Citrus Sinensis ID: 020197

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MYGFARFHKIFSANLLYAASKTYPSNLETTAAANSNVGTGRLGSSICCSHGYLPNPLLEFYPRRTRVTQFVHLRQPKLKKTEVKGRACRANRNFKSSSTTISEEDLDMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDTVRYLWMPRLIERIQANKSSPVATTPELDSAAPAGTATPIATTAATAGSFTTAPIDEPASRFINDIDGGTGQMVMQPLDCSSTTQSESESSSKSTTQSESGSN
cccHHHHHHHHHHHHHHHHHccccccccHHHHHccccccccccccccccccccccccccccccccccccEEEEccccccHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHcccccHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHcccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccEEEEcccccccEEEEEEccccccccccccEcccccccccccccccHccccccccccccHHHHHHHHHHHHHccccccHHcHHHHHHcccccccEcccccccccccccccccHHHHHHHHHHHHHHcccccHHcHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHcccccccccccccHHHcccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MYGFARFHKIFSANLLYAAsktypsnlettaaansnvgtgrlgssiccshgylpnpllefyprrtrvtqfvhlrqpklkktevkgracranrnfksssttiseedldmrkgpwtveedFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLnylrpdvrlgkITLEEQLLILELHSRWGNRWSKLAqhlpgrtdneiKNYWRTRVQKQAKQLKcdvnskqfkDTVRYLWMPRLIERIQanksspvattpeldsaapagtatpiattaatagsfttapidepasrfindidggtgqmvmqpldcssttqsesesssksttqsesgsn
MYGFARFHKIFSANLLYAASKTYPSNLETTAAANSNVGTGRLGSSICCSHGYLPNPLLEFYPRRTRVTQfvhlrqpklkktevkgracranrnfksssttiseedldmrkgpwtveeDFKLINYIVThgegrwnrlARCAGLkrtgkscrlrwlnylrpdvrlgkITLEEQLLILELHSRWGNRWSklaqhlpgrtdneikNYWRTRVQKQakqlkcdvnskqfkdTVRYLWMPRLIERIQANKSSPVATTPELDSAAPAGTATPIATTAATagsfttapidepaSRFINDIDGGTGQMVMQPLDCssttqsesesssksttqsesgsn
MYGFARFHKIFSANLLYAASKTYPSNLETTAAANSNVGTGRLGSSICCSHGYLPNPLLEFYPRRTRVTQFVHLRQPKLKKTEVKGRACRANRNFKSSSTTISEEDLDMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITleeqllilelHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDTVRYLWMPRLIERIQANKSSPVATTPELDSaapagtatpiattaatagsfttaPIDEPASRFINDIDGGTGQMVMQPLDCssttqsesesssksttqsesgsN
**GFARFHKIFSANLLYAASKTYPSNLETTAAANSNVGTGRLGSSICCSHGYLPNPLLEFYPRRTRVTQFVHLRQ***********************************GPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDTVRYLWMPRLIERI*****************************************************************************************
**GFARFHKIFSANLLYAASKTYPSNLETTAA*NSNVGTGRLGSSICCSHGYLPNPLLEFYPRRTRVTQFVHLR************************************GPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQ**********************************************************************************************************************
MYGFARFHKIFSANLLYAASKTYPSNLETTAAANSNVGTGRLGSSICCSHGYLPNPLLEFYPRRTRVTQFVHLRQPKLKKTEVKGRACRANRNFKSSSTTISEEDLDMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDTVRYLWMPRLIERIQANKSSPVATTPELDSAAPAGTATPIATTAATAGSFTTAPIDEPASRFINDIDGGTGQMVMQPL*************************
MYGFARFHKIFSANLLYAASKTYPSNL***************GSSI*C*H*Y*PNPLLEFYPRRTRVTQFVHLRQPKLKKTEVKGRACRANRNFKSSSTTISEEDLDMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQAKQLKCDVNSKQF*********************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYGFARFHKIFSANLLYAASKTYPSNLETTAAANSNVGTGRLGSSICCSHGYLPNPLLEFYPRRTRVTQFVHLRQPKLKKTEVKGRACRANRNFKSSSTTISEEDLDMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQAKQLKCDVNSKQFKDTVRYLWMPRLIERIQANKSSPVATTPELDSAAPAGTATPIATTAATAGSFTTAPIDEPASRFINDIDGGTGQMVMQPLDCSSTTQSESESSSKSTTQSESGSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query329 2.2.26 [Sep-21-2011]
P81391205 Myb-related protein 305 O N/A no 0.337 0.541 0.774 4e-49
Q9LK95226 Transcription factor MYB2 no no 0.334 0.486 0.754 2e-48
P81396198 Myb-related protein 340 O N/A no 0.337 0.560 0.767 5e-48
Q9LX82256 Transcription factor MYB4 no no 0.328 0.421 0.601 1e-36
Q4JL84235 Transcription factor MYB5 no no 0.334 0.468 0.590 2e-36
Q53NK6237 Myb-related protein MYBAS no no 0.358 0.497 0.545 2e-35
Q4JL76242 Myb-related protein MYBAS no no 0.349 0.475 0.567 3e-35
Q0JIC2 553 Transcription factor GAMY no no 0.313 0.186 0.572 4e-35
A2WW87 553 Transcription factor GAMY N/A no 0.313 0.186 0.572 5e-35
P81394268 Myb-related protein 315 O N/A no 0.364 0.447 0.541 3e-34
>sp|P81391|MYB05_ANTMA Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1 Back     alignment and function desciption
 Score =  195 bits (495), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 98/111 (88%)

