Citrus Sinensis ID: 020274


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MTNFVLKNSYLHGFSTFVPLPAPNSILFGTSTSKVLVSSRQGSVGLSVTDKQLIKVRFCAVESKQEALLQTQMGEWEDPDDGSGSEYDDDDDDDEEGEVKENDLDFESDWEEERSGIGAAASGDAATTISKYEEDLLKEVEQLLEPEEREILNQNATPNLGKISTAKWRPLQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLKILPVE
ccccccccccccccccccccccccccccccEEEEHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHcHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccccHHHHHHHHHHcccc
ccEEEEccccccccccccccccHHHHHccHHHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccHEcccccccccHHHHHHHcccHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHHcccc
mtnfvlknsylhgfstfvplpapnsilfgtstSKVLVssrqgsvglsvtdkQLIKVRFCAVESKQEALLQTQmgewedpddgsgseydddddddeegevkendldfesdweeersgigaaasgdaaTTISKYEEDLLKEVEQLLEPEereilnqnatpnlgkistakwrplqtLTLSMQIRYMDMLLdggldidsvdkDGLTALHKAIIGKKEAVISHLLrkganphvkdgdgatplHYAVQVGAMQSVKLLIKYNVDvnvadnegwtplHIAIQSRNRDIAKVLLIngadksrktkdgktALDMslcygrdfksYDLAKLLKILPVE
MTNFVLKNSYLHGFSTFVPLPAPNSILFGTSTSKVLVSsrqgsvglsvtdkqLIKVRFCAVESKQEALLQtqmgewedpddgsGSEYDDDDDDDEEGevkendldfesdwEEERSgigaaasgdaaTTISKYEEDLLKEVEQLLEPeereilnqnatpnlgkistakwrplQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLingadksrktkdgktaldmslcygrdfksydLAKLLKILPVE
MTNFVLKNSYLHGFSTFVPLPAPNSILFGTSTSKVLVSSRQGSVGLSVTDKQLIKVRFCAVESKQEALLQTQMGEWedpddgsgseydddddddeegeVKENDLDFESDWEEERsgigaaasgdaattisKYEEDllkeveqllepeereilNQNATPNLGKISTAKWRPLQTLTLSMQIRYmdmlldggldIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLKILPVE
***FVLKNSYLHGFSTFVPLPAPNSILFGTSTSKVLVSSRQGSVGLSVTDKQLIKVRFCAVES***********************************************************************************************NLGKISTAKWRPLQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGA**********TALDMSLCYGRDFKSYDLAKLLKIL***
**N****NSYLHGFSTFVPLPAPNSILFGTSTSKVLVSSRQ******VTDKQLIKVRFCAVESKQEALLQTQMGEWEDPDDGSGSEYDDDDDDDEEGEVKENDLDFESDWEEERSGIGAAASGDAATTISKYEEDLLKEVEQLLEPEEREILNQNATPNLGKISTAKWRPLQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLKILPV*
MTNFVLKNSYLHGFSTFVPLPAPNSILFGTSTSKVLVSSRQGSVGLSVTDKQLIKVRFCAVESKQEALLQTQMGE*************************ENDLDFESDWEEERSGIGAAASGDAATTISKYEEDLLKEVEQLLEPEEREILNQNATPNLGKISTAKWRPLQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLKILPVE
MTNFVLKNSYLHGFSTFVPLPAPNSILFGTSTSKVLVSSRQGSVGLSVTDKQLIKVRFCAVESKQEALLQTQMGEWEDPDDGSGSEYDDDDDDDEEGEVKENDLDFESDWEEERSGIGAAASGDAATTISKYEEDLLKEVEQLLEPEEREILNQNATPNLGKISTAKWRPLQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLKILP**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTNFVLKNSYLHGFSTFVPLPAPNSILFGTSTSKVLVSSRQGSVGLSVTDKQLIKVRFCAVESKQEALLQTQMGEWEDPDDGSGSEYDDDDDDDEEGEVKENDLDFESDWEEERSGIGAAASGDAATTISKYEEDLLKEVEQLLEPEEREILNQNATPNLGKISTAKWRPLQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLKILPVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query328 2.2.26 [Sep-21-2011]
Q9SQK3315 Ankyrin repeat domain-con yes no 0.896 0.933 0.608 3e-97
Q05753435 Ankyrin repeat domain-con no no 0.567 0.427 0.481 1e-45
Q4UMH61179 Putative ankyrin repeat p yes no 0.432 0.120 0.363 9e-18
Q54HW1232 26S proteasome non-ATPase yes no 0.420 0.594 0.359 2e-17
P16157 1881 Ankyrin-1 OS=Homo sapiens yes no 0.469 0.081 0.320 2e-16
Q01484 3957 Ankyrin-2 OS=Homo sapiens no no 0.371 0.030 0.365 3e-16
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus yes no 0.371 0.031 0.365 3e-16
Q8BZ25 745 Ankyrin repeat and protei yes no 0.426 0.187 0.330 6e-16
Q07E28 1658 Cortactin-binding protein N/A no 0.457 0.090 0.356 8e-16
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no no 0.484 0.081 0.293 8e-16
>sp|Q9SQK3|EM506_ARATH Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 Back     alignment and function desciption
 Score =  355 bits (910), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 188/309 (60%), Positives = 226/309 (73%), Gaps = 15/309 (4%)

Query: 20  LPAPNSILFGTSTSKVLVSSRQGSVGLSVTDKQLIKVRFCAVESKQEALLQTQMGEWEDP 79
           LP  +S+   +     L +S +GS   SV  +   + R     +++   +Q++   WEDP
Sbjct: 18  LPISDSVNCKSKIVYCLSTSVRGS---SVKRQSTARTRSFTETNRRTPSVQSKHEFWEDP 74

Query: 80  DDGSGSEYDDDDDD-DEEGEVKENDLDFESDWEEERSGIGAAASGDAATTISKYEEDLLK 138
           DDGS SE + + ++ D  G    NDLD ESDWE++       +     TT   YEE+L K
Sbjct: 75  DDGSDSENEYEGEEEDGIG----NDLDNESDWEDD-------SRVQKLTTTDNYEEELAK 123

Query: 139 EVEQLLEPEEREILNQNATPNLGKISTAKWRPLQTLTLSMQIRYMDMLLDGGLDIDSVDK 198
           EVEQLLEPEER IL QN  PNL  IST  W+PLQTL LSMQI+ MD L++ GLDID VDK
Sbjct: 124 EVEQLLEPEERVILQQNEKPNLKMISTKSWKPLQTLALSMQIQLMDNLIENGLDIDDVDK 183

Query: 199 DGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVD 258
           D  TALHKAIIGKKEAVISHLLRKGANPH++D DGA P+HYAVQVGA+Q+VKLL KYNVD
Sbjct: 184 DNQTALHKAIIGKKEAVISHLLRKGANPHLQDRDGAAPIHYAVQVGALQTVKLLFKYNVD 243

Query: 259 VNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDL 318
           VNVADNEGWTPLHIA+QSRNRDI K+LL NGADK+R+TKDGK ALD++LC+GRDFKSYDL
Sbjct: 244 VNVADNEGWTPLHIAVQSRNRDITKILLTNGADKTRRTKDGKLALDLALCFGRDFKSYDL 303

Query: 319 AKLLKILPV 327
            KLLKI+P 
Sbjct: 304 VKLLKIMPT 312




Involved in the initial differentiation of the proplastid during the embryo development. Also required for correct cotyledon, true leaf and cauline leaf margin development.
Arabidopsis thaliana (taxid: 3702)
>sp|Q05753|AKRP_ARATH Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 Back     alignment and function description
>sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
255552692343 aberrant large forked product, putative 0.914 0.874 0.600 1e-103
225452545322 PREDICTED: ankyrin repeat domain-contain 0.820 0.835 0.72 1e-102
224060757255 predicted protein [Populus trichocarpa] 0.777 1.0 0.725 1e-100
449492678319 PREDICTED: ankyrin repeat domain-contain 0.923 0.949 0.598 1e-100
449449192319 PREDICTED: ankyrin repeat domain-contain 0.923 0.949 0.595 1e-99
296087710232 unnamed protein product [Vitis vinifera] 0.692 0.978 0.763 1e-95
15242597315 ankyrin repeat domain-containing protein 0.896 0.933 0.608 2e-95
224097124226 predicted protein [Populus trichocarpa] 0.685 0.995 0.737 5e-93
124359844317 Ankyrin [Medicago truncatula] 0.887 0.917 0.575 1e-90
356537833391 PREDICTED: ankyrin repeat domain-contain 0.966 0.810 0.590 2e-90
>gi|255552692|ref|XP_002517389.1| aberrant large forked product, putative [Ricinus communis] gi|223543400|gb|EEF44931.1| aberrant large forked product, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/333 (60%), Positives = 234/333 (70%), Gaps = 33/333 (9%)

Query: 20  LPAPN-SILFGTSTSKVLVSSRQGSVGLSVTDKQLIKVRFCAVESKQEALLQTQMGEWED 78
           LP P  +   GTST   L  +  GS    + +K   K+  C VESK     +   G WED
Sbjct: 13  LPLPRFAATPGTSTGTNLFKASTGSFDFLLANK-CRKLTTCRVESKWAYPSERLPGVWED 71

Query: 79  PDDGSGSEYDDDDDDDEEGEVKENDLDFESDWEEERSGIGAAASGDAAT----------- 127
           PDDGSGS+YD      E  E++END+D+ESDWEEE          D +T           
Sbjct: 72  PDDGSGSDYD------EVEELEENDMDYESDWEEETYAKSTTRIVDYSTSNNYEEDSEEA 125

Query: 128 --------------TISKYEEDLLKEVEQLLEPEEREILNQNATPNLGKISTAKWRPLQT 173
                         T   YEEDL KE+ QLL+PEER IL QNAT NL K+STAKW+PLQT
Sbjct: 126 TYVASTSTTTVRNSTSKNYEEDLSKEIIQLLQPEERAILQQNATYNLDKLSTAKWKPLQT 185

Query: 174 LTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDG 233
           L LS QIR+MD LL  GLDIDSVDKDGLTALHKAI+GKKEAVISHLLRKGANPHVKD DG
Sbjct: 186 LALSGQIRFMDKLLADGLDIDSVDKDGLTALHKAIVGKKEAVISHLLRKGANPHVKDRDG 245

Query: 234 ATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKS 293
           A+ LHYAVQ+GA+Q+VKLLIKYNVD+NVADNEGWTPLH+A+Q+R RDI KVLL+NGADK+
Sbjct: 246 ASSLHYAVQIGALQTVKLLIKYNVDINVADNEGWTPLHVAVQTRKRDIVKVLLVNGADKN 305

Query: 294 RKTKDGKTALDMSLCYGRDFKSYDLAKLLKILP 326
           RK KDG T +D+ LCYG+DFKSYDLAKL+K++P
Sbjct: 306 RKNKDGMTPVDLCLCYGKDFKSYDLAKLVKVVP 338




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225452545|ref|XP_002275234.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic [Vitis vinifera] gi|147786877|emb|CAN75542.1| hypothetical protein VITISV_022633 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224060757|ref|XP_002300264.1| predicted protein [Populus trichocarpa] gi|222847522|gb|EEE85069.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449492678|ref|XP_004159069.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449449192|ref|XP_004142349.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|296087710|emb|CBI34966.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|15242597|ref|NP_198832.1| ankyrin repeat domain-containing protein EMB506 [Arabidopsis thaliana] gi|75313777|sp|Q9SQK3.1|EM506_ARATH RecName: Full=Ankyrin repeat domain-containing protein EMB506, chloroplastic; AltName: Full=Protein EMBRYO DEFECTIVE 506; Flags: Precursor gi|5911312|gb|AAD55746.1|AF026167_1 ankyrin repeat protein EMB506 [Arabidopsis thaliana] gi|10177503|dbj|BAB10897.1| ankyrin repeat protein EMB506 [Arabidopsis thaliana] gi|17380824|gb|AAL36099.1| putative ankyrin repeat protein EMB506 [Arabidopsis thaliana] gi|21436371|gb|AAM51355.1| putative ankyrin repeat protein EMB506 [Arabidopsis thaliana] gi|332007132|gb|AED94515.1| ankyrin repeat domain-containing protein EMB506 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224097124|ref|XP_002334642.1| predicted protein [Populus trichocarpa] gi|222873864|gb|EEF10995.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|124359844|gb|ABD32433.2| Ankyrin [Medicago truncatula] Back     alignment and taxonomy information
>gi|356537833|ref|XP_003537429.1| PREDICTED: ankyrin repeat domain-containing protein EMB506, chloroplastic-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query328
TAIR|locus:2173767315 EMB506 "embryo defective 506" 0.664 0.692 0.631 2.6e-70
TAIR|locus:505006718435 AKRP "ankyrin repeat protein" 0.518 0.390 0.464 9.9e-39
UNIPROTKB|F1NXP5 745 F1NXP5 "Uncharacterized protei 0.338 0.148 0.405 1.1e-17
UNIPROTKB|F1NNF9 765 F1NNF9 "Uncharacterized protei 0.338 0.145 0.405 1.1e-17
UNIPROTKB|F1P1R3189 PSMD10 "Uncharacterized protei 0.448 0.777 0.312 1.8e-16
DICTYBASE|DDB_G0277249282 DDB_G0277249 "ankyrin repeat-c 0.381 0.443 0.365 1.8e-16
UNIPROTKB|J9P7A0 1316 TNKS2 "Uncharacterized protein 0.317 0.079 0.423 5.5e-16
DICTYBASE|DDB_G0289189232 psmD10 "26S proteasome non-ATP 0.460 0.650 0.318 7.7e-16
ZFIN|ZDB-GENE-030131-4865 1267 si:ch211-155m12.3 "si:ch211-15 0.317 0.082 0.442 1.5e-15
UNIPROTKB|G3N3N0 1389 G3N3N0 "Uncharacterized protei 0.344 0.081 0.398 2.2e-15
TAIR|locus:2173767 EMB506 "embryo defective 506" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 712 (255.7 bits), Expect = 2.6e-70, P = 2.6e-70
 Identities = 142/225 (63%), Positives = 160/225 (71%)

Query:   102 NDLDFESDWEEERXXXXXXXXXXXXXXXXKYEEDXXXXXXXXXXXXXXXXXNQNATPNLG 161
             NDLD ESDWE++                  YEE+                  QN  PNL 
Sbjct:    94 NDLDNESDWEDD-------SRVQKLTTTDNYEEELAKEVEQLLEPEERVILQQNEKPNLK 146

Query:   162 KISTAKWRPLQTLTLSMQIRYXXXXXXXXXXIDSVDKDGLTALHKAIIGKKEAVISHLLR 221
              IST  W+PLQTL LSMQI+           ID VDKD  TALHKAIIGKKEAVISHLLR
Sbjct:   147 MISTKSWKPLQTLALSMQIQLMDNLIENGLDIDDVDKDNQTALHKAIIGKKEAVISHLLR 206

Query:   222 KGANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDI 281
             KGANPH++D DGA P+HYAVQVGA+Q+VKLL KYNVDVNVADNEGWTPLHIA+QSRNRDI
Sbjct:   207 KGANPHLQDRDGAAPIHYAVQVGALQTVKLLFKYNVDVNVADNEGWTPLHIAVQSRNRDI 266

Query:   282 AKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLKILP 326
              K+LL NGADK+R+TKDGK ALD++LC+GRDFKSYDL KLLKI+P
Sbjct:   267 TKILLTNGADKTRRTKDGKLALDLALCFGRDFKSYDLVKLLKIMP 311




GO:0005634 "nucleus" evidence=ISM
GO:0009793 "embryo development ending in seed dormancy" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0010027 "thylakoid membrane organization" evidence=RCA
TAIR|locus:505006718 AKRP "ankyrin repeat protein" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXP5 F1NXP5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNF9 F1NNF9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1R3 PSMD10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277249 DDB_G0277249 "ankyrin repeat-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7A0 TNKS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0289189 psmD10 "26S proteasome non-ATPase regulatory subunit 10" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4865 si:ch211-155m12.3 "si:ch211-155m12.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3N3N0 G3N3N0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SQK3EM506_ARATHNo assigned EC number0.60840.89630.9333yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00020794001
SubName- Full=Putative uncharacterized protein (Chromosome chr14 scaffold_21, whole genome shotgun sequence); (322 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-38
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-32
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-23
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-19
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-18
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-16
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 6e-16
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-15
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 7e-15
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 8e-15
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-14
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-14
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 6e-14
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 7e-14
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-13
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-13
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 2e-12
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-12
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-12
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-11
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-11
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-11
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 4e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-10
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-09
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-09
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-09
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 3e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-08
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-08
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-07
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 8e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-06
PHA02884 300 PHA02884, PHA02884, ankyrin repeat protein; Provis 1e-06
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 1e-06
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-06
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 3e-06
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 7e-06
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 7e-06
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-05
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 3e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-05
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 4e-05
PHA02716 764 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provi 5e-05
PHA02859209 PHA02859, PHA02859, ankyrin repeat protein; Provis 6e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 9e-05
smart0024830 smart00248, ANK, ankyrin repeats 9e-05
smart0024830 smart00248, ANK, ankyrin repeats 1e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 3e-04
PHA02917 661 PHA02917, PHA02917, ankyrin-like protein; Provisio 4e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 5e-04
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
pfam10446 449 pfam10446, DUF2457, Protein of unknown function (D 0.001
PHA02791284 PHA02791, PHA02791, ankyrin-like protein; Provisio 0.001
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  132 bits (335), Expect = 1e-38
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 4/129 (3%)

Query: 194 DSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLI 253
           ++ D+DG T LH A       V+  LL  GA+ + KD DG TPLH A + G ++ VKLL+
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLL 60

Query: 254 KYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDF 313
           +   DVN  D +G TPLH+A ++ N D+ K+LL +GAD + + KDG+T L ++   G   
Sbjct: 61  EKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHL- 119

Query: 314 KSYDLAKLL 322
              ++ KLL
Sbjct: 120 ---EVVKLL 125


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165089 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>gnl|CDD|165195 PHA02859, PHA02859, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165231 PHA02917, PHA02917, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|220759 pfam10446, DUF2457, Protein of unknown function (DUF2457) Back     alignment and domain information
>gnl|CDD|165154 PHA02791, PHA02791, ankyrin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 328
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.98
PHA02859209 ankyrin repeat protein; Provisional 99.97
PHA02874 434 ankyrin repeat protein; Provisional 99.97
PHA02878 477 ankyrin repeat protein; Provisional 99.97
PHA03100 480 ankyrin repeat protein; Provisional 99.97
PHA02875 413 ankyrin repeat protein; Provisional 99.97
PHA02791284 ankyrin-like protein; Provisional 99.97
PHA02874 434 ankyrin repeat protein; Provisional 99.97
PHA03100 480 ankyrin repeat protein; Provisional 99.97
PHA02946 446 ankyin-like protein; Provisional 99.97
PHA02878 477 ankyrin repeat protein; Provisional 99.96
PHA02989 494 ankyrin repeat protein; Provisional 99.96
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.96
PHA02946 446 ankyin-like protein; Provisional 99.96
PHA02798 489 ankyrin-like protein; Provisional 99.96
KOG0508 615 consensus Ankyrin repeat protein [General function 99.96
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.96
PHA03095 471 ankyrin-like protein; Provisional 99.96
PHA02795 437 ankyrin-like protein; Provisional 99.96
PHA03095 471 ankyrin-like protein; Provisional 99.96
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.96
PHA02876 682 ankyrin repeat protein; Provisional 99.95
PHA02798 489 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02917 661 ankyrin-like protein; Provisional 99.95
PHA02876 682 ankyrin repeat protein; Provisional 99.95
PHA02989 494 ankyrin repeat protein; Provisional 99.95
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.94
KOG0508 615 consensus Ankyrin repeat protein [General function 99.94
KOG0510 929 consensus Ankyrin repeat protein [General function 99.94
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.94
KOG0510 929 consensus Ankyrin repeat protein [General function 99.94
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.93
PHA02917 661 ankyrin-like protein; Provisional 99.93
KOG0514452 consensus Ankyrin repeat protein [General function 99.93
PHA02743166 Viral ankyrin protein; Provisional 99.92
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.92
PHA02795 437 ankyrin-like protein; Provisional 99.92
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.91
PHA02730 672 ankyrin-like protein; Provisional 99.91
PHA02741169 hypothetical protein; Provisional 99.91
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.91
PHA02730 672 ankyrin-like protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.9
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02884 300 ankyrin repeat protein; Provisional 99.9
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.89
PHA02792 631 ankyrin-like protein; Provisional 99.89
PHA02736154 Viral ankyrin protein; Provisional 99.89
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.89
PHA02792 631 ankyrin-like protein; Provisional 99.89
PHA02736154 Viral ankyrin protein; Provisional 99.87
PHA02884 300 ankyrin repeat protein; Provisional 99.87
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.86
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.86
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.85
KOG0514452 consensus Ankyrin repeat protein [General function 99.85
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.84
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.84
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.83
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.82
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.81
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.81
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.8
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.8
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.8
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.73
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.72
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.7
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.67
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.67
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.66
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.61
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.59
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.56
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.56
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.54
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.5
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.5
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.49
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.47
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.47
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.45
KOG0783 1267 consensus Uncharacterized conserved protein, conta 99.03
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.98
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.91
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.89
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.88
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.87
PF1360630 Ank_3: Ankyrin repeat 98.87
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.87
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.84
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.82
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.76
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.75
PF1360630 Ank_3: Ankyrin repeat 98.74
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.72
KOG0522 560 consensus Ankyrin repeat protein [General function 98.69
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.66
KOG0522 560 consensus Ankyrin repeat protein [General function 98.65
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.58
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.52
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.5
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.48
KOG2384223 consensus Major histocompatibility complex protein 98.31
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.3
KOG2384 223 consensus Major histocompatibility complex protein 98.25
KOG0511 516 consensus Ankyrin repeat protein [General function 98.2
KOG0511 516 consensus Ankyrin repeat protein [General function 98.18
KOG2505591 consensus Ankyrin repeat protein [General function 97.52
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.19
KOG2505591 consensus Ankyrin repeat protein [General function 96.97
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.87
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.87
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.32
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 94.97
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.86
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 90.22
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 89.02
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 85.4
PF10446 458 DUF2457: Protein of unknown function (DUF2457); In 85.31
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 80.64
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=1.5e-35  Score=240.81  Aligned_cols=175  Identities=27%  Similarity=0.364  Sum_probs=139.8

Q ss_pred             ChHHHHHHHhcCCCCCCCCCCCCCCcHHHHHHHhCCHHHHHHHH-HCCCCCCccCCCCCcHHHHHHHcCCHHHHHHHHHC
Q 020274          144 LEPEEREILNQNATPNLGKISTAKWRPLQTLTLSMQIRYMDMLL-DGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRK  222 (328)
Q Consensus       144 ~~~~v~~lL~~g~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll-~~gadi~~~d~~g~t~L~~A~~~g~~~~v~~Ll~~  222 (328)
                      -...+.++++.....-....+.+|+|||||||..|+.+++.+|+ +.+..+|.+|..||||||.||..|+.++|+.|+.+
T Consensus        15 ~~~kveel~~s~~kSL~~r~dqD~Rt~LHwa~S~g~~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r   94 (226)
T KOG4412|consen   15 EEFKVEELIQSDPKSLNARDDQDGRTPLHWACSFGHVEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNR   94 (226)
T ss_pred             hHHHHHHHHhcChhhhhccccccCCceeeeeeecCchhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcC
Confidence            34455566655442222223458888888888888888888888 56777888888888888888888888888888887


Q ss_pred             -CCCCCCCCCCCChHHHHHHHcCCHHHHHHHHhCCCCccccCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCc
Q 020274          223 -GANPHVKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKT  301 (328)
Q Consensus       223 -g~d~~~~d~~g~tpLh~A~~~g~~~iv~~Ll~~ga~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gad~~~~d~~G~T  301 (328)
                       |+++|..+..|.||||+|+..|..+|+++|+++|+.++++|..|.||||-|+..|..+++++|+..|+.+|.+|+.|+|
T Consensus        95 ~~advna~tn~G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n~qDk~G~T  174 (226)
T KOG4412|consen   95 SGADVNATTNGGQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLNTQDKYGFT  174 (226)
T ss_pred             CCCCcceecCCCcceehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccchhhHHHHHhcCCCCCcccccCcc
Confidence             8888888888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             HHHHHHHcCCCCChHHHHHHH
Q 020274          302 ALDMSLCYGRDFKSYDLAKLL  322 (328)
Q Consensus       302 pL~~A~~~g~~~~~~~i~~lL  322 (328)
                      |||.|..-|+    .++..+|
T Consensus       175 pL~~al~e~~----~d~a~lL  191 (226)
T KOG4412|consen  175 PLHHALAEGH----PDVAVLL  191 (226)
T ss_pred             HHHHHHhccC----chHHHHH
Confidence            8888888887    4444444



>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF10446 DUF2457: Protein of unknown function (DUF2457); InterPro: IPR018853 This entry represents a family of uncharacterised proteins Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-21
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 8e-21
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-20
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 6e-20
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 7e-20
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-19
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 3e-19
2xeh_A157 Structural Determinants For Improved Thermal Stabil 8e-19
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-18
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-18
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-18
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-18
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 3e-17
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-17
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 3e-17
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 4e-17
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 4e-17
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-17
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 7e-17
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 1e-16
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-16
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-16
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-16
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-16
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-15
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 1e-15
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-15
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 4e-15
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-14
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-14
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 5e-14
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 5e-14
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 7e-14
1uoh_A226 Human Gankyrin Length = 226 7e-14
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 8e-14
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 8e-14
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-13
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-13
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-13
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-13
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 2e-12
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-12
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-12
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 2e-12
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-12
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 6e-12
3utm_A 351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 6e-12
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 6e-12
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-12
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-11
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 3e-11
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-11
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 4e-11
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 4e-11
1ycs_B239 P53-53bp2 Complex Length = 239 8e-11
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 8e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 8e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 2e-10
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 1e-10
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 4e-10
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 6e-10
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 1e-09
2xen_A91 Structural Determinants For Improved Thermal Stabil 3e-09
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 4e-09
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 5e-09
3b7b_A 237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-06
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 8e-09
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 8e-09
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-08
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-08
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-08
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 2e-08
3uxg_A172 Crystal Structure Of Rfxank Length = 172 2e-08
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 2e-08
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-08
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-08
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-08
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-08
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 5e-08
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 6e-08
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-07
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-07
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 1e-07
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 1e-07
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 3e-07
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 3e-07
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 3e-07
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 9e-07
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 9e-07
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 9e-07
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 9e-07
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 1e-06
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 1e-06
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 1e-06
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 3e-06
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 4e-06
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 9e-06
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 1e-05
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 3e-04
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 3e-04
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 4e-04
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 5e-04
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 7e-04
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure

Iteration: 1

Score = 99.8 bits (247), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 50/119 (42%), Positives = 74/119 (62%) Query: 194 DSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSVKLLI 253 ++ D DG T LH A + ++ LL KGA+P+ KD DG TPLHYA + G + VKLL+ Sbjct: 31 NASDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKDSDGRTPLHYAAENGHKEIVKLLL 90 Query: 254 KYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRD 312 D N D++G TPLH A ++ +++I K+LL GAD + DG+T LD++ +G + Sbjct: 91 SKGADPNAKDSDGRTPLHYAAENGHKEIVKLLLSKGADPNTSDSDGRTPLDLAREHGNE 149
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query328
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-44
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-30
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-30
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 6e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-42
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-37
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-32
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-23
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-41
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-40
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-40
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-38
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-38
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-37
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-37
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-37
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-37
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-36
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-27
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-22
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-41
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-34
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-19
3f6q_A 179 Integrin-linked protein kinase; ILK, integrin-link 9e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-41
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-35
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-33
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 2e-26
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-17
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-32
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-31
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-40
1awc_B153 Protein (GA binding protein beta 1); complex (tran 9e-32
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-40
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-33
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-28
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-27
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-15
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-40
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-37
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-37
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-34
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-33
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-09
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-40
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-34
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-26
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-39
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-38
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-29
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-24
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-39
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-34
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-31
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 9e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-39
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-39
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-33
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-32
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-39
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-35
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-28
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-28
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-38
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-37
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 3e-34
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-31
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 3e-25
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 4e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-38
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-31
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-38
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-37
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-35
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 8e-34
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-30
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-38
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-37
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 8e-37
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-31
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-28
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-38
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-36
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-36
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-31
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-05
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-37
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-32
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-32
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-30
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-29
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-37
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-20
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-37
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-34
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-33
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-30
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-28
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-18
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-35
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-31
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-12
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-36
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-33
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-24
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-17
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-14
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-36
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-36
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-34
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-34
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-22
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-36
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-25
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-36
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-33
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-33
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-27
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-23
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-13
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-35
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-34
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-35
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-26
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-35
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-30
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-10
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-34
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-32
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-34
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-33
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-32
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-32
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-32
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-31
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-17
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-34
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-33
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-27
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-15
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-34
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-32
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-22
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-10
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-33
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-33
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-32
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 4e-31
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-29
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-33
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-26
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 8e-13
2rfa_A232 Transient receptor potential cation channel subfa 3e-33
2rfa_A232 Transient receptor potential cation channel subfa 3e-30
2rfa_A232 Transient receptor potential cation channel subfa 3e-29
2rfa_A232 Transient receptor potential cation channel subfa 2e-28
3deo_A183 Signal recognition particle 43 kDa protein; chloro 9e-33
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-31
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-26
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-17
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-32
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-30
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-23
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-32
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-32
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-31
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-31
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-28
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-19
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-32
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 8e-27
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 4e-24
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 9e-17
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-05
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 5e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-30
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-29
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-28
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-26
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-23
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-28
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 9e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-04
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-26
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-22
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-14
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-24
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-22
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-18
3jxi_A260 Vanilloid receptor-related osmotically activated p 7e-11
3jxi_A 260 Vanilloid receptor-related osmotically activated p 4e-06
2pnn_A273 Transient receptor potential cation channel subfa 4e-24
2pnn_A273 Transient receptor potential cation channel subfa 2e-20
2pnn_A273 Transient receptor potential cation channel subfa 7e-19
2pnn_A273 Transient receptor potential cation channel subfa 2e-12
2etb_A256 Transient receptor potential cation channel subfam 3e-23
2etb_A256 Transient receptor potential cation channel subfam 8e-20
2etb_A256 Transient receptor potential cation channel subfam 4e-16
2etb_A256 Transient receptor potential cation channel subfam 9e-12
2etb_A256 Transient receptor potential cation channel subfam 1e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 6e-23
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-22
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 1e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-18
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 8e-18
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-17
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-16
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 7e-16
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-15
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-11
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-09
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-05
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 7e-12
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-11
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
 Score =  146 bits (372), Expect = 9e-44
 Identities = 42/137 (30%), Positives = 76/137 (55%), Gaps = 6/137 (4%)

Query: 186 LLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGA 245
           L    +  D++++ G TAL   + G    +   LL++GA+P+V+D  G +P+H A + G 
Sbjct: 22  LHRELVHPDALNRFGKTALQVMMFGSTA-IALELLKQGASPNVQDTSGTSPVHDAARTGF 80

Query: 246 MQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDM 305
           + ++K+L+++  DVNV D  G  P+H+A+Q  +  +    L   +D  R+   G T L++
Sbjct: 81  LDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVS-FLAAESDLHRRDARGLTPLEL 139

Query: 306 SLCYGRDFKSYDLAKLL 322
           +L  G    + DL  +L
Sbjct: 140 ALQRG----AQDLVDIL 152


>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1awc_B153 Protein (GA binding protein beta 1); complex (tran 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 100.0
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.98
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.98
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.98
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.98
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.97
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.97
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.94
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.94
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.94
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.93
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.93
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.92
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.91
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.91
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.91
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.9
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.89
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.82
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=1.7e-36  Score=254.80  Aligned_cols=153  Identities=36%  Similarity=0.539  Sum_probs=95.5

Q ss_pred             HHHHHHHhCCHHHHHHHHHCCCCCCccCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCChHHHHHHHcCCHHHH
Q 020274          170 PLQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPHVKDGDGATPLHYAVQVGAMQSV  249 (328)
Q Consensus       170 ~L~~A~~~g~~~~v~~Ll~~gadi~~~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~d~~~~d~~g~tpLh~A~~~g~~~iv  249 (328)
                      +|+.||..|+.++|++||++|+++|.+|..|+||||+|+..++.+++++|+++|++++.++..|+||||+|+..|+.+++
T Consensus         7 ~L~~Aa~~G~~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v   86 (169)
T 4gpm_A            7 RLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVV   86 (169)
T ss_dssp             HHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHH
T ss_pred             HHHHHHHcCCHHHHHHHHHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHH
Confidence            45666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             HHHHhCCCCccccCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHcCCCCChHHHHHHHhhCC
Q 020274          250 KLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLKILP  326 (328)
Q Consensus       250 ~~Ll~~ga~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~~~~~i~~lL~~~~  326 (328)
                      ++|+++|+++|.+|..|+||||+|+..|+.++|++|+++|++++.+|..|+||||+|+.+|+    .+++++|....
T Consensus        87 ~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~~~g~----~~iv~~Ll~~G  159 (169)
T 4gpm_A           87 KLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAREHGN----EEVVKLLEKQG  159 (169)
T ss_dssp             HHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTC----HHHHHHHHTC-
T ss_pred             HHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHHHcCC----HHHHHHHHHCC
Confidence            66666666666666666666666666666666666666666666666666666666666665    56666665543



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 328
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-26
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-24
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-23
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-22
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-21
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-21
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-20
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-19
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-18
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-26
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 9e-20
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-23
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-21
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-18
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-13
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-10
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-10
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-21
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-14
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-12
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-11
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-07
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-19
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-18
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-11
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-09
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-06
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-18
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-18
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-09
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-18
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-10
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-12
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-08
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-14
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-10
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-06
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-15
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.001
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-13
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 8e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-08
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-07
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-05
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-11
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 3e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 9e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.001
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.003
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 8e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 7e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  106 bits (264), Expect = 1e-26
 Identities = 46/158 (29%), Positives = 70/158 (44%), Gaps = 4/158 (2%)

Query: 168 WRPLQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGKKEAVISHLLRKGANPH 227
             PL           + +LL    + +  +K GLT LH         V   L++ G    
Sbjct: 232 VTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVD 291

Query: 228 VKDGDGATPLHYAVQVGAMQSVKLLIKYNVDVNVADNEGWTPLHIAIQSRNRDIAKVLLI 287
                G TPLH A   G ++ VK L+++  DVN     G++PLH A Q  + DI  +LL 
Sbjct: 292 ATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLK 351

Query: 288 NGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLKIL 325
           NGA  +  + DG T L ++   G       +  +LK++
Sbjct: 352 NGASPNEVSSDGTTPLAIAKRLGYI----SVTDVLKVV 385


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query328
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.97
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.97
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.95
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.94
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.94
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.94
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.92
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.92
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.91
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.9
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.88
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.84
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=1.3e-33  Score=248.23  Aligned_cols=191  Identities=26%  Similarity=0.300  Sum_probs=174.0

Q ss_pred             cHHHHHHHHhhChHHHHHHHhcCCCCC-CCCCCCCCCcHHHHHHHhCCHHHHHHHHHCCCCCCccCCCCCcHHHHHHHcC
Q 020274          133 EEDLLKEVEQLLEPEEREILNQNATPN-LGKISTAKWRPLQTLTLSMQIRYMDMLLDGGLDIDSVDKDGLTALHKAIIGK  211 (328)
Q Consensus       133 ~~~l~~ai~~~~~~~v~~lL~~g~~~~-~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~gadi~~~d~~g~t~L~~A~~~g  211 (328)
                      ...|+.|+..+..+.++.|++.|+++. +...+..|.||||+|+..|+.+++++|+++|++++.+|..|.||||+|+..+
T Consensus        10 ~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~tpL~~A~~~~   89 (255)
T d1oy3d_          10 DTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHLACRVR   89 (255)
T ss_dssp             CCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCHHHHHTTTT
T ss_pred             CCHHHHHHHcCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhcccccccccccccccccccccccchhhhhhhccC
Confidence            356899999999999999999998865 4566889999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHCCC-----------------------------------------------CCCCCCCCCChHHHHHHHcC
Q 020274          212 KEAVISHLLRKGA-----------------------------------------------NPHVKDGDGATPLHYAVQVG  244 (328)
Q Consensus       212 ~~~~v~~Ll~~g~-----------------------------------------------d~~~~d~~g~tpLh~A~~~g  244 (328)
                      +.+++++|++.+.                                               +++.++..|.||||+|+..+
T Consensus        90 ~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~A~~~~  169 (255)
T d1oy3d_          90 AHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHK  169 (255)
T ss_dssp             CHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCHHHHHHHTT
T ss_pred             chHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCccccccccccc
Confidence            9999999976432                                               22345778999999999999


Q ss_pred             CHHHHHHHHhCCCCcccc-CCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHcCCCCChHHHHHHHh
Q 020274          245 AMQSVKLLIKYNVDVNVA-DNEGWTPLHIAIQSRNRDIAKVLLINGADKSRKTKDGKTALDMSLCYGRDFKSYDLAKLLK  323 (328)
Q Consensus       245 ~~~iv~~Ll~~ga~in~~-d~~g~TpL~~A~~~g~~~iv~~Ll~~gad~~~~d~~G~TpL~~A~~~g~~~~~~~i~~lL~  323 (328)
                      +.+++++|++++++.+.. +..|.||||+|+..|+.+++++|+++|++++.+|..|+||||+|+.+++    .+++++|.
T Consensus       170 ~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~----~~i~~~Ll  245 (255)
T d1oy3d_         170 DAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPN----PILARLLR  245 (255)
T ss_dssp             CHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSC----HHHHHHHH
T ss_pred             ccccccchhcccccccccccccccccccccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCC----HHHHHHHH
Confidence            999999999999998865 5689999999999999999999999999999999999999999999999    99999998


Q ss_pred             hCCC
Q 020274          324 ILPV  327 (328)
Q Consensus       324 ~~~~  327 (328)
                      ....
T Consensus       246 ~~Ga  249 (255)
T d1oy3d_         246 AHGA  249 (255)
T ss_dssp             HTTC
T ss_pred             HcCC
Confidence            7654



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure