 159 (159)
T ss_dssp CSTTCCCEEEEEEECTTCCEEEEEEETTTCCEEEEEECCCSSCSCHHHHHHHHHHHHHTTTHHHHHTTSSCSCEECS
T ss_pred CCCCCceEEEEEEEcCCCeEEEEEEEcCCCCeEEEEEecCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence 99999999999999999999999999999999999999887889999999999999999999988888777777664
|
| >d1dkza2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u00a2 b.130.1.1 (A:389-503) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ud0a_ a.8.4.1 (A:) DnaK {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bupa2 c.55.1.1 (A:189-381) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1dkgd2 c.55.1.1 (D:186-383) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u00a1 a.8.4.1 (A:504-615) Chaperone protein hscA (Hsc66) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jcea2 c.55.1.1 (A:141-336) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2zgya2 c.55.1.1 (A:158-320) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d2fsja1 c.55.1.12 (A:165-325) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1e4ft2 c.55.1.1 (T:200-390) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} | Back information, alignment and structure |
|---|
| >d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|