Query: 104 EDLDMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRL 163
           +D+++RKGPWT+EED  LINYI  HGEG WN LAR AGLKRTGKSCRLRWLNYLRPDVR 
Sbjct: 9   QDVEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWLNYLRPDVRR 68

Query: 164 GKITLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQAKQ 214
           G IT EEQLLI+ELH++WGNRWSK+A+ LPGRTDNEIKNYWRTR+QK  +Q
Sbjct: 69  GNITPEEQLLIMELHAKWGNRWSKIAKTLPGRTDNEIKNYWRTRIQKHMEQ 119
Transcription factor.
Antirrhinum majus (taxid: 4151)
>sp|Q9LK95|MYB21_ARATH Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1 Back     alignment and function description
>sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 Back     alignment and function description
>sp|Q9LX82|MYB48_ARATH Transcription factor MYB48 OS=Arabidopsis thaliana GN=MYB48 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL84|MYB59_ARATH Transcription factor MYB59 OS=Arabidopsis thaliana GN=MYB59 PE=2 SV=2 Back     alignment and function description
>sp|Q53NK6|MYBA1_ORYSJ Myb-related protein MYBAS1 OS=Oryza sativa subsp. japonica GN=MYBAS1 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica GN=MYBAS2 PE=2 SV=1 Back     alignment and function description
>sp|Q0JIC2|GAM1_ORYSJ Transcription factor GAMYB OS=Oryza sativa subsp. japonica GN=GAM1 PE=2 SV=1 Back     alignment and function description
>sp|A2WW87|GAM1_ORYSI Transcription factor GAMYB OS=Oryza sativa subsp. indica GN=GAM1 PE=2 SV=1 Back     alignment and function description
>sp|P81394|MYB15_ANTMA Myb-related protein 315 OS=Antirrhinum majus GN=MYB315 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
224099087321 predicted protein [Populus trichocarpa] 0.620 0.635 0.665 6e-73
224112034316 predicted protein [Populus trichocarpa] 0.413 0.430 0.911 4e-72
295913101187 transcription factor [Lycoris longituba] 0.525 0.925 0.715 4e-69
228480908306 R2R3 transcription factor MYB108-like pr 0.440 0.473 0.875 1e-67
225432059306 PREDICTED: uncharacterized protein LOC10 0.440 0.473 0.875 1e-67
147773545306 hypothetical protein VITISV_029107 [Viti 0.440 0.473 0.875 2e-67
449466201263 PREDICTED: transcription repressor MYB6- 0.580 0.726 0.695 1e-66
449516958263 PREDICTED: transcription repressor MYB6- 0.580 0.726 0.695 1e-66
115474203300 Os07g0688200 [Oryza sativa Japonica Grou 0.477 0.523 0.738 1e-66
24059885298 putative typical P-type R2R3 Myb protein 0.477 0.526 0.738 1e-66
>gi|224099087|ref|XP_002311369.1| predicted protein [Populus trichocarpa] gi|222851189|gb|EEE88736.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  280 bits (716), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 141/212 (66%), Positives = 159/212 (75%), Gaps = 8/212 (3%)

Query: 107 DMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKI 166
           D+R+GPWTVEEDFKLINYI THGEGRWN LARCAGLKRTGKSCRLRWLNYLRPDVR G I
Sbjct: 26  DLRRGPWTVEEDFKLINYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYLRPDVRRGNI 85

Query: 167 TLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQAKQLKCDVNSKQFKD 226
           TLEEQL+ILELHSRWGNRWSK+AQHLPGRTDNEIKNYWRTRVQK AKQLKCDVNSKQFKD
Sbjct: 86  TLEEQLMILELHSRWGNRWSKIAQHLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSKQFKD 145

Query: 227 TVRYLWMPRLIERIQ--ANKSSPVATTPELDSAAPAGTATPIATTAATAGSFTTAPIDEP 284
           T+RYLWMPRL+ERIQ  A  ++  ++T     +APA     I+      G+   AP    
Sbjct: 146 TMRYLWMPRLVERIQAAAATATNTSSTSTATVSAPATNQHSISNRDVGTGNLVMAP---- 201

Query: 285 ASRFINDIDGGTGQMVMQPLDCSSTTQSESES 316
               IN  D G   +       +S+T + S+S
Sbjct: 202 --HGINGNDFGVSHVTQSYTPENSSTAASSDS 231

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224112034|ref|XP_002316060.1| predicted protein [Populus trichocarpa] gi|222865100|gb|EEF02231.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|295913101|gb|ADG57813.1| transcription factor [Lycoris longituba] Back     alignment and taxonomy information
>gi|228480908|gb|ACQ42220.1| R2R3 transcription factor MYB108-like protein 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225432059|ref|XP_002280500.1| PREDICTED: uncharacterized protein LOC100248153 [Vitis vinifera] gi|296083206|emb|CBI22842.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147773545|emb|CAN63179.1| hypothetical protein VITISV_029107 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449466201|ref|XP_004150815.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449516958|ref|XP_004165513.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|115474203|ref|NP_001060700.1| Os07g0688200 [Oryza sativa Japonica Group] gi|113612236|dbj|BAF22614.1| Os07g0688200 [Oryza sativa Japonica Group] gi|215737161|dbj|BAG96090.1| unnamed protein product [Oryza sativa Japonica Group] gi|323388857|gb|ADX60233.1| MYB transcription factor [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|24059885|dbj|BAC21351.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica Group] gi|50509163|dbj|BAD30303.1| putative typical P-type R2R3 Myb protein [Oryza sativa Japonica Group] gi|125559670|gb|EAZ05206.1| hypothetical protein OsI_27405 [Oryza sativa Indica Group] gi|125601579|gb|EAZ41155.1| hypothetical protein OsJ_25652 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
TAIR|locus:2084269323 MYB108 "myb domain protein 108 0.452 0.461 0.746 7.9e-62
TAIR|locus:2202633243 MYB112 "myb domain protein 112 0.504 0.683 0.644 1.5e-58
TAIR|locus:2065226273 MYB2 "AT2G47190" [Arabidopsis 0.483 0.582 0.645 6.1e-55
TAIR|locus:2199357286 MYB62 "myb domain protein 62" 0.468 0.538 0.610 7.2e-52
TAIR|locus:2032975283 MYB116 "myb domain protein 116 0.465 0.540 0.580 2e-47
TAIR|locus:2089159226 MYB21 "myb domain protein 21" 0.361 0.526 0.663 8.4e-42
TAIR|locus:2170573214 MYB24 "myb domain protein 24" 0.352 0.542 0.663 4.6e-41
TAIR|locus:2084168206 MYB57 "myb domain protein 57" 0.361 0.577 0.630 2.6e-40
TAIR|locus:2087183269 MYB305 "myb domain protein 305 0.319 0.390 0.647 1.3e-36
TAIR|locus:2140847261 MYB79 "myb domain protein 79" 0.319 0.402 0.638 2.7e-36
TAIR|locus:2084269 MYB108 "myb domain protein 108" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 632 (227.5 bits), Expect = 7.9e-62, P = 7.9e-62
 Identities = 112/150 (74%), Positives = 129/150 (86%)

Query:   103 EEDLDMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVR 162
             E+++D+++GPWT EEDFKL+NYI T+GEGRWN L+RCAGL+RTGKSCRLRWLNYLRPDVR
Sbjct:    14 EDEMDLKRGPWTAEEDFKLMNYIATNGEGRWNSLSRCAGLQRTGKSCRLRWLNYLRPDVR 73

Query:   163 LGKITXXXXXXXXXXHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQAKQLKCDVNSK 222
              G IT          HSRWGNRWSK+AQ+LPGRTDNEIKNYWRTRVQK AKQLKCDVNS+
Sbjct:    74 RGNITLEEQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQ 133

Query:   223 QFKDTVRYLWMPRLIERIQ-ANKSSPVATT 251
             QFKDT++YLWMPRL+ERIQ A+ SS  A T
Sbjct:   134 QFKDTMKYLWMPRLVERIQSASASSAAAAT 163
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009620 "response to fungus" evidence=IMP
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP;RCA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP;RCA
GO:0007165 "signal transduction" evidence=RCA
GO:0009407 "toxin catabolic process" evidence=RCA
GO:0009414 "response to water deprivation" evidence=RCA
GO:0009611 "response to wounding" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009733 "response to auxin stimulus" evidence=RCA
GO:0009738 "abscisic acid mediated signaling pathway" evidence=RCA
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA
GO:0010583 "response to cyclopentenone" evidence=RCA
GO:0042538 "hyperosmotic salinity response" evidence=RCA
GO:0052542 "defense response by callose deposition" evidence=RCA
TAIR|locus:2202633 MYB112 "myb domain protein 112" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065226 MYB2 "AT2G47190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2199357 MYB62 "myb domain protein 62" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2032975 MYB116 "myb domain protein 116" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089159 MYB21 "myb domain protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170573 MYB24 "myb domain protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084168 MYB57 "myb domain protein 57" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2087183 MYB305 "myb domain protein 305" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2140847 MYB79 "myb domain protein 79" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 4e-41
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 1e-39
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 4e-15
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-12
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 3e-12
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 2e-11
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-09
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-09
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 9e-09
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 1e-08
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 3e-04
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information 
 Score =  143 bits (362), Expect = 4e-41
 Identities = 67/116 (57%), Positives = 83/116 (71%)

Query: 96  SSSTTISEEDLDMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLN 155
           S  TT     + M++GPWTVEED  L+++I   GEGRW  L + AGL R GKSCRLRW+N
Sbjct: 11  SKKTTPCCTKMGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMN 70

Query: 156 YLRPDVRLGKITLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQ 211
           YLRP V+ G IT +E+ LIL LH   GNRWS +A  +PGRTDNEIKNYW T ++K+
Sbjct: 71  YLRPSVKRGGITSDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKK 126

Length = 249
>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 329
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.98
PLN03091 459 hypothetical protein; Provisional 99.97
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.9
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.87
PLN03212249 Transcription repressor MYB5; Provisional 99.78
PLN03091 459 hypothetical protein; Provisional 99.76
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.69
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.66
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.55
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.54
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.53
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.47
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.34
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.21
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.15
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.11
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.1
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.05
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.03
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.0
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.97
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.92
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.85
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.42
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.3
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.29
KOG1279506 consensus Chromatin remodeling factor subunit and 97.18
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.12
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.95
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.86
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.8
KOG1279506 consensus Chromatin remodeling factor subunit and 96.72
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.68
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.51
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.36
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.27
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 96.07
PRK13923170 putative spore coat protein regulator protein YlbO 95.94
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.78
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.77
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 94.58
PRK13923170 putative spore coat protein regulator protein YlbO 94.54
PLN031421033 Probable chromatin-remodeling complex ATPase chain 94.43
KOG2656 445 consensus DNA methyltransferase 1-associated prote 93.9
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 92.35
KOG1194 534 consensus Predicted DNA-binding protein, contains 90.47
KOG4282 345 consensus Transcription factor GT-2 and related pr 90.46
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 89.88
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 89.18
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 88.8
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 87.61
KOG4167 907 consensus Predicted DNA-binding protein, contains 85.44
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 84.23
KOG4282345 consensus Transcription factor GT-2 and related pr 83.71
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information 
Probab=100.00  E-value=8.3e-34  Score=257.93  Aligned_cols=114  Identities=57%  Similarity=1.040  Sum_probs=108.4

Q ss_pred             cCCccCCCCHHHHHHHHHHHHHcCCCchhhhccccCCccCchhhhhhhccccCCccccCcccHHHHHHHHHHHHhhCCcc
Q 020197          106 LDMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITLEEQLLILELHSRWGNRW  185 (329)
Q Consensus       106 ~~~~kg~WT~eED~~L~~~v~~~g~~~W~~IA~~~~~~Rt~~qcr~Rw~n~L~p~~k~g~WT~eEd~~Ll~~v~~~G~~W  185 (329)
                      +++++++||+|||++|+++|++||..+|..||+.++++|+++|||+||.|+|+|.+++++||+|||++|++++.+||++|
T Consensus        21 ~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~lLlel~~~~GnKW  100 (249)
T PLN03212         21 MGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDLILRLHRLLGNRW  100 (249)
T ss_pred             CCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHHHHHHHHhccccH
Confidence            78999999999999999999999988999999999669999999999999999999999999999999999999999999


Q ss_pred             hhhcccCCCCCHHHHHHHHHHHHHHHHHhccccc
Q 020197          186 SKLAQHLPGRTDNEIKNYWRTRVQKQAKQLKCDV  219 (329)
Q Consensus       186 ~~Ia~~lpgRt~~~~k~rw~~~l~~~~kk~~~~~  219 (329)
                      ..||..|+|||+++||+||+.++++.+.+.....
T Consensus       101 s~IAk~LpGRTDnqIKNRWns~LrK~l~r~~i~p  134 (249)
T PLN03212        101 SLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDP  134 (249)
T ss_pred             HHHHhhcCCCCHHHHHHHHHHHHhHHHHhcCCCC
Confidence            9999999999999999999999999887765443

>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 4e-18
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 1e-17
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 2e-17
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 2e-17
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 2e-17
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 4e-11
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 3e-09
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 8e-08
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 4e-06
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 7e-06
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 7e-06
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 3e-05
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 4e-05
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure 
Iteration: 1

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 68/107 (63%), Gaps = 3/107 (2%)
Query: 107 DMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLK-RTGKSCRLRWLNYLRPDVRLGK 165
           ++ KGPWT EED ++I ++  +G  RW+ +A+   LK R GK CR RW N+L P+V+   
Sbjct: 24  ELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAK--HLKGRIGKQCRERWHNHLNPEVKKTS 81
Query: 166 ITXXXXXXXXXXHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQA 212
            T          H R GNRW+++A+ LPGRTDN +KN+W + ++++ 
Sbjct: 82  WTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKV 128
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 4e-54
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 1e-53
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 1e-52
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 1e-51
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-47
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-46
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 9e-28
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 1e-06
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 3e-24
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 3e-21
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 1e-19
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 9e-16
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 3e-12
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 2e-11
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 4e-11
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 1e-09
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 1e-09
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 1e-08
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-08
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 3e-07
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 3e-07
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 4e-07
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 4e-06
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 4e-04
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 5e-06
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 5e-06
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 5e-05
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 1e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  171 bits (436), Expect = 4e-54
 Identities = 46/105 (43%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 107 DMRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKI 166
           ++ KGPWT EED ++I  +  +G  RW+ +A+     R GK CR RW N+L P+V+    
Sbjct: 1   ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSW 59

Query: 167 TLEEQLLILELHSRWGNRWSKLAQHLPGRTDNEIKNYWRTRVQKQ 211
           T EE  +I + H R GNRW+++A+ LPGRTDN IKN+W + ++++
Sbjct: 60  TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK 104
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 100.0
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.98
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.98
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.96
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.89
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.86
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.85
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.85
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.83
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.83
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.77
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.75
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.73
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.73
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.72
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.71
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.69
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.68
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.66
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.64
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.63
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.62
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.61
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.6
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.59
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.59
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.58
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.58
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.57
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.56
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.56
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.55
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.53
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.52
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.52
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.51
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.49
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.48
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.48
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.46
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.16
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.42
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.42
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.12
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.35
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.28
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.22
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.21
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.17
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.15
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.14
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.13
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.1
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.09
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.99
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.89
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.88
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.87
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.75
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.73
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.66
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.59
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.58
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.45
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.44
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.43
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.3
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.18
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.11
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.03
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.97
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.94
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.92
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.09
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.84
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.8
2crg_A70 Metastasis associated protein MTA3; transcription 97.59
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.59
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.47
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.37
2crg_A70 Metastasis associated protein MTA3; transcription 97.33
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.29
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.26
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.13
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.08
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 96.0
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.68
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.27
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 92.96
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 92.93
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 92.84
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 92.52
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 91.25
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
Probab=100.00  E-value=5.6e-40  Score=284.58  Aligned_cols=154  Identities=36%  Similarity=0.603  Sum_probs=112.2

Q ss_pred             hcccccccccccccccccccCCCCchhHhhhCCCCCCccceeeeeeccccchhhccccccccccCCCCCccccccCcCCc
Q 020197           30 TAAANSNVGTGRLGSSICCSHGYLPNPLLEFYPRRTRVTQFVHLRQPKLKKTEVKGRACRANRNFKSSSTTISEEDLDMR  109 (329)
Q Consensus        30 ~~~~~~~~~~~~~~~~~~~~~~~~W~~Ia~~~~~r~~~~qc~~r~~~~lk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  109 (329)
                      ..+.|+..+|+.|+.+|..++..+|..||++||+|+.. ||..||...|+                          |.++
T Consensus         5 ~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~~Rt~~-qcr~Rw~~~l~--------------------------p~~~   57 (159)
T 1h89_C            5 GKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTDV-QCQHRWQKVLN--------------------------PELI   57 (159)
T ss_dssp             ---------------------------------------CHHHHHHTTTC--------------------------TTCC
T ss_pred             CCCCCCHHHHHHHHHHHHHhCCCCHHHHHHHcCCCCHH-HHHHHHHHccC--------------------------CCcC
Confidence            35678899999999999999989999999999999988 99999999999                          9999


Q ss_pred             cCCCCHHHHHHHHHHHHHcCCCchhhhccccCCccCchhhhhhhccccCCccccCcccHHHHHHHHHHHHhhCCcchhhc
Q 020197          110 KGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITLEEQLLILELHSRWGNRWSKLA  189 (329)
Q Consensus       110 kg~WT~eED~~L~~~v~~~g~~~W~~IA~~~~~~Rt~~qcr~Rw~n~L~p~~k~g~WT~eEd~~Ll~~v~~~G~~W~~Ia  189 (329)
                      +|+||+|||++|+++|.+||..+|..||..|+ +|++.||++||.++|+|.+++++||+|||.+|++++.+||++|..||
T Consensus        58 ~~~Wt~eEd~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~~~WT~eEd~~L~~~~~~~g~~W~~Ia  136 (159)
T 1h89_C           58 KGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIA  136 (159)
T ss_dssp             CSCCCHHHHHHHHHHHHHHCSCCHHHHHHTST-TCCHHHHHHHHHHTTCTTSCCSCCCHHHHHHHHHHHHHHCSCHHHHH
T ss_pred             CCCCChHHHHHHHHHHHHhCcccHHHHHHHcC-CCCHHHHHHHHHHHhCccccccCCChHHHHHHHHHHHHHCCCHHHHH
Confidence            99999999999999999999878999999999 99999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCHHHHHHHHHHHHHHH
Q 020197          190 QHLPGRTDNEIKNYWRTRVQKQ  211 (329)
Q Consensus       190 ~~lpgRt~~~~k~rw~~~l~~~  211 (329)
                      +.|||||+++|++||+.++++.
T Consensus       137 ~~l~gRt~~~~knr~~~~~r~~  158 (159)
T 1h89_C          137 KLLPGRTDNAIKNHWNSTMRRK  158 (159)
T ss_dssp             TTSTTCCHHHHHHHHHTTTCC-
T ss_pred             HHCCCCCHHHHHHHHHHHHhcc
Confidence            9999999999999999887654
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 329
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-18
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 9e-07
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 3e-18
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-07
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 3e-18
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 9e-15
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 4e-04
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 9e-15
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 6e-14
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 1e-08
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-11
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 7e-09
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 6e-11
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-10
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 3e-04
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-10
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 8e-07
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-05
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-10
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 4e-07
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 7e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-07
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 3e-05
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 0.002
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 75.5 bits (186), Expect = 2e-18
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 108 MRKGPWTVEEDFKLINYIVTHGEGRWNRLARCAGLKRTGKSCRLRWLNYLRPD 160
           + KGPWT EED +LI  +  +G  RW+ +A+     R GK CR RW N+L P+
Sbjct: 1   LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.78
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.77
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.72
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.64
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.62
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.61
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.59
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.59
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.54
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.53
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.52
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.46
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.44
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.44
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.42
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.4
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.37
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.34
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.33
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.32
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.29
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.24
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.12
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.08
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.06
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.04
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.02
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.95
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.16
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.15
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.13
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.88
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.33
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.18
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.99
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.53
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.43
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 96.15
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.87
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 95.38
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 87.54
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 86.95
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 83.62
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: DNA-binding domain of rap1
domain: DNA-binding domain of rap1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.78  E-value=2.2e-21  Score=149.24  Aligned_cols=69  Identities=19%  Similarity=0.214  Sum_probs=64.0

Q ss_pred             cCCCCHHHHHHHHHHHHHcCCC-----chhhhccccCCccCchhhhhhhccccCCccccCcccHHHHHHHHHHHH
Q 020197          110 KGPWTVEEDFKLINYIVTHGEG-----RWNRLARCAGLKRTGKSCRLRWLNYLRPDVRLGKITLEEQLLILELHS  179 (329)
Q Consensus       110 kg~WT~eED~~L~~~v~~~g~~-----~W~~IA~~~~~~Rt~~qcr~Rw~n~L~p~~k~g~WT~eEd~~Ll~~v~  179 (329)
                      |++||+|||++|+++|.+||..     +|.+||+.|| |||++||++||+++|+|.++++.||.+||.+|+....
T Consensus         1 k~~WT~eED~~L~~~v~~~g~~~~~~~~W~~IA~~lp-gRt~~qcr~Rw~~~L~p~l~~~~~t~~ed~ll~d~~~   74 (86)
T d1igna1           1 KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVP-NHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDG   74 (86)
T ss_dssp             CCCCCHHHHHHHHHHHHTSGGGTTCSHHHHHHTTTST-TSCHHHHHHHHHHTTGGGCCCEECBCTTSCBCBCTTS
T ss_pred             CCCCCHHHHHHHHHHHHHhCcCcCCccCHHHHHHHcC-CCCHHHHHHHHHHHcCccccCCCCCCchhHHHHHHhh
Confidence            5789999999999999999974     3999999999 9999999999999999999999999999998877543
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure