Citrus Sinensis ID: 020304

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MIHQAIWKPSNSISYSIPSKIRCESRTDTVKMKPPQRQQMGLHTGRDPDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLVSWF

cccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHcccccccccccccccHHHHccccccccccEEEEEcccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHccccccccccccHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccEEccccccccccccccccccccHHHHHHHHHHHHHccccEEEEccccccc

ccHHHccccccccccccccEEccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHccccEEEEHcccccccHccccccccEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEEcccccccHHHHHHHHHccccHHHcccccHHHHcHHcccccccHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHccccEEEEccccccccccccEEEEccHHHHHHHHHHHHHcccEEEEccccEccc

mihqaiwkpsnsisysipskircesrtdtvkmkppqrqqmglhtgrdpdvkkpewlrqkapqgqrFQEVKESLSSlklntvceeaqcpnigecwngggdgiATATIMLLgdtctrgcrfcavktsrnpappdpmepentAKAIASWGVDYIVLtsvdrddipdggsghFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIvrdpragyEQSLEVLKHAKLSKKGLITKSSImlglgesddDLKEAMADLRSIDVDILTlgqylqptplhltvkeyvtpeKFDFWKAYGESigfryvasgplvswf

mihqaiwkpsnsisysipskircesrtdtvkmkppqrqqmglhtgrdpdvkkpEWLRqkapqgqrfqeVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTsrnpappdpmepENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARtvkamkkqkpdIMVECLTSDFRGDLRAVETLVHSGldvfahnietvkrLQRIVRDPRAGYEQSLEVlkhaklskkglitkssimlglGESDDDLKEAMADLRSIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVAsgplvswf

***************************************************************************LKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVK******************AIASWGVDYIVLTSVDRDDIPD***GHFARTVKAM**QKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGLG******KEAMADLRSIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLVSW*

******************************************************WLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLVSWF

MIHQAIWKPSNSISYSIPSKIRCESRTDTVKMKPPQRQQMGLHTGRDPDVKKPEWL****************LSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLVSWF

***********************************************PDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLVSWF

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		328	2.2.26 [Sep-21-2011]
B9RX57		364	Lipoyl synthase, chloropl	N/A	no	0.987	0.890	0.804	1e-161
B9I666		376	Lipoyl synthase 1, chloro	yes	no	0.990	0.864	0.777	1e-151
Q8LEE8		394	Lipoyl synthase, chloropl	yes	no	0.990	0.824	0.742	1e-150
B9N2B0		397	Lipoyl synthase 2, chloro	no	no	0.990	0.818	0.711	1e-144
B8B016		384	Lipoyl synthase 2, chloro	N/A	no	0.868	0.742	0.749	1e-127
Q6L534		384	Lipoyl synthase 2, chloro	yes	no	0.868	0.742	0.745	1e-126
Q5ZAQ2		370	Lipoyl synthase 1, chloro	no	no	0.960	0.851	0.703	1e-124
B8AA76		370	Lipoyl synthase 1, chloro	N/A	no	0.960	0.851	0.703	1e-124
C5XKZ1		368	Lipoyl synthase, chloropl	N/A	no	0.951	0.847	0.696	1e-124
B6TN12		361	Lipoyl synthase 1, chloro	N/A	no	0.881	0.800	0.742	1e-124

>sp\|B9RX57\|LISC_RICCO Lipoyl synthase, chloroplastic OS=Ricinus communis GN=LIP1P PE=3 SV=1	Back alignment and function desciption

 Score =  566 bits (1459), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 272/338 (80%), Positives = 299/338 (88%), Gaps = 14/338 (4%)

Query: 2   IHQAIWKPSNSISYS-------IPSKIRCE-------SRTDTVKMKPPQRQQMGLHTGRD 47
           + Q ++ PS S+  S       I S+I+C+       S T T  +  P ++ MG +TGRD
Sbjct: 1   MEQTLFNPSISMPKSFYHKHITISSRIQCQLSTNSPSSNTKTTTVTVPSKKTMGPYTGRD 60

Query: 48  PDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIM 107
           P+VKKPEWLRQ+APQG+RFQEVK SLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIM
Sbjct: 61  PNVKKPEWLRQRAPQGERFQEVKHSLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIM 120

Query: 108 LLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSG 167
           LLGDTCTRGCRFCAVKTSRNP+PPDP+EP+NTA AIASWGVDYIVLTSVDRDD+PDGGSG
Sbjct: 121 LLGDTCTRGCRFCAVKTSRNPSPPDPLEPQNTALAIASWGVDYIVLTSVDRDDLPDGGSG 180

Query: 168 HFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDP 227
           HF+ TV+AMKK KP+IMVECLTSDFRGDL AVETLVHSGLDVFAHNIETVKRLQRIVRDP
Sbjct: 181 HFSETVQAMKKLKPEIMVECLTSDFRGDLEAVETLVHSGLDVFAHNIETVKRLQRIVRDP 240

Query: 228 RAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVDILTLGQYLQ 287
           RAGYEQSL VLKHAK SK+G+ITKSSIMLGLGE+DD+LKEAMADLR+IDVDILTLGQYLQ
Sbjct: 241 RAGYEQSLSVLKHAKHSKEGMITKSSIMLGLGETDDELKEAMADLRAIDVDILTLGQYLQ 300

Query: 288 PTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLV 325
           PTPLHLTVKEYVTPEKF FWK YGESIGFRYVASGP+V
Sbjct: 301 PTPLHLTVKEYVTPEKFAFWKEYGESIGFRYVASGPMV 338

Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, thereby converting the octanoylated domains into lipoylated derivatives.
Ricinus communis (taxid: 3988)
EC: 2EC: .EC: 8EC: .EC: 1EC: .EC: 8

>sp\|B9I666\|LISC1_POPTR Lipoyl synthase 1, chloroplastic OS=Populus trichocarpa GN=LIP1P-1 PE=3 SV=1	Back alignment and function description

>sp\|Q8LEE8\|LISC_ARATH Lipoyl synthase, chloroplastic OS=Arabidopsis thaliana GN=LIP1P PE=2 SV=2	Back alignment and function description

>sp\|B9N2B0\|LISC2_POPTR Lipoyl synthase 2, chloroplastic OS=Populus trichocarpa GN=LIP1P-2 PE=3 SV=1	Back alignment and function description

>sp\|B8B016\|LISC2_ORYSI Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. indica GN=LIP1P-2 PE=3 SV=1	Back alignment and function description

>sp\|Q6L534\|LISC2_ORYSJ Lipoyl synthase 2, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-2 PE=2 SV=1	Back alignment and function description

>sp\|Q5ZAQ2\|LISC1_ORYSJ Lipoyl synthase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=LIP1P-1 PE=3 SV=1	Back alignment and function description

>sp\|B8AA76\|LISC1_ORYSI Lipoyl synthase 1, chloroplastic OS=Oryza sativa subsp. indica GN=LIP1P-1 PE=3 SV=2	Back alignment and function description

>sp\|C5XKZ1\|LISC_SORBI Lipoyl synthase, chloroplastic OS=Sorghum bicolor GN=LIP1P PE=3 SV=1	Back alignment and function description

>sp\|B6TN12\|LISC1_MAIZE Lipoyl synthase 1, chloroplastic OS=Zea mays GN=LIP1P-1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		328
356575490		364	PREDICTED: lipoyl synthase, chloroplasti	0.987	0.890	0.819	1e-159
255554575		364	lipoic acid synthetase, putative [Ricinu	0.987	0.890	0.804	1e-159
225463795		372	PREDICTED: lipoyl synthase, chloroplasti	0.868	0.766	0.915	1e-154
449458724		398	PREDICTED: lipoyl synthase, chloroplasti	0.871	0.718	0.902	1e-152
224126729		376	predicted protein [Populus trichocarpa]	0.990	0.864	0.777	1e-150
21553591		393	lipoic acid synthase-like protein [Arabi	0.990	0.826	0.742	1e-148
18415808		394	lipoyl synthase [Arabidopsis thaliana] g	0.990	0.824	0.742	1e-148
356534404		358	PREDICTED: LOW QUALITY PROTEIN: lipoyl s	0.972	0.891	0.798	1e-146
224127031		397	predicted protein [Populus trichocarpa]	0.990	0.818	0.711	1e-143
302821689		357	hypothetical protein SELMODRAFT_186771 [	0.978	0.899	0.730	1e-135

>gi\|356575490\|ref\|XP_003555873.1\| PREDICTED: lipoyl synthase, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

 Score =  568 bits (1464), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 277/338 (81%), Positives = 302/338 (89%), Gaps = 14/338 (4%)

Query: 1   MIHQAIWKPSNSISYSIPS-----------KIRCESRTDTVKMK--PPQRQQMGLHTGRD 47
           MI Q+++ P  SI++S PS           +IRC++ + +V+ K   P    +G HTGRD
Sbjct: 1   MIRQSLYTPP-SITFSTPSPKRHRFAPPSWRIRCDASSVSVEQKVVGPYPGGLGPHTGRD 59

Query: 48  PDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIM 107
           P+ KKPEWLRQKAPQG+RFQE+KESLS LKLNTVCEEAQCPNIGECWNGGGDGIATATIM
Sbjct: 60  PNAKKPEWLRQKAPQGERFQEIKESLSHLKLNTVCEEAQCPNIGECWNGGGDGIATATIM 119

Query: 108 LLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSG 167
           LLGDTCTRGCRFCAVKTSRNP P DPMEPENTAKAIASWGVDYIVLTSVDRDD+PDGGSG
Sbjct: 120 LLGDTCTRGCRFCAVKTSRNPPPADPMEPENTAKAIASWGVDYIVLTSVDRDDLPDGGSG 179

Query: 168 HFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDP 227
           HFA+TVKAMK  KP+IMVECLTSDFRGDL+AVETLVHSGLDVFAHNIETVKRLQRIVRDP
Sbjct: 180 HFAQTVKAMKNLKPEIMVECLTSDFRGDLKAVETLVHSGLDVFAHNIETVKRLQRIVRDP 239

Query: 228 RAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVDILTLGQYLQ 287
           RAGYEQSL VLKHAK SK+G+ITK+SIMLGLGESDD++KEAMADLR+IDVDILTLGQYLQ
Sbjct: 240 RAGYEQSLSVLKHAKHSKEGMITKTSIMLGLGESDDEVKEAMADLRAIDVDILTLGQYLQ 299

Query: 288 PTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLV 325
           PTPLHLTVKEYVTPEKFDFWK YGESIGFRYVASGPLV
Sbjct: 300 PTPLHLTVKEYVTPEKFDFWKEYGESIGFRYVASGPLV 337

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255554575|ref|XP_002518326.1| lipoic acid synthetase, putative [Ricinus communis] gi|308197093|sp|B9RX57.1|LISC_RICCO RecName: Full=Lipoyl synthase, chloroplastic; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoate synthase, plastidial; Short=LIP1p; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|223542546|gb|EEF44086.1| lipoic acid synthetase, putative [Ricinus communis]

Back alignment and taxonomy information

>gi\|225463795\|ref\|XP_002270080.1\| PREDICTED: lipoyl synthase, chloroplastic [Vitis vinifera] gi\|297742716\|emb\|CBI35350.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449458724\|ref\|XP_004147097.1\| PREDICTED: lipoyl synthase, chloroplastic-like [Cucumis sativus] gi\|449526690\|ref\|XP_004170346.1\| PREDICTED: lipoyl synthase, chloroplastic-like [Cucumis sativus]	Back alignment and taxonomy information

>gi|224126729|ref|XP_002319912.1| predicted protein [Populus trichocarpa] gi|308191445|sp|B9I666.1|LISC1_POPTR RecName: Full=Lipoyl synthase 1, chloroplastic; AltName: Full=Lipoate synthase 1; Short=LS 1; Short=Lip-syn 1; AltName: Full=Lipoate synthase, plastidial 1; Short=LIP1p 1; AltName: Full=Lipoic acid synthase 1; Flags: Precursor gi|222858288|gb|EEE95835.1| predicted protein [Populus trichocarpa]

Back alignment and taxonomy information

>gi\|21553591\|gb\|AAM62684.1\| lipoic acid synthase-like protein [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi|18415808|ref|NP_568196.1| lipoyl synthase [Arabidopsis thaliana] gi|308191548|sp|Q8LEE8.2|LISC_ARATH RecName: Full=Lipoyl synthase, chloroplastic; AltName: Full=Lipoate synthase; Short=LS; Short=Lip-syn; AltName: Full=Lipoate synthase, plastidial; Short=LIP1p; AltName: Full=Lipoic acid synthase; Flags: Precursor gi|20373023|dbj|BAB91180.1| lipoic acid synthase [Arabidopsis thaliana] gi|98960967|gb|ABF58967.1| At5g08415 [Arabidopsis thaliana] gi|332003915|gb|AED91298.1| lipoyl synthase [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|356534404\|ref\|XP_003535745.1\| PREDICTED: LOW QUALITY PROTEIN: lipoyl synthase, chloroplastic-like [Glycine max]	Back alignment and taxonomy information

>gi|224127031|ref|XP_002329366.1| predicted protein [Populus trichocarpa] gi|308191448|sp|B9N2B0.1|LISC2_POPTR RecName: Full=Lipoyl synthase 2, chloroplastic; AltName: Full=Lipoate synthase 2; Short=LS 2; Short=Lip-syn 2; AltName: Full=Lipoate synthase, plastidial 2; Short=LIP1p 2; AltName: Full=Lipoic acid synthase 2; Flags: Precursor gi|222870416|gb|EEF07547.1| predicted protein [Populus trichocarpa]

Back alignment and taxonomy information

>gi\|302821689\|ref\|XP_002992506.1\| hypothetical protein SELMODRAFT_186771 [Selaginella moellendorffii] gi\|300139708\|gb\|EFJ06444.1\| hypothetical protein SELMODRAFT_186771 [Selaginella moellendorffii]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		328
TAIR\|locus:505006586		394	AT5G08415 [Arabidopsis thalian	0.890	0.741	0.880	8.6e-143
UNIPROTKB\|I3LGA8		372	LIAS "Lipoyl synthase, mitocho	0.841	0.741	0.637	5.8e-98
RGD\|1307270		373	Lias "lipoic acid synthetase"	0.841	0.739	0.634	5.8e-98
UNIPROTKB\|Q5BIP7		372	LIAS "Lipoyl synthase, mitocho	0.841	0.741	0.630	3.2e-97
UNIPROTKB\|E2R257		373	LIAS "Lipoyl synthase, mitocho	0.841	0.739	0.634	3.2e-97
MGI\|MGI:1934604		373	Lias "lipoic acid synthetase"	0.841	0.739	0.626	1.4e-96
ZFIN\|ZDB-GENE-040426-1528		399	lias "lipoic acid synthetase"	0.841	0.691	0.634	1.4e-96
UNIPROTKB\|F1NEN8		339	LIAS "Uncharacterized protein"	0.841	0.814	0.630	5.9e-96
UNIPROTKB\|O43766		372	LIAS "Lipoyl synthase, mitocho	0.841	0.741	0.623	5.9e-96
WB\|WBGene00010809		354	M01F1.3 [Caenorhabditis elegan	0.871	0.807	0.593	1e-93

TAIR\|locus:505006586 AT5G08415 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1396 (496.5 bits), Expect = 8.6e-143, P = 8.6e-143
 Identities = 257/292 (88%), Positives = 277/292 (94%)

Query:    34 PPQRQQMGLHTGRDPDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGEC 93
             P    +MG  TGRDP+VKKP WLRQKAPQG+RFQEVKESLS L LNTVCEEAQCPNIGEC
Sbjct:    79 PGGMPKMGPFTGRDPNVKKPAWLRQKAPQGERFQEVKESLSRLNLNTVCEEAQCPNIGEC 138

Query:    94 WNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVL 153
             WNGGGDG+ATATIM+LGDTCTRGCRFCAVKTSRNP PPDPMEPENTAKAIASWGVDYIV+
Sbjct:   139 WNGGGDGVATATIMVLGDTCTRGCRFCAVKTSRNPPPPDPMEPENTAKAIASWGVDYIVI 198

Query:   154 TSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHN 213
             TSVDRDDIPDGGSGHFA+TVKAMK+ KPDIM+ECLTSDFRGDL AV+TLVHSGLDVFAHN
Sbjct:   199 TSVDRDDIPDGGSGHFAQTVKAMKRHKPDIMIECLTSDFRGDLEAVDTLVHSGLDVFAHN 258

Query:   214 IETVKRLQRIVRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLR 273
             +ETVKRLQR+VRDPRAGYEQS+ VLKHAK+SK G+ITK+SIMLGLGE+D++LKEAMADLR
Sbjct:   259 VETVKRLQRLVRDPRAGYEQSMSVLKHAKISKPGMITKTSIMLGLGETDEELKEAMADLR 318

Query:   274 SIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLV 325
             +IDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWK YGESIGFRYVASGPLV
Sbjct:   319 AIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKTYGESIGFRYVASGPLV 370

GO:0003824 "catalytic activity" evidence=IEA

GO:0009107 "lipoate biosynthetic process" evidence=IEA;ISS

GO:0009507 "chloroplast" evidence=ISM

GO:0016992 "lipoate synthase activity" evidence=IEA;ISS

GO:0051536 "iron-sulfur cluster binding" evidence=IEA

GO:0051539 "4 iron, 4 sulfur cluster binding" evidence=IEA

UNIPROTKB\|I3LGA8 LIAS "Lipoyl synthase, mitochondrial" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

RGD\|1307270 Lias "lipoic acid synthetase" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5BIP7 LIAS "Lipoyl synthase, mitochondrial" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R257 LIAS "Lipoyl synthase, mitochondrial" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:1934604 Lias "lipoic acid synthetase" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-1528 lias "lipoic acid synthetase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NEN8 LIAS "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|O43766 LIAS "Lipoyl synthase, mitochondrial" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

WB\|WBGene00010809 M01F1.3 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
B8AA76	LISC1_ORYSI	2, ., 8, ., 1, ., 8	0.7037	0.9603	0.8513	N/A	no
B6TN12	LISC1_MAIZE	2, ., 8, ., 1, ., 8	0.7423	0.8810	0.8005	N/A	no
Q5XIH4	LIAS_RAT	2, ., 8, ., 1, ., 8	0.6340	0.8414	0.7399	yes	no
Q8IDQ0	LIPA_PLAF7	2, ., 8, ., 1, ., 8	0.5827	0.8323	0.6578	yes	no
B8B016	LISC2_ORYSI	2, ., 8, ., 1, ., 8	0.7491	0.8689	0.7421	N/A	no
C0PN26	LISC2_MAIZE	2, ., 8, ., 1, ., 8	0.7355	0.8810	0.7874	N/A	no
Q6FPY0	LIPA_CANGA	2, ., 8, ., 1, ., 8	0.5928	0.8536	0.7216	yes	no
Q6L534	LISC2_ORYSJ	2, ., 8, ., 1, ., 8	0.7457	0.8689	0.7421	yes	no
B9I666	LISC1_POPTR	2, ., 8, ., 1, ., 8	0.7771	0.9908	0.8643	yes	no
B9RX57	LISC_RICCO	2, ., 8, ., 1, ., 8	0.8047	0.9878	0.8901	N/A	no
C5DY71	LIPA_ZYGRC	2, ., 8, ., 1, ., 8	0.55	0.9024	0.7668	yes	no
Q8LEE8	LISC_ARATH	2, ., 8, ., 1, ., 8	0.7425	0.9908	0.8248	yes	no
Q99M04	LIAS_MOUSE	2, ., 8, ., 1, ., 8	0.6268	0.8414	0.7399	yes	no
Q74ZH6	LIPA_ASHGO	2, ., 8, ., 1, ., 8	0.6036	0.8353	0.7425	yes	no
Q5BIP7	LIAS_BOVIN	2, ., 8, ., 1, ., 8	0.6304	0.8414	0.7419	yes	no
Q21452	LIAS_CAEEL	2, ., 8, ., 1, ., 8	0.5896	0.8719	0.8079	yes	no
B9WFS9	LIPA_CANDC	2, ., 8, ., 1, ., 8	0.6	0.8628	0.7331	yes	no
C5XKZ1	LISC_SORBI	2, ., 8, ., 1, ., 8	0.6965	0.9512	0.8478	N/A	no
Q6C6C6	LIPA_YARLI	2, ., 8, ., 1, ., 8	0.6007	0.8323	0.7777	yes	no
A3GGJ5	LIPA_PICST	2, ., 8, ., 1, ., 8	0.5964	0.8506	0.7010	yes	no
Q6PHG4	LIAS_DANRE	2, ., 8, ., 1, ., 8	0.6340	0.8414	0.6917	yes	no
Q5ZAQ2	LISC1_ORYSJ	2, ., 8, ., 1, ., 8	0.7037	0.9603	0.8513	no	no
A4RW69	LISC_OSTLU	2, ., 8, ., 1, ., 8	0.7127	0.8475	0.8580	yes	no
C4QYF2	LIPA_PICPG	2, ., 8, ., 1, ., 8	0.5842	0.8475	0.6666	yes	no
Q7JQW6	LIAS_DROME	2, ., 8, ., 1, ., 8	0.6049	0.8567	0.7453	yes	no
O43766	LIAS_HUMAN	2, ., 8, ., 1, ., 8	0.6231	0.8414	0.7419	yes	no
Q2LYK1	LIAS_DROPS	2, ., 8, ., 1, ., 8	0.6227	0.8567	0.7513	yes	no
C3Y3G4	LIAS_BRAFL	2, ., 8, ., 1, ., 8	0.6272	0.8506	0.7420	yes	no
B9N2B0	LISC2_POPTR	2, ., 8, ., 1, ., 8	0.7115	0.9908	0.8186	no	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.8.1.8	0.979
3rd Layer	2.8.1	0.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	GSVIVG00002605001	SubName- Full=Chromosome undetermined scaffold_133, whole genome shotgun sequence; (372 aa)
		(Vitis vinifera)
Predicted Functional Partners:
	GSVIVG00024702001	SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (235 aa)	•	•		•	•	0.992
	GSVIVG00023636001	SubName- Full=Chromosome chr7 scaffold_31, whole genome shotgun sequence; (180 aa)	•	•		•	•	0.992
	GSVIVG00019672001	RecName- Full=Dihydrolipoyl dehydrogenase; EC=1.8.1.4; (502 aa)	•	•			•	0.824
	GSVIVG00001917001	SubName- Full=Chromosome chr5 scaffold_124, whole genome shotgun sequence; (381 aa)					•	0.792
	GSVIVG00008624001	SubName- Full=Chromosome undetermined scaffold_203, whole genome shotgun sequence; (226 aa)	•				•	0.735
	GSVIVG00036866001	SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (471 aa)	•		•		•	0.645
	GSVIVG00016525001	SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (434 aa)	•	•				0.641
	GSVIVG00033027001	SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (469 aa)	•	•				0.638
	GSVIVG00003725001	SubName- Full=Chromosome chr13 scaffold_149, whole genome shotgun sequence; (326 aa)	•				•	0.625
	GSVIVG00033119001	SubName- Full=Chromosome chr5 scaffold_64, whole genome shotgun sequence; (566 aa)	•	•			•	0.605

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		328
PLN02428		349	PLN02428, PLN02428, lipoic acid synthase	0.0
PRK05481		289	PRK05481, PRK05481, lipoyl synthase; Provisional	1e-167
COG0320		306	COG0320, LipA, Lipoate synthase [Coenzyme metaboli	1e-154
PTZ00413		398	PTZ00413, PTZ00413, lipoate synthase; Provisional	1e-154
TIGR00510		302	TIGR00510, lipA, lipoate synthase	1e-130
PRK12928		290	PRK12928, PRK12928, lipoyl synthase; Provisional	1e-124
pfam04055		165	pfam04055, Radical_SAM, Radical SAM superfamily	2e-24
smart00729		216	smart00729, Elp3, Elongator protein 3, MiaB family	4e-19
cd01335		204	cd01335, Radical_SAM, Radical SAM superfamily	4e-09
COG0502		335	COG0502, BioB, Biotin synthase and related enzymes	9e-08
PRK06256		336	PRK06256, PRK06256, biotin synthase; Validated	4e-06
TIGR00433		296	TIGR00433, bioB, biotin synthase	7e-06
COG1060		370	COG1060, ThiH, Thiamine biosynthesis enzyme ThiH a	4e-04
TIGR04043		354	TIGR04043, rSAM_MSMEG_0568, radical SAM protein, M	0.002

>gnl\|CDD\|215236 PLN02428, PLN02428, lipoic acid synthase	Back alignment and domain information

 Score =  599 bits (1545), Expect = 0.0
 Identities = 211/282 (74%), Positives = 245/282 (86%)

Query: 44  TGRDPDVKKPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIAT 103
            GRD  + KP+WLRQ+AP G+++ E+KE L  LKLNTVCEEAQCPNIGECWNGGG G AT
Sbjct: 43  YGRDKPLPKPKWLRQRAPGGEKYTEIKEKLRELKLNTVCEEAQCPNIGECWNGGGTGTAT 102

Query: 104 ATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPD 163
           ATIM+LGDTCTRGCRFCAVKTSR P PPDP EPEN A+AIASWGVDY+VLTSVDRDD+PD
Sbjct: 103 ATIMILGDTCTRGCRFCAVKTSRTPPPPDPDEPENVAEAIASWGVDYVVLTSVDRDDLPD 162

Query: 164 GGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRI 223
           GGSGHFA TV+ +K+ KP+I+VE L  DFRGDL AVET+  SGLDVFAHNIETV+RLQRI
Sbjct: 163 GGSGHFAETVRRLKQLKPEILVEALVPDFRGDLGAVETVATSGLDVFAHNIETVERLQRI 222

Query: 224 VRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVDILTLG 283
           VRDPRAGY+QSL+VLKHAK SK GL+TK+SIMLGLGE+D+++ + M DLR+  VD++T G
Sbjct: 223 VRDPRAGYKQSLDVLKHAKESKPGLLTKTSIMLGLGETDEEVVQTMEDLRAAGVDVVTFG 282

Query: 284 QYLQPTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLV 325
           QYL+PT  HL VKEYVTPEKF+FW+ YGE +GFRYVASGPLV
Sbjct: 283 QYLRPTKRHLPVKEYVTPEKFEFWREYGEEMGFRYVASGPLV 324

Length = 349

>gnl\|CDD\|235493 PRK05481, PRK05481, lipoyl synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|223397 COG0320, LipA, Lipoate synthase [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|240408 PTZ00413, PTZ00413, lipoate synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|233002 TIGR00510, lipA, lipoate synthase	Back alignment and domain information

>gnl\|CDD\|237261 PRK12928, PRK12928, lipoyl synthase; Provisional	Back alignment and domain information

>gnl\|CDD\|217866 pfam04055, Radical_SAM, Radical SAM superfamily	Back alignment and domain information

>gnl\|CDD\|214792 smart00729, Elp3, Elongator protein 3, MiaB family, Radical SAM	Back alignment and domain information

>gnl\|CDD\|100105 cd01335, Radical_SAM, Radical SAM superfamily	Back alignment and domain information

>gnl\|CDD\|223576 COG0502, BioB, Biotin synthase and related enzymes [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|235755 PRK06256, PRK06256, biotin synthase; Validated	Back alignment and domain information

>gnl\|CDD\|232973 TIGR00433, bioB, biotin synthase	Back alignment and domain information

>gnl\|CDD\|223988 COG1060, ThiH, Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234446 TIGR04043, rSAM_MSMEG_0568, radical SAM protein, MSMEG_0568 family	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		328
PTZ00413		398	lipoate synthase; Provisional	100.0
PLN02428		349	lipoic acid synthase	100.0
COG0320		306	LipA Lipoate synthase [Coenzyme metabolism]	100.0
TIGR00510		302	lipA lipoate synthase. The family shows strong seq	100.0
PRK12928		290	lipoyl synthase; Provisional	100.0
KOG2672		360	consensus Lipoate synthase [Coenzyme transport and	100.0
PRK05481		289	lipoyl synthase; Provisional	100.0
PRK08444		353	hypothetical protein; Provisional	100.0
TIGR03700		351	mena_SCO4494 putative menaquinone biosynthesis pro	100.0
PRK05926		370	hypothetical protein; Provisional	99.98
COG0502		335	BioB Biotin synthase and related enzymes [Coenzyme	99.97
PRK08445		348	hypothetical protein; Provisional	99.97
TIGR03551		343	F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflav	99.97
PRK05927		350	hypothetical protein; Provisional	99.97
PRK09240		371	thiH thiamine biosynthesis protein ThiH; Reviewed	99.97
PRK07360		371	FO synthase subunit 2; Reviewed	99.97
PRK06256		336	biotin synthase; Validated	99.97
PRK07094		323	biotin synthase; Provisional	99.97
PRK09234		843	fbiC FO synthase; Reviewed	99.97
PRK15108		345	biotin synthase; Provisional	99.96
PRK08508		279	biotin synthase; Provisional	99.96
TIGR02351		366	thiH thiazole biosynthesis protein ThiH. Members t	99.96
TIGR03699		340	mena_SCO4550 menaquinone biosynthesis protein, SCO	99.96
PLN02389		379	biotin synthase	99.96
PRK09613		469	thiH thiamine biosynthesis protein ThiH; Reviewed	99.96
COG1060		370	ThiH Thiamine biosynthesis enzyme ThiH and related	99.96
TIGR00423		309	radical SAM domain protein, CofH subfamily. This p	99.95
COG0621		437	MiaB 2-methylthioadenine synthetase [Translation,	99.95
TIGR00433		296	bioB biotin synthetase. Catalyzes the last step of	99.94
PRK09234		843	fbiC FO synthase; Reviewed	99.93
PRK14327		509	(dimethylallyl)adenosine tRNA methylthiotransferas	99.92
TIGR03550		322	F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflav	99.92
PRK14340		445	(dimethylallyl)adenosine tRNA methylthiotransferas	99.92
PRK06267		350	hypothetical protein; Provisional	99.92
PRK14335		455	(dimethylallyl)adenosine tRNA methylthiotransferas	99.91
PRK14329		467	(dimethylallyl)adenosine tRNA methylthiotransferas	99.91
PRK05904		353	coproporphyrinogen III oxidase; Provisional	99.91
TIGR01579		414	MiaB-like-C MiaB-like tRNA modifying enzyme. This	99.91
PRK14332		449	(dimethylallyl)adenosine tRNA methylthiotransferas	99.91
PRK14339		420	(dimethylallyl)adenosine tRNA methylthiotransferas	99.91
PRK14331		437	(dimethylallyl)adenosine tRNA methylthiotransferas	99.91
PRK05660		378	HemN family oxidoreductase; Provisional	99.9
PRK14326		502	(dimethylallyl)adenosine tRNA methylthiotransferas	99.9
PRK08446		350	coproporphyrinogen III oxidase; Provisional	99.9
TIGR01574		438	miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-3	99.9
PRK14337		446	(dimethylallyl)adenosine tRNA methylthiotransferas	99.9
PRK14325		444	(dimethylallyl)adenosine tRNA methylthiotransferas	99.9
PRK14336		418	(dimethylallyl)adenosine tRNA methylthiotransferas	99.9
PRK14330		434	(dimethylallyl)adenosine tRNA methylthiotransferas	99.9
TIGR01125		430	MiaB-like tRNA modifying enzyme YliG, TIGR01125. T	99.89
PRK14862		440	rimO ribosomal protein S12 methylthiotransferase;	99.89
KOG2900		380	consensus Biotin synthase [Coenzyme transport and	99.89
TIGR00089		429	RNA modification enzyme, MiaB family. This subfami	99.89
PRK14338		459	(dimethylallyl)adenosine tRNA methylthiotransferas	99.89
PRK14328		439	(dimethylallyl)adenosine tRNA methylthiotransferas	99.89
PRK08599		377	coproporphyrinogen III oxidase; Provisional	99.89
PRK14334		440	(dimethylallyl)adenosine tRNA methylthiotransferas	99.89
TIGR01578		420	MiaB-like-B MiaB-like tRNA modifying enzyme, archa	99.89
PRK06245		336	cofG FO synthase subunit 1; Reviewed	99.89
PRK05799		374	coproporphyrinogen III oxidase; Provisional	99.89
PRK07379		400	coproporphyrinogen III oxidase; Provisional	99.89
TIGR00539		360	hemN_rel putative oxygen-independent coproporphyri	99.88
PRK08207		488	coproporphyrinogen III oxidase; Provisional	99.88
PRK14333		448	(dimethylallyl)adenosine tRNA methylthiotransferas	99.88
PRK05628		375	coproporphyrinogen III oxidase; Validated	99.88
PRK09058		449	coproporphyrinogen III oxidase; Provisional	99.88
TIGR02026		497	BchE magnesium-protoporphyrin IX monomethyl ester	99.87
PRK08208		430	coproporphyrinogen III oxidase; Validated	99.87
PRK06294		370	coproporphyrinogen III oxidase; Provisional	99.87
PRK08898		394	coproporphyrinogen III oxidase; Provisional	99.87
PRK09249		453	coproporphyrinogen III oxidase; Provisional	99.87
TIGR03471		472	HpnJ hopanoid biosynthesis associated radical SAM	99.87
TIGR00538		455	hemN oxygen-independent coproporphyrinogen III oxi	99.87
PRK06582		390	coproporphyrinogen III oxidase; Provisional	99.87
PRK09057		380	coproporphyrinogen III oxidase; Provisional	99.87
PRK13347		453	coproporphyrinogen III oxidase; Provisional	99.86
smart00729		216	Elp3 Elongator protein 3, MiaB family, Radical SAM	99.86
COG0635		416	HemN Coproporphyrinogen III oxidase and related Fe	99.82
cd01335		204	Radical_SAM Radical SAM superfamily. Enzymes of th	99.81
PRK13361		329	molybdenum cofactor biosynthesis protein A; Provis	99.8
TIGR01212		302	radical SAM protein, TIGR01212 family. This unchar	99.79
PRK05301		378	pyrroloquinoline quinone biosynthesis protein PqqE	99.78
TIGR02666		334	moaA molybdenum cofactor biosynthesis protein A, b	99.78
PRK08629		433	coproporphyrinogen III oxidase; Provisional	99.77
PF04055		166	Radical_SAM: Radical SAM superfamily; InterPro: IP	99.77
TIGR02109		358	PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E.	99.76
PRK00164		331	moaA molybdenum cofactor biosynthesis protein A; R	99.76
TIGR01210		313	conserved hypothetical protein TIGR01210. This fam	99.75
TIGR03470		318	HpnH hopanoid biosynthesis associated radical SAM	99.74
TIGR02668		302	moaA_archaeal probable molybdenum cofactor biosynt	99.73
PLN02951		373	Molybderin biosynthesis protein CNX2	99.73
COG2896		322	MoaA Molybdenum cofactor biosynthesis enzyme [Coen	99.72
TIGR01290		442	nifB nitrogenase cofactor biosynthesis protein Nif	99.72
PRK01254		707	hypothetical protein; Provisional	99.72
KOG2492		552	consensus CDK5 activator-binding protein [Signal t	99.7
PRK00955		620	hypothetical protein; Provisional	99.7
COG1856		275	Uncharacterized homolog of biotin synthetase [Func	99.67
TIGR02493		235	PFLA pyruvate formate-lyase 1-activating enzyme. A	99.67
PRK11145		246	pflA pyruvate formate lyase-activating enzyme 1; P	99.66
TIGR01211		522	ELP3 histone acetyltransferase, ELP3 family. The S	99.66
COG1032		490	Fe-S oxidoreductase [Energy production and convers	99.62
TIGR03822		321	AblA_like_2 lysine-2,3-aminomutase-related protein	99.62
COG2100		414	Predicted Fe-S oxidoreductase [General function pr	99.62
TIGR02495		191	NrdG2 anaerobic ribonucleoside-triphosphate reduct	99.61
COG0535		347	Predicted Fe-S oxidoreductases [General function p	99.55
PRK13762		322	tRNA-modifying enzyme; Provisional	99.55
COG1180		260	PflA Pyruvate-formate lyase-activating enzyme [Pos	99.55
PRK13758		370	anaerobic sulfatase-maturase; Provisional	99.55
PRK14456		368	ribosomal RNA large subunit methyltransferase N; P	99.53
COG2108		353	Uncharacterized conserved protein related to pyruv	99.52
COG1242		312	Predicted Fe-S oxidoreductase [General function pr	99.5
PRK14459		373	ribosomal RNA large subunit methyltransferase N; P	99.49
PRK14455		356	ribosomal RNA large subunit methyltransferase N; P	99.47
PRK13745		412	anaerobic sulfatase-maturase; Provisional	99.47
TIGR00238		331	KamA family protein. Note that the E. coli homolog	99.47
PRK14469		343	ribosomal RNA large subunit methyltransferase N; P	99.46
TIGR03821		321	AblA_like_1 lysine-2,3-aminomutase-related protein	99.45
PRK14468		343	ribosomal RNA large subunit methyltransferase N; P	99.44
TIGR00048		355	radical SAM enzyme, Cfr family. A Staphylococcus s	99.43
PRK14470		336	ribosomal RNA large subunit methyltransferase N; P	99.42
PRK14460		354	ribosomal RNA large subunit methyltransferase N; P	99.42
PRK14466		345	ribosomal RNA large subunit methyltransferase N; P	99.39
TIGR03278		404	methan_mark_10 putative methanogenesis marker prot	99.39
PRK14457		345	ribosomal RNA large subunit methyltransferase N; P	99.39
TIGR03820		417	lys_2_3_AblA lysine-2,3-aminomutase. This model de	99.38
PRK14463		349	ribosomal RNA large subunit methyltransferase N; P	99.38
COG1243		515	ELP3 Histone acetyltransferase [Transcription / Ch	99.36
COG0641		378	AslB Arylsulfatase regulator (Fe-S oxidoreductase)	99.34
KOG4355		547	consensus Predicted Fe-S oxidoreductase [General f	99.34
PRK14467		348	ribosomal RNA large subunit methyltransferase N; P	99.34
COG1031		560	Uncharacterized Fe-S oxidoreductase [Energy produc	99.3
COG0731		296	Fe-S oxidoreductases [Energy production and conver	99.29
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	99.28
PRK10076		213	pyruvate formate lyase II activase; Provisional	99.27
PRK14454		342	ribosomal RNA large subunit methyltransferase N; P	99.26
PRK14462		356	ribosomal RNA large subunit methyltransferase N; P	99.25
PRK14453		347	chloramphenicol/florfenicol resistance protein; Pr	99.25
PRK11194		372	ribosomal RNA large subunit methyltransferase N; P	99.2
PRK14465		342	ribosomal RNA large subunit methyltransferase N; P	99.15
PRK14464		344	ribosomal RNA large subunit methyltransferase N; P	99.11
TIGR03365		238	Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosyn	99.06
COG1313		335	PflX Uncharacterized Fe-S protein PflX, homolog of	99.05
COG2516		339	Biotin synthase-related enzyme [General function p	99.04
PRK14461		371	ribosomal RNA large subunit methyltransferase N; P	98.81
COG1533		297	SplB DNA repair photolyase [DNA replication, recom	98.79
COG1244		358	Predicted Fe-S oxidoreductase [General function pr	98.79
COG1509		369	KamA Lysine 2,3-aminomutase [Amino acid transport	98.78
COG5014		228	Predicted Fe-S oxidoreductase [General function pr	98.67
COG4277		404	Predicted DNA-binding protein with the Helix-hairp	98.63
KOG2876		323	consensus Molybdenum cofactor biosynthesis pathway	98.61
PF13353		139	Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A	98.56
PF13394		119	Fer4_14: 4Fe-4S single cluster domain; PDB: 1TV8_B	98.54
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	98.5
COG1625		414	Fe-S oxidoreductase, related to NifB/MoaA family [	98.47
TIGR02826		147	RNR_activ_nrdG3 anaerobic ribonucleoside-triphosph	98.3
TIGR02491		154	NrdG anaerobic ribonucleoside-triphosphate reducta	98.26
COG0820		349	Predicted Fe-S-cluster redox enzyme [General funct	98.17
PRK11121		154	nrdG anaerobic ribonucleotide reductase-activating	98.12
COG0602		212	NrdG Organic radical activating enzymes [Posttrans	98.08
TIGR03279		433	cyano_FeS_chp putative FeS-containing Cyanobacteri	97.84
cd07939		259	DRE_TIM_NifV Streptomyces rubellomurinus FrbC and	97.7
cd07948		262	DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s	97.7
COG1964		475	Predicted Fe-S oxidoreductases [General function p	97.55
PRK05692		287	hydroxymethylglutaryl-CoA lyase; Provisional	97.55
PRK11858		378	aksA trans-homoaconitate synthase; Reviewed	97.51
TIGR02660		365	nifV_homocitr homocitrate synthase NifV. This fami	97.51
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	97.49
TIGR02090		363	LEU1_arch isopropylmalate/citramalate/homocitrate	97.48
cd07944		266	DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-	97.48
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	97.47
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	97.43
PLN02746		347	hydroxymethylglutaryl-CoA lyase	97.41
cd07940		268	DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-	97.4
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	97.04
cd07938		274	DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase,	96.97
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	96.7
PRK14024		241	phosphoribosyl isomerase A; Provisional	96.7
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	96.6
PRK09389		488	(R)-citramalate synthase; Provisional	96.6
PRK00915		513	2-isopropylmalate synthase; Validated	96.6
cd07941		273	DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3	96.58
PRK08091		228	ribulose-phosphate 3-epimerase; Validated	96.52
cd07945		280	DRE_TIM_CMS Leptospira interrogans citramalate syn	96.4
PRK14041		467	oxaloacetate decarboxylase; Provisional	96.31
PRK00748		233	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	96.28
TIGR01108		582	oadA oxaloacetate decarboxylase alpha subunit. Thi	96.25
PRK12331		448	oxaloacetate decarboxylase; Provisional	96.21
PRK09282		592	pyruvate carboxylase subunit B; Validated	96.19
KOG2535		554	consensus RNA polymerase II elongator complex, sub	96.13
PRK12330		499	oxaloacetate decarboxylase; Provisional	96.07
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	96.07
PRK01033		258	imidazole glycerol phosphate synthase subunit HisF	95.9
PRK14040		593	oxaloacetate decarboxylase; Provisional	95.81
TIGR00973		494	leuA_bact 2-isopropylmalate synthase, bacterial ty	95.81
cd04732		234	HisA HisA. Phosphoribosylformimino-5-aminoimidazol	95.77
TIGR00007		230	phosphoribosylformimino-5-aminoimidazole carboxami	95.7
COG0159		265	TrpA Tryptophan synthase alpha chain [Amino acid t	95.63
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	95.61
PRK14057		254	epimerase; Provisional	95.5
PRK13585		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	95.42
PRK12581		468	oxaloacetate decarboxylase; Provisional	95.38
KOG4175		268	consensus Tryptophan synthase alpha chain [Amino a	95.2
KOG2550		503	consensus IMP dehydrogenase/GMP reductase [Nucleot	95.14
PF00977		229	His_biosynth: Histidine biosynthesis protein; Inte	95.05
PF04481		242	DUF561: Protein of unknown function (DUF561); Inte	95.03
PRK02083		253	imidazole glycerol phosphate synthase subunit HisF	94.71
PRK14042		596	pyruvate carboxylase subunit B; Provisional	94.69
TIGR00977		526	LeuA_rel 2-isopropylmalate synthase/homocitrate sy	94.6
PRK08745		223	ribulose-phosphate 3-epimerase; Provisional	94.59
PRK08883		220	ribulose-phosphate 3-epimerase; Provisional	94.58
PRK12344		524	putative alpha-isopropylmalate/homocitrate synthas	94.57
PLN02617		538	imidazole glycerol phosphate synthase hisHF	94.52
PLN03228		503	methylthioalkylmalate synthase; Provisional	94.52
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	94.34
PRK07807		479	inosine 5-monophosphate dehydrogenase; Validated	94.27
PRK05096		346	guanosine 5'-monophosphate oxidoreductase; Provisi	94.27
PRK06806		281	fructose-bisphosphate aldolase; Provisional	94.26
PRK11572		248	copper homeostasis protein CutC; Provisional	94.07
COG0106		241	HisA Phosphoribosylformimino-5-aminoimidazole carb	94.0
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD)	93.97
TIGR01496		257	DHPS dihydropteroate synthase. This model represen	93.97
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase, eu	93.88
PRK06552		213	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	93.66
PRK14114		241	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	93.65
PF00478		352	IMPDH: IMP dehydrogenase / GMP reductase domain; I	93.55
PRK13587		234	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	93.54
COG0119		409	LeuA Isopropylmalate/homocitrate/citramalate synth	93.38
PF00834		201	Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam	93.32
PRK15452		443	putative protease; Provisional	93.15
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	93.04
PF01729		169	QRPTase_C: Quinolinate phosphoribosyl transferase,	92.85
cd04723		233	HisA_HisF Phosphoribosylformimino-5-aminoimidazole	92.82
cd00945		201	Aldolase_Class_I Class I aldolases. The class I al	92.77
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	92.77
PF00290		259	Trp_syntA: Tryptophan synthase alpha chain; InterP	92.71
TIGR03249		296	KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh	92.58
cd00950		284	DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke	92.54
COG1856		275	Uncharacterized homolog of biotin synthetase [Func	92.51
PRK06801		286	hypothetical protein; Provisional	92.45
COG0107		256	HisF Imidazoleglycerol-phosphate synthase [Amino a	92.37
cd00739		257	DHPS DHPS subgroup of Pterin binding enzymes. DHPS	92.35
cd07942		284	DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and	92.03
PRK09722		229	allulose-6-phosphate 3-epimerase; Provisional	91.9
PLN02446		262	(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy	91.86
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family b	91.84
TIGR00640		132	acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal	91.73
TIGR00677		281	fadh2_euk methylenetetrahydrofolate reductase, euk	91.72
COG0329		299	DapA Dihydrodipicolinate synthase/N-acetylneuramin	91.71
PRK13586		232	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met	91.62
PRK08005		210	epimerase; Validated	91.53
TIGR00559		237	pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req	91.42
PLN02321		632	2-isopropylmalate synthase	91.4
COG0826		347	Collagenase and related proteases [Posttranslation	91.39
TIGR01859		282	fruc_bis_ald_ fructose-1,6-bisphosphate aldolase,	91.38
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R	91.22
PTZ00170		228	D-ribulose-5-phosphate 3-epimerase; Provisional	91.13
PF07745		332	Glyco_hydro_53: Glycosyl hydrolase family 53; Inte	91.08
cd00954		288	NAL N-Acetylneuraminic acid aldolase, also called	91.07
PRK05265		239	pyridoxine 5'-phosphate synthase; Provisional	91.01
PLN02540		565	methylenetetrahydrofolate reductase	90.93
PRK12290		437	thiE thiamine-phosphate pyrophosphorylase; Reviewe	90.91
cd00952		309	CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate	90.87
PRK03170		292	dihydrodipicolinate synthase; Provisional	90.76
TIGR00674		285	dapA dihydrodipicolinate synthase. Dihydrodipicoli	90.73
PRK07428		288	nicotinate-nucleotide pyrophosphorylase; Provision	90.66
cd07947		279	DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synt	90.61
PRK07896		289	nicotinate-nucleotide pyrophosphorylase; Provision	90.53
PRK05848		273	nicotinate-nucleotide pyrophosphorylase; Provision	90.52
PRK12737		284	gatY tagatose-bisphosphate aldolase; Reviewed	90.48
PRK03620		303	5-dehydro-4-deoxyglucarate dehydratase; Provisiona	90.44
TIGR03128		206	RuMP_HxlA 3-hexulose-6-phosphate synthase. at the	90.43
cd00408		281	DHDPS-like Dihydrodipicolinate synthase family. A	90.39
cd00003		234	PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase	90.38
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	90.15
PRK11613		282	folP dihydropteroate synthase; Provisional	90.07
TIGR03849		237	arch_ComA phosphosulfolactate synthase. This model	90.07
COG5016		472	Pyruvate/oxaloacetate carboxyltransferase [Energy	90.07
cd02071		122	MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin	90.03
PF06180		262	CbiK: Cobalt chelatase (CbiK); InterPro: IPR010388	89.96
TIGR02146		344	LysS_fung_arch homocitrate synthase. This model in	89.85
TIGR01163		210	rpe ribulose-phosphate 3-epimerase. This family co	89.83
TIGR00262		256	trpA tryptophan synthase, alpha subunit. Tryptopha	89.73
COG5016		472	Pyruvate/oxaloacetate carboxyltransferase [Energy	89.71
PRK08195		337	4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac	89.71
PRK02227		238	hypothetical protein; Provisional	89.7
PRK06843		404	inosine 5-monophosphate dehydrogenase; Validated	89.69
TIGR01334		277	modD putative molybdenum utilization protein ModD.	89.64
COG0800		211	Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca	89.62
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like	89.43
PRK05265		239	pyridoxine 5'-phosphate synthase; Provisional	89.37
PLN02334		229	ribulose-phosphate 3-epimerase	89.37
PF05853		272	DUF849: Prokaryotic protein of unknown function (D	89.27
PF03740		239	PdxJ: Pyridoxal phosphate biosynthesis protein Pdx	89.2
PF01261		213	AP_endonuc_2: Xylose isomerase-like TIM barrel; In	89.16
PTZ00314		495	inosine-5'-monophosphate dehydrogenase; Provisiona	89.12
PRK04147		293	N-acetylneuraminate lyase; Provisional	88.98
PRK06096		284	molybdenum transport protein ModD; Provisional	88.95
TIGR02313		294	HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac	88.94
TIGR01858		282	tag_bisphos_ald class II aldolase, tagatose bispho	88.93
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	88.91
cd00951		289	KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also	88.82
PRK09195		284	gatY tagatose-bisphosphate aldolase; Reviewed	88.74
TIGR00683		290	nanA N-acetylneuraminate lyase. N-acetylneuraminat	88.67
PF01136		233	Peptidase_U32: Peptidase family U32 This is family	88.66
TIGR01303		475	IMP_DH_rel_1 IMP dehydrogenase family protein. Thi	88.58
PRK09196		347	fructose-1,6-bisphosphate aldolase; Reviewed	88.56
PRK08185		283	hypothetical protein; Provisional	88.3
TIGR00676		272	fadh2 5,10-methylenetetrahydrofolate reductase, pr	88.29
PF06180		262	CbiK: Cobalt chelatase (CbiK); InterPro: IPR010388	88.27
TIGR02320		285	PEP_mutase phosphoenolpyruvate phosphomutase. A cl	88.25
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	88.08
PRK08385		278	nicotinate-nucleotide pyrophosphorylase; Provision	88.07
COG0269		217	SgbH 3-hexulose-6-phosphate synthase and related p	87.99
cd07943		263	DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-te	87.98
PRK12999		1146	pyruvate carboxylase; Reviewed	87.91
PRK07535		261	methyltetrahydrofolate:corrinoid/iron-sulfur prote	87.9
PRK15452		443	putative protease; Provisional	87.85
PF04476		235	DUF556: Protein of unknown function (DUF556); Inte	87.62
PRK12738		286	kbaY tagatose-bisphosphate aldolase; Reviewed	87.57
cd03412		127	CbiK_N Anaerobic cobalamin biosynthetic cobalt che	87.57
cd04724		242	Tryptophan_synthase_alpha Ttryptophan synthase (TR	87.56
PLN02591		250	tryptophan synthase	87.54
COG0685		291	MetF 5,10-methylenetetrahydrofolate reductase [Ami	87.51
cd00537		274	MTHFR Methylenetetrahydrofolate reductase (MTHFR).	87.48
PF01081		196	Aldolase: KDPG and KHG aldolase; InterPro: IPR0008	87.46
PRK10550		312	tRNA-dihydrouridine synthase C; Provisional	87.44
TIGR01182		204	eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho	87.36
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	87.24
PF00701		289	DHDPS: Dihydrodipicolinate synthetase family; Inte	87.08
PRK06015		201	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	87.07
PRK07709		285	fructose-bisphosphate aldolase; Provisional	86.89
PRK13210		284	putative L-xylulose 5-phosphate 3-epimerase; Revie	86.71
PRK05581		220	ribulose-phosphate 3-epimerase; Validated	86.66
cd06556		240	ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup	86.62
TIGR01302		450	IMP_dehydrog inosine-5'-monophosphate dehydrogenas	86.62
COG3142		241	CutC Uncharacterized protein involved in copper re	86.53
TIGR00284		499	dihydropteroate synthase-related protein. This pro	86.39
PRK05835		307	fructose-bisphosphate aldolase; Provisional	86.14
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	85.93
PRK07998		283	gatY putative fructose-1,6-bisphosphate aldolase;	85.76
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	85.71
cd00377		243	ICL_PEPM Members of the ICL/PEPM enzyme family cat	85.69
cd00331		217	IGPS Indole-3-glycerol phosphate synthase (IGPS);	85.55
PF02581		180	TMP-TENI: Thiamine monophosphate synthase/TENI; In	85.53
cd00423		258	Pterin_binding Pterin binding enzymes. This family	85.35
COG0042		323	tRNA-dihydrouridine synthase [Translation, ribosom	85.19
PRK07114		222	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	85.17
cd02801		231	DUS_like_FMN Dihydrouridine synthase-like (DUS-lik	85.12
PRK07565		334	dihydroorotate dehydrogenase 2; Reviewed	85.07
cd00953		279	KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas	85.06
cd00947		276	TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a	85.06
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c	85.02
TIGR02129		253	hisA_euk phosphoribosylformimino-5-aminoimidazole	84.97
TIGR00737		319	nifR3_yhdG putative TIM-barrel protein, nifR3 fami	84.8
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	84.74
PRK13399		347	fructose-1,6-bisphosphate aldolase; Provisional	84.68
TIGR01235		1143	pyruv_carbox pyruvate carboxylase. This enzyme pla	84.48
COG4822		265	CbiK Cobalamin biosynthesis protein CbiK, Co2+ che	84.47
TIGR00735		254	hisF imidazoleglycerol phosphate synthase, cyclase	84.45
PRK04452		319	acetyl-CoA decarbonylase/synthase complex subunit	84.41
TIGR01769		205	GGGP geranylgeranylglyceryl phosphate synthase. Th	84.39
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine m	84.36
PRK13111		258	trpA tryptophan synthase subunit alpha; Provisiona	84.21
cd07945		280	DRE_TIM_CMS Leptospira interrogans citramalate syn	84.17
PLN02591		250	tryptophan synthase	83.93
PRK13209		283	L-xylulose 5-phosphate 3-epimerase; Reviewed	83.88
cd07939		259	DRE_TIM_NifV Streptomyces rubellomurinus FrbC and	83.79
COG2185		143	Sbm Methylmalonyl-CoA mutase, C-terminal domain/su	83.69
PLN02424		332	ketopantoate hydroxymethyltransferase	83.67
PRK12857		284	fructose-1,6-bisphosphate aldolase; Reviewed	83.64
cd03174		265	DRE_TIM_metallolyase DRE-TIM metallolyase superfam	83.59
TIGR00559		237	pdxJ pyridoxine 5'-phosphate synthase. PdxJ is req	83.18
PRK07107		502	inosine 5-monophosphate dehydrogenase; Validated	82.98
cd04731		243	HisF The cyclase subunit of imidazoleglycerol phos	82.9
cd01299		342	Met_dep_hydrolase_A Metallo-dependent hydrolases,	82.83
PLN02417		280	dihydrodipicolinate synthase	82.83
cd07940		268	DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-	82.82
TIGR00542		279	hxl6Piso_put hexulose-6-phosphate isomerase, putat	82.78
COG0036		220	Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate	82.69
TIGR03217		333	4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase.	82.57
PRK00278		260	trpC indole-3-glycerol-phosphate synthase; Reviewe	82.48
PRK07315		293	fructose-bisphosphate aldolase; Provisional	82.41
PRK14847		333	hypothetical protein; Provisional	82.3
KOG0564		590	consensus 5,10-methylenetetrahydrofolate reductase	82.27
TIGR01521		347	FruBisAldo_II_B fructose-bisphosphate aldolase, cl	82.12
PRK09997		258	hydroxypyruvate isomerase; Provisional	81.99
PRK13398		266	3-deoxy-7-phosphoheptulonate synthase; Provisional	81.98
PLN02334		229	ribulose-phosphate 3-epimerase	81.81
PRK00043		212	thiE thiamine-phosphate pyrophosphorylase; Reviewe	81.65
cd00956		211	Transaldolase_FSA Transaldolase-like fructose-6-ph	81.49
TIGR03572		232	WbuZ glycosyl amidation-associated protein WbuZ. T	81.43
PRK10415		321	tRNA-dihydrouridine synthase B; Provisional	81.38
PRK05692		287	hydroxymethylglutaryl-CoA lyase; Provisional	81.3
PRK05437		352	isopentenyl pyrophosphate isomerase; Provisional	81.27
PF01207		309	Dus: Dihydrouridine synthase (Dus); InterPro: IPR0	81.23
PF00682		237	HMGL-like: HMGL-like of this family is not conserv	81.03
PRK08999		312	hypothetical protein; Provisional	80.99
cd07938		274	DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase,	80.9
CHL00200		263	trpA tryptophan synthase alpha subunit; Provisiona	80.85
PRK07455		187	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog	80.75
PRK13397		250	3-deoxy-7-phosphoheptulonate synthase; Provisional	80.73
PRK05567		486	inosine 5'-monophosphate dehydrogenase; Reviewed	80.66
PRK09517		755	multifunctional thiamine-phosphate pyrophosphoryla	80.62
PRK08005		210	epimerase; Validated	80.53
TIGR02764		191	spore_ybaN_pdaB polysaccharide deacetylase family	80.4
cd07937		275	DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar	80.38
PRK13125		244	trpA tryptophan synthase subunit alpha; Provisiona	80.38
cd00429		211	RPE Ribulose-5-phosphate 3-epimerase (RPE). This e	80.33
cd07941		273	DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3	80.12

>PTZ00413 lipoate synthase; Provisional	Back alignment and domain information

Probab=100.00  E-value=2.6e-53  Score=387.55  Aligned_cols=293  Identities=53%  Similarity=0.962  Sum_probs=266.9

Q ss_pred             ccCCCceecccccCCCCCCCCchhhhhhccCCc----chHHHHHHHhcCCHHHHHHhcCCCCccccccCC-CCceeeEEE
Q 020304           32 MKPPQRQQMGLHTGRDPDVKKPEWLRQKAPQGQ----RFQEVKESLSSLKLNTVCEEAQCPNIGECWNGG-GDGIATATI  106 (328)
Q Consensus        32 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~g~----~~~~~~~~l~~~~l~~l~~~a~~p~i~~~~~~~-~~~~~~~~~  106 (328)
                      .++++.++++++++..  .++|+||+.++..|+    .+.++.++++...|.++|++|.||++.+||.++ +....+++|
T Consensus        75 ~~~~~~~~~~~~~~~~--~~kP~Wlk~~~~~~~~~~~~~~~~~~~~~~~~L~TVCeea~CPNi~EC~~~~~~~~~~tATf  152 (398)
T PTZ00413         75 GLKPSAASIGPIKRGE--EPLPPWFKVKVPKGASRRPRFNRIRRSMREKKLHTVCEEAKCPNIGECWGGGDEEGTATATI  152 (398)
T ss_pred             ccccccccCCCccCCC--CCCCcceeecCCCCccccchHHHHHHHHHhCCCceeeCCCCCCChHHHhCCCCCCCCceeEe
Confidence            4555667777777433  589999999999998    789999999999999999999999999999874 234558999


Q ss_pred             EEeCCCCCCCCCCCccCCCCCCCCCCCCchHHHHHHHHHCCCcEEEEEeccCCCCCCCcHHHHHHHHHHHHHhCCCcEEE
Q 020304          107 MLLGDTCTRGCRFCAVKTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVE  186 (328)
Q Consensus       107 i~~t~gC~~~C~FC~~~~~~~~~~~~~~ei~~~~~~~~~~G~~~i~l~gg~~~~l~~~~~~~l~~li~~ik~~~~~~~i~  186 (328)
                      ++.++.|+.+|.||++.....+...+++|+.+.++.+.++|++++++|+|+.++++|++.+++.+.++.|++..|++.++
T Consensus       153 milG~~CTr~C~FCaqstg~~p~~lD~eEp~~vA~av~~~Gl~~~VVTSv~RDDL~D~ga~~~a~~I~~Ir~~~p~~~Ie  232 (398)
T PTZ00413        153 MVMGDHCTRGCRFCSVKTSRKPPPLDPNEPEKVAKAVAEMGVDYIVMTMVDRDDLPDGGASHVARCVELIKESNPELLLE  232 (398)
T ss_pred             eecCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEEEEEcCCCCChhhHHHHHHHHHHHHccCCCCeEE
Confidence            99999999999999998755445678899999999999999999999999988899989999999999999987899999


Q ss_pred             EEeCCCCCCHHHHHHHHHcCCcEEeechhhHHHHHhhhcCCCCCHHHHHHHHHHHHHh-CCCCeEEEeEEEEcCCCHHHH
Q 020304          187 CLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAGYEQSLEVLKHAKLS-KKGLITKSSIMLGLGESDDDL  265 (328)
Q Consensus       187 ~~t~~~~~~~e~l~~L~~aG~~~i~~~~et~~~~~~~~~~~~~~~~~~l~~i~~~~~~-~~Gi~v~~~~ivGlgEt~e~~  265 (328)
                      ++.+++..+++.++.|++||++.++||+||..+++..++++.++|++.+++++.+++. .+|+.+++++|+|+|||++|+
T Consensus       233 vligDf~g~~e~l~~L~eAG~dvynHNLETv~rLyp~VRt~~atYe~sLe~Lr~AKe~f~~gi~tcSGiIVGLGET~eEv  312 (398)
T PTZ00413        233 ALVGDFHGDLKSVEKLANSPLSVYAHNIECVERITPYVRDRRASYRQSLKVLEHVKEFTNGAMLTKSSIMLGLGETEEEV  312 (398)
T ss_pred             EcCCccccCHHHHHHHHhcCCCEEecccccCHhHHHHHccCcCCHHHHHHHHHHHHHHhcCCceEeeeeEecCCCCHHHH
Confidence            9888877789999999999999999999999999988884468999999999999984 259999999999999999999


Q ss_pred             HHHHHHHHhCCCCEEeeecccCCCCCCcccCCCCCHHHHHHHHHHHHhcCCceeeeccccc
Q 020304          266 KEAMADLRSIDVDILTLGQYLQPTPLHLTVKEYVTPEKFDFWKAYGESIGFRYVASGPLVS  326 (328)
Q Consensus       266 ~~~l~~l~~l~~~~i~i~~~l~PTp~~~~~~~~~~~~~~~~l~~~~~~~G~~~~~~g~~~~  326 (328)
                      .++++.|+++|++.++|+|||+||+.++++..+++|++|+.|++++.++||++|++|||||
T Consensus       313 ie~m~dLrelGVDivtIGQYL~Ps~~h~~V~~yv~P~~F~~~~~~a~~~Gf~~v~sgPlVR  373 (398)
T PTZ00413        313 RQTLRDLRTAGVSAVTLGQYLQPTKTRLKVSRYAHPKEFEMWEEEAMKMGFLYCASGPLVR  373 (398)
T ss_pred             HHHHHHHHHcCCcEEeeccccCCCcccCCceeccCHHHHHHHHHHHHHcCCceEEecCccc
Confidence            9999999999999999999999999999999999999999999999999999999999998

>PLN02428 lipoic acid synthase	Back alignment and domain information

>COG0320 LipA Lipoate synthase [Coenzyme metabolism]	Back alignment and domain information

>TIGR00510 lipA lipoate synthase	Back alignment and domain information

>PRK12928 lipoyl synthase; Provisional	Back alignment and domain information

>KOG2672 consensus Lipoate synthase [Coenzyme transport and metabolism]	Back alignment and domain information

>PRK05481 lipoyl synthase; Provisional	Back alignment and domain information

>PRK08444 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03700 mena_SCO4494 putative menaquinone biosynthesis protein, SCO4494 family	Back alignment and domain information

>PRK05926 hypothetical protein; Provisional	Back alignment and domain information

>COG0502 BioB Biotin synthase and related enzymes [Coenzyme metabolism]	Back alignment and domain information

>PRK08445 hypothetical protein; Provisional	Back alignment and domain information

>TIGR03551 F420_cofH 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit	Back alignment and domain information

>PRK05927 hypothetical protein; Provisional	Back alignment and domain information

>PRK09240 thiH thiamine biosynthesis protein ThiH; Reviewed	Back alignment and domain information

>PRK07360 FO synthase subunit 2; Reviewed	Back alignment and domain information

>PRK06256 biotin synthase; Validated	Back alignment and domain information

>PRK07094 biotin synthase; Provisional	Back alignment and domain information

>PRK09234 fbiC FO synthase; Reviewed	Back alignment and domain information

>PRK15108 biotin synthase; Provisional	Back alignment and domain information

>PRK08508 biotin synthase; Provisional	Back alignment and domain information

>TIGR02351 thiH thiazole biosynthesis protein ThiH	Back alignment and domain information

>TIGR03699 mena_SCO4550 menaquinone biosynthesis protein, SCO4550 family	Back alignment and domain information

>PLN02389 biotin synthase	Back alignment and domain information

>PRK09613 thiH thiamine biosynthesis protein ThiH; Reviewed	Back alignment and domain information

>COG1060 ThiH Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only]	Back alignment and domain information

>TIGR00423 radical SAM domain protein, CofH subfamily	Back alignment and domain information

>COG0621 MiaB 2-methylthioadenine synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00433 bioB biotin synthetase	Back alignment and domain information

>PRK09234 fbiC FO synthase; Reviewed	Back alignment and domain information

>PRK14327 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR03550 F420_cofG 7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit	Back alignment and domain information

>PRK14340 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK06267 hypothetical protein; Provisional	Back alignment and domain information

>PRK14335 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14329 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK05904 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR01579 MiaB-like-C MiaB-like tRNA modifying enzyme	Back alignment and domain information

>PRK14332 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14339 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14331 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK05660 HemN family oxidoreductase; Provisional	Back alignment and domain information

>PRK14326 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK08446 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR01574 miaB-methiolase tRNA-N(6)-(isopentenyl)adenosine-37 thiotransferase enzyme MiaB	Back alignment and domain information

>PRK14337 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14325 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14336 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14330 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125	Back alignment and domain information

>PRK14862 rimO ribosomal protein S12 methylthiotransferase; Provisional	Back alignment and domain information

>KOG2900 consensus Biotin synthase [Coenzyme transport and metabolism]	Back alignment and domain information

>TIGR00089 RNA modification enzyme, MiaB family	Back alignment and domain information

>PRK14338 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK14328 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK08599 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK14334 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>TIGR01578 MiaB-like-B MiaB-like tRNA modifying enzyme, archaeal-type	Back alignment and domain information

>PRK06245 cofG FO synthase subunit 1; Reviewed	Back alignment and domain information

>PRK05799 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK07379 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase	Back alignment and domain information

>PRK08207 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK14333 (dimethylallyl)adenosine tRNA methylthiotransferase; Provisional	Back alignment and domain information

>PRK05628 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>PRK09058 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR02026 BchE magnesium-protoporphyrin IX monomethyl ester anaerobic oxidative cyclase	Back alignment and domain information

>PRK08208 coproporphyrinogen III oxidase; Validated	Back alignment and domain information

>PRK06294 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK08898 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK09249 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ	Back alignment and domain information

>TIGR00538 hemN oxygen-independent coproporphyrinogen III oxidase	Back alignment and domain information

>PRK06582 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK09057 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PRK13347 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>smart00729 Elp3 Elongator protein 3, MiaB family, Radical SAM	Back alignment and domain information

>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism]	Back alignment and domain information

>cd01335 Radical_SAM Radical SAM superfamily	Back alignment and domain information

>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional	Back alignment and domain information

>TIGR01212 radical SAM protein, TIGR01212 family	Back alignment and domain information

>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional	Back alignment and domain information

>TIGR02666 moaA molybdenum cofactor biosynthesis protein A, bacterial	Back alignment and domain information

>PRK08629 coproporphyrinogen III oxidase; Provisional	Back alignment and domain information

>PF04055 Radical_SAM: Radical SAM superfamily; InterPro: IPR007197 Radical SAM proteins catalyze diverse reactions, including unusual methylations, isomerization, sulphur insertion, ring formation, anaerobic oxidation and protein radical formation	Back alignment and domain information

>TIGR02109 PQQ_syn_pqqE coenzyme PQQ biosynthesis protein E	Back alignment and domain information

>PRK00164 moaA molybdenum cofactor biosynthesis protein A; Reviewed	Back alignment and domain information

>TIGR01210 conserved hypothetical protein TIGR01210	Back alignment and domain information

>TIGR03470 HpnH hopanoid biosynthesis associated radical SAM protein HpnH	Back alignment and domain information

>TIGR02668 moaA_archaeal probable molybdenum cofactor biosynthesis protein A, archaeal	Back alignment and domain information

>PLN02951 Molybderin biosynthesis protein CNX2	Back alignment and domain information

>COG2896 MoaA Molybdenum cofactor biosynthesis enzyme [Coenzyme metabolism]	Back alignment and domain information

>TIGR01290 nifB nitrogenase cofactor biosynthesis protein NifB	Back alignment and domain information

>PRK01254 hypothetical protein; Provisional	Back alignment and domain information

>KOG2492 consensus CDK5 activator-binding protein [Signal transduction mechanisms]	Back alignment and domain information

>PRK00955 hypothetical protein; Provisional	Back alignment and domain information

>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown]	Back alignment and domain information

>TIGR02493 PFLA pyruvate formate-lyase 1-activating enzyme	Back alignment and domain information

>PRK11145 pflA pyruvate formate lyase-activating enzyme 1; Provisional	Back alignment and domain information

>TIGR01211 ELP3 histone acetyltransferase, ELP3 family	Back alignment and domain information

>COG1032 Fe-S oxidoreductase [Energy production and conversion]	Back alignment and domain information

>TIGR03822 AblA_like_2 lysine-2,3-aminomutase-related protein	Back alignment and domain information

>COG2100 Predicted Fe-S oxidoreductase [General function prediction only]	Back alignment and domain information

>TIGR02495 NrdG2 anaerobic ribonucleoside-triphosphate reductase activating protein	Back alignment and domain information

>COG0535 Predicted Fe-S oxidoreductases [General function prediction only]	Back alignment and domain information

>PRK13762 tRNA-modifying enzyme; Provisional	Back alignment and domain information

>COG1180 PflA Pyruvate-formate lyase-activating enzyme [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13758 anaerobic sulfatase-maturase; Provisional	Back alignment and domain information

>PRK14456 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme [General function prediction only]	Back alignment and domain information

>COG1242 Predicted Fe-S oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK14459 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14455 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK13745 anaerobic sulfatase-maturase; Provisional	Back alignment and domain information

>TIGR00238 KamA family protein	Back alignment and domain information

>PRK14469 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR03821 AblA_like_1 lysine-2,3-aminomutase-related protein	Back alignment and domain information

>PRK14468 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR00048 radical SAM enzyme, Cfr family	Back alignment and domain information

>PRK14470 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14460 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14466 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR03278 methan_mark_10 putative methanogenesis marker protein 10	Back alignment and domain information

>PRK14457 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR03820 lys_2_3_AblA lysine-2,3-aminomutase	Back alignment and domain information

>PRK14463 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>COG1243 ELP3 Histone acetyltransferase [Transcription / Chromatin structure and dynamics]	Back alignment and domain information

>COG0641 AslB Arylsulfatase regulator (Fe-S oxidoreductase) [General function prediction only]	Back alignment and domain information

>KOG4355 consensus Predicted Fe-S oxidoreductase [General function prediction only]	Back alignment and domain information

>PRK14467 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>COG1031 Uncharacterized Fe-S oxidoreductase [Energy production and conversion]	Back alignment and domain information

>COG0731 Fe-S oxidoreductases [Energy production and conversion]	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>PRK10076 pyruvate formate lyase II activase; Provisional	Back alignment and domain information

>PRK14454 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14462 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14453 chloramphenicol/florfenicol resistance protein; Provisional	Back alignment and domain information

>PRK11194 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14465 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>PRK14464 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE	Back alignment and domain information

>COG1313 PflX Uncharacterized Fe-S protein PflX, homolog of pyruvate formate lyase activating proteins [General function prediction only]	Back alignment and domain information

>COG2516 Biotin synthase-related enzyme [General function prediction only]	Back alignment and domain information

>PRK14461 ribosomal RNA large subunit methyltransferase N; Provisional	Back alignment and domain information

>COG1533 SplB DNA repair photolyase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1244 Predicted Fe-S oxidoreductase [General function prediction only]	Back alignment and domain information

>COG1509 KamA Lysine 2,3-aminomutase [Amino acid transport and metabolism]	Back alignment and domain information

>COG5014 Predicted Fe-S oxidoreductase [General function prediction only]	Back alignment and domain information

>COG4277 Predicted DNA-binding protein with the Helix-hairpin-helix motif [General function prediction only]	Back alignment and domain information

>KOG2876 consensus Molybdenum cofactor biosynthesis pathway protein [Coenzyme transport and metabolism]	Back alignment and domain information

>PF13353 Fer4_12: 4Fe-4S single cluster domain; PDB: 3C8F_A 3CB8_A 3T7V_A 2YX0_A 3CAN_A	Back alignment and domain information

>PF13394 Fer4_14: 4Fe-4S single cluster domain; PDB: 1TV8_B 1TV7_A 2FB2_A 2FB3_A	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>COG1625 Fe-S oxidoreductase, related to NifB/MoaA family [Energy production and conversion]	Back alignment and domain information

>TIGR02826 RNR_activ_nrdG3 anaerobic ribonucleoside-triphosphate reductase activating protein	Back alignment and domain information

>TIGR02491 NrdG anaerobic ribonucleoside-triphosphate reductase activating protein	Back alignment and domain information

>COG0820 Predicted Fe-S-cluster redox enzyme [General function prediction only]	Back alignment and domain information

>PRK11121 nrdG anaerobic ribonucleotide reductase-activating protein; Provisional	Back alignment and domain information

>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase	Back alignment and domain information

>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>COG1964 Predicted Fe-S oxidoreductases [General function prediction only]	Back alignment and domain information

>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional	Back alignment and domain information

>PRK11858 aksA trans-homoaconitate synthase; Reviewed	Back alignment and domain information

>TIGR02660 nifV_homocitr homocitrate synthase NifV	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases	Back alignment and domain information

>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PLN02746 hydroxymethylglutaryl-CoA lyase	Back alignment and domain information

>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>PRK14024 phosphoribosyl isomerase A; Provisional	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>PRK09389 (R)-citramalate synthase; Provisional	Back alignment and domain information

>PRK00915 2-isopropylmalate synthase; Validated	Back alignment and domain information

>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK08091 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK14041 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated	Back alignment and domain information

>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit	Back alignment and domain information

>PRK12331 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>PRK09282 pyruvate carboxylase subunit B; Validated	Back alignment and domain information

>KOG2535 consensus RNA polymerase II elongator complex, subunit ELP3/histone acetyltransferase [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>PRK12330 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK14040 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>TIGR00973 leuA_bact 2-isopropylmalate synthase, bacterial type	Back alignment and domain information

>cd04732 HisA HisA	Back alignment and domain information

>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase	Back alignment and domain information

>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>PRK14057 epimerase; Provisional	Back alignment and domain information

>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK12581 oxaloacetate decarboxylase; Provisional	Back alignment and domain information

>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism]	Back alignment and domain information

>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes	Back alignment and domain information

>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae	Back alignment and domain information

>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional	Back alignment and domain information

>PRK14042 pyruvate carboxylase subunit B; Provisional	Back alignment and domain information

>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein	Back alignment and domain information

>PRK08745 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PRK08883 ribulose-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PRK12344 putative alpha-isopropylmalate/homocitrate synthase family transferase; Provisional	Back alignment and domain information

>PLN02617 imidazole glycerol phosphate synthase hisHF	Back alignment and domain information

>PLN03228 methylthioalkylmalate synthase; Provisional	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>PRK07807 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>PRK06806 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK11572 copper homeostasis protein CutC; Provisional	Back alignment and domain information

>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism]	Back alignment and domain information

>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain	Back alignment and domain information

>TIGR01496 DHPS dihydropteroate synthase	Back alignment and domain information

>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase	Back alignment and domain information

>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>COG0119 LeuA Isopropylmalate/homocitrate/citramalate synthases [Amino acid transport and metabolism]	Back alignment and domain information

>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5	Back alignment and domain information

>PRK15452 putative protease; Provisional	Back alignment and domain information

>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2	Back alignment and domain information

>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>cd00945 Aldolase_Class_I Class I aldolases	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4	Back alignment and domain information

>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase	Back alignment and domain information

>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis	Back alignment and domain information

>COG1856 Uncharacterized homolog of biotin synthetase [Function unknown]	Back alignment and domain information

>PRK06801 hypothetical protein; Provisional	Back alignment and domain information

>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism]	Back alignment and domain information

>cd00739 DHPS DHPS subgroup of Pterin binding enzymes	Back alignment and domain information

>cd07942 DRE_TIM_LeuA Mycobacterium tuberculosis LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK09722 allulose-6-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase	Back alignment and domain information

>cd00452 KDPG_aldolase KDPG and KHG aldolase	Back alignment and domain information

>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain	Back alignment and domain information

>TIGR00677 fadh2_euk methylenetetrahydrofolate reductase, eukaryotic type	Back alignment and domain information

>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional	Back alignment and domain information

>PRK08005 epimerase; Validated	Back alignment and domain information

>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase	Back alignment and domain information

>PLN02321 2-isopropylmalate synthase	Back alignment and domain information

>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist	Back alignment and domain information

>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed	Back alignment and domain information

>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional	Back alignment and domain information

>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3	Back alignment and domain information

>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid)	Back alignment and domain information

>PRK05265 pyridoxine 5'-phosphate synthase; Provisional	Back alignment and domain information

>PLN02540 methylenetetrahydrofolate reductase	Back alignment and domain information

>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA)	Back alignment and domain information

>PRK03170 dihydrodipicolinate synthase; Provisional	Back alignment and domain information

>TIGR00674 dapA dihydrodipicolinate synthase	Back alignment and domain information

>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>cd07947 DRE_TIM_Re_CS Clostridium kluyveri Re-citrate synthase and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional	Back alignment and domain information

>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase	Back alignment and domain information

>cd00408 DHDPS-like Dihydrodipicolinate synthase family	Back alignment and domain information

>cd00003 PNPsynthase Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>PRK11613 folP dihydropteroate synthase; Provisional	Back alignment and domain information

>TIGR03849 arch_ComA phosphosulfolactate synthase	Back alignment and domain information

>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]	Back alignment and domain information

>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain	Back alignment and domain information

>PF06180 CbiK: Cobalt chelatase (CbiK); InterPro: IPR010388 This group, typified by Salmonella typhimurium CbiK, contains anaerobic cobalt chelatases that act in the anaerobic cobalamin biosynthesis pathway [, ]	Back alignment and domain information

>TIGR02146 LysS_fung_arch homocitrate synthase	Back alignment and domain information

>TIGR01163 rpe ribulose-phosphate 3-epimerase	Back alignment and domain information

>TIGR00262 trpA tryptophan synthase, alpha subunit	Back alignment and domain information

>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion]	Back alignment and domain information

>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated	Back alignment and domain information

>PRK02227 hypothetical protein; Provisional	Back alignment and domain information

>PRK06843 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>TIGR01334 modD putative molybdenum utilization protein ModD	Back alignment and domain information

>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins	Back alignment and domain information

>PRK05265 pyridoxine 5'-phosphate synthase; Provisional	Back alignment and domain information

>PLN02334 ribulose-phosphate 3-epimerase	Back alignment and domain information

>PF05853 DUF849: Prokaryotic protein of unknown function (DUF849); InterPro: IPR008567 This family consists of several hypothetical prokaryotic proteins with no known function	Back alignment and domain information

>PF03740 PdxJ: Pyridoxal phosphate biosynthesis protein PdxJ; InterPro: IPR004569 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal)	Back alignment and domain information

>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3	Back alignment and domain information

>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>PRK04147 N-acetylneuraminate lyase; Provisional	Back alignment and domain information

>PRK06096 molybdenum transport protein ModD; Provisional	Back alignment and domain information

>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase	Back alignment and domain information

>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases	Back alignment and domain information

>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>TIGR00683 nanA N-acetylneuraminate lyase	Back alignment and domain information

>PF01136 Peptidase_U32: Peptidase family U32 This is family U32 in the peptidase classification	Back alignment and domain information

>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein	Back alignment and domain information

>PRK09196 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK08185 hypothetical protein; Provisional	Back alignment and domain information

>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase, prokaryotic form	Back alignment and domain information

>PF06180 CbiK: Cobalt chelatase (CbiK); InterPro: IPR010388 This group, typified by Salmonella typhimurium CbiK, contains anaerobic cobalt chelatases that act in the anaerobic cobalamin biosynthesis pathway [, ]	Back alignment and domain information

>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional	Back alignment and domain information

>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd07943 DRE_TIM_HOA 4-hydroxy-2-oxovalerate aldolase, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PRK12999 pyruvate carboxylase; Reviewed	Back alignment and domain information

>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated	Back alignment and domain information

>PRK15452 putative protease; Provisional	Back alignment and domain information

>PF04476 DUF556: Protein of unknown function (DUF556); InterPro: IPR007565 The proteins in this entry are functionally uncharacterised	Back alignment and domain information

>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed	Back alignment and domain information

>cd03412 CbiK_N Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), N-terminal domain	Back alignment and domain information

>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA)	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>COG0685 MetF 5,10-methylenetetrahydrofolate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>cd00537 MTHFR Methylenetetrahydrofolate reductase (MTHFR)	Back alignment and domain information

>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4	Back alignment and domain information

>PRK10550 tRNA-dihydrouridine synthase C; Provisional	Back alignment and domain information

>TIGR01182 eda Entner-Doudoroff aldolase	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants	Back alignment and domain information

>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK07709 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed	Back alignment and domain information

>PRK05581 ribulose-phosphate 3-epimerase; Validated	Back alignment and domain information

>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds	Back alignment and domain information

>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00284 dihydropteroate synthase-related protein	Back alignment and domain information

>PRK05835 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage	Back alignment and domain information

>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water	Back alignment and domain information

>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2	Back alignment and domain information

>cd00423 Pterin_binding Pterin binding enzymes	Back alignment and domain information

>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain	Back alignment and domain information

>PRK07565 dihydroorotate dehydrogenase 2; Reviewed	Back alignment and domain information

>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea	Back alignment and domain information

>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases	Back alignment and domain information

>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain	Back alignment and domain information

>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type	Back alignment and domain information

>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family	Back alignment and domain information

>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed	Back alignment and domain information

>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional	Back alignment and domain information

>TIGR01235 pyruv_carbox pyruvate carboxylase	Back alignment and domain information

>COG4822 CbiK Cobalamin biosynthesis protein CbiK, Co2+ chelatase [Coenzyme metabolism]	Back alignment and domain information

>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit	Back alignment and domain information

>PRK04452 acetyl-CoA decarbonylase/synthase complex subunit delta; Provisional	Back alignment and domain information

>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase	Back alignment and domain information

>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>PRK13111 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd07945 DRE_TIM_CMS Leptospira interrogans citramalate synthase (CMS) and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

>PLN02591 tryptophan synthase	Back alignment and domain information

>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed	Back alignment and domain information

>cd07939 DRE_TIM_NifV Streptomyces rubellomurinus FrbC and related proteins, catalytic TIM barrel domain	Back alignment and domain information

>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism]	Back alignment and domain information

>PLN02424 ketopantoate hydroxymethyltransferase	Back alignment and domain information

>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed	Back alignment and domain information

>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily	Back alignment and domain information

>TIGR00559 pdxJ pyridoxine 5'-phosphate synthase	Back alignment and domain information

>PRK07107 inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF)	Back alignment and domain information

>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site	Back alignment and domain information

>PLN02417 dihydrodipicolinate synthase	Back alignment and domain information

>cd07940 DRE_TIM_IPMS 2-isopropylmalate synthase (IPMS), N-terminal catalytic TIM barrel domain	Back alignment and domain information

>TIGR00542 hxl6Piso_put hexulose-6-phosphate isomerase, putative	Back alignment and domain information

>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase	Back alignment and domain information

>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed	Back alignment and domain information

>PRK07315 fructose-bisphosphate aldolase; Provisional	Back alignment and domain information

>PRK14847 hypothetical protein; Provisional	Back alignment and domain information

>KOG0564 consensus 5,10-methylenetetrahydrofolate reductase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype	Back alignment and domain information

>PRK09997 hydroxypyruvate isomerase; Provisional	Back alignment and domain information

>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PLN02334 ribulose-phosphate 3-epimerase	Back alignment and domain information

>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed	Back alignment and domain information

>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases	Back alignment and domain information

>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ	Back alignment and domain information

>PRK10415 tRNA-dihydrouridine synthase B; Provisional	Back alignment and domain information

>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional	Back alignment and domain information

>PRK05437 isopentenyl pyrophosphate isomerase; Provisional	Back alignment and domain information

>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA	Back alignment and domain information

>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members	Back alignment and domain information

>PRK08999 hypothetical protein; Provisional	Back alignment and domain information

>cd07938 DRE_TIM_HMGL 3-hydroxy-3-methylglutaryl-CoA lyase, catalytic TIM barrel domain	Back alignment and domain information

>CHL00200 trpA tryptophan synthase alpha subunit; Provisional	Back alignment and domain information

>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional	Back alignment and domain information

>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional	Back alignment and domain information

>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional	Back alignment and domain information

>PRK08005 epimerase; Validated	Back alignment and domain information

>TIGR02764 spore_ybaN_pdaB polysaccharide deacetylase family sporulation protein PdaB	Back alignment and domain information

>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain	Back alignment and domain information

>PRK13125 trpA tryptophan synthase subunit alpha; Provisional	Back alignment and domain information

>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE)	Back alignment and domain information

>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		328
3iix_A		348	Biotin synthetase, putative; adoMet radical, SAM r	7e-10
3t7v_A		350	Methylornithine synthase PYLB; TIM-barrel fold, mu	1e-09
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-04

>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A* Length = 348	Back alignment and structure

 Score = 58.4 bits (141), Expect = 7e-10
 Identities = 42/211 (19%), Positives = 75/211 (35%), Gaps = 13/211 (6%)

Query: 98  GDGIATATIMLLGDTCTRGCRFCAVKTSRNPAPPDPMEPE---NTAKAIASWGVDYIVLT 154
           GD +    I+   + C + C +C ++          M PE     A+    +G   IVL 
Sbjct: 48  GDEVHIRAIIEFSNVCRKNCLYCGLRRDNKNLKRYRMTPEEIVERARLAVQFGAKTIVLQ 107

Query: 155 SVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNI 214
           S +             + +K M       +   L+          E    +G D +    
Sbjct: 108 SGEDPYXMPDVISDIVKEIKKMG------VAVTLSLGEW-PREYYEKWKEAGADRYLLRH 160

Query: 215 ETVKRLQRIVRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGL-GESDDDLKEAMADLR 273
           ET   +      P   +E  L  L   K  + G  T +  M+GL G++ DDL + +  L+
Sbjct: 161 ETANPVLHRKLRPDTSFENRLNCLLTLK--ELGYETGAGSMVGLPGQTIDDLVDDLLFLK 218

Query: 274 SIDVDILTLGQYLQPTPLHLTVKEYVTPEKF 304
             D D++ +G ++      L  ++       
Sbjct: 219 EHDFDMVGIGPFIPHPDTPLANEKKGDFTLT 249

PyMOL of 3iix

>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri} Length = 350	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		328
3t7v_A		350	Methylornithine synthase PYLB; TIM-barrel fold, mu	99.97
3iix_A		348	Biotin synthetase, putative; adoMet radical, SAM r	99.96
1r30_A		369	Biotin synthase; SAM radical protein, TIM barrel,	99.94
2qgq_A		304	Protein TM_1862; alpha-beta protein, structural ge	99.91
1olt_A		457	Oxygen-independent coproporphyrinogen III oxidase;	99.88
3c8f_A		245	Pyruvate formate-lyase 1-activating enzyme; adoMet	99.79
1tv8_A		340	MOAA, molybdenum cofactor biosynthesis protein A;	99.78
2yx0_A		342	Radical SAM enzyme; predicted tRNA modification en	99.7
2z2u_A		311	UPF0026 protein MJ0257; metal binding protein; 2.4	99.62
3rfa_A		404	Ribosomal RNA large subunit methyltransferase N; r	99.55
2a5h_A		416	L-lysine 2,3-aminomutase; radical SAM, four-iron-f	99.54
3can_A		182	Pyruvate-formate lyase-activating enzyme; structur	99.23
4fhd_A		368	Spore photoproduct lyase; partial TIM-barrel, DNA	98.42
2cw6_A		298	Hydroxymethylglutaryl-COA lyase, mitochondrial; HM	97.77
1ydn_A		295	Hydroxymethylglutaryl-COA lyase; TIM-barrel protei	97.59
1ydo_A		307	HMG-COA lyase; TIM-barrel protein, structural geno	97.48
2ftp_A		302	Hydroxymethylglutaryl-COA lyase; structural genomi	97.21
3ewb_X		293	2-isopropylmalate synthase; LEUA, structural genom	97.02
3eeg_A		325	2-isopropylmalate synthase; 11106D, beta barrel, P	96.97
3ivs_A		423	Homocitrate synthase, mitochondrial; TIM barrel, m	96.91
1nvm_A		345	HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered	96.87
3ble_A		337	Citramalate synthase from leptospira interrogans;	96.83
2ztj_A		382	Homocitrate synthase; (beta/alpha)8 TIM barrel, su	96.6
3rmj_A		370	2-isopropylmalate synthase; LEUA, truncation, neis	96.22
2nx9_A		464	Oxaloacetate decarboxylase 2, subunit alpha; carbo	96.18
1rqb_A		539	Transcarboxylase 5S subunit; TIM-barrel, carbamyla	96.06
2y88_A		244	Phosphoribosyl isomerase A; aromatic amino acid bi	95.26
4e38_A		232	Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho	95.05
3nav_A		271	Tryptophan synthase alpha chain; alpha subunit, st	95.01
3vnd_A		267	TSA, tryptophan synthase alpha chain; psychrophili	94.93
1thf_D		253	HISF protein; thermophIle, TIM-barrel, histidine b	94.54
1vzw_A		244	Phosphoribosyl isomerase A; histidine biosynthesis	94.43
1ka9_F		252	Imidazole glycerol phosphtate synthase; riken stru	94.27
3tdn_A		247	FLR symmetric alpha-beta TIM barrel; symmetric sup	94.02
1h5y_A		253	HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py	93.89
1vhc_A		224	Putative KHG/KDPG aldolase; structural genomics, u	93.78
2yci_X		271	5-methyltetrahydrofolate corrinoid/iron sulfur PR	93.59
1eye_A		280	DHPS 1, dihydropteroate synthase I; alpha-beta bar	93.46
3lab_A		217	Putative KDPG (2-keto-3-deoxy-6-phosphogluconate)	93.09
2r91_A		286	2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM	93.01
2dqw_A		294	Dihydropteroate synthase; dimer, structural genomi	92.96
1w3i_A		293	EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m	92.95
3tsm_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	92.77
2nuw_A		288	2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a	92.73
4af0_A		556	Inosine-5'-monophosphate dehydrogenase; oxidoreduc	92.58
3inp_A		246	D-ribulose-phosphate 3-epimerase; IDP02542, isomer	92.51
1aj0_A		282	DHPS, dihydropteroate synthase; antibiotic, resist	92.41
2vp8_A		318	Dihydropteroate synthase 2; RV1207 transferase, fo	92.41
3qja_A		272	IGPS, indole-3-glycerol phosphate synthase; struct	92.26
2y5s_A		294	DHPS, dihydropteroate synthase; transferase, folat	92.19
1mxs_A		225	KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a	92.04
2ekc_A		262	AQ_1548, tryptophan synthase alpha chain; structur	91.97
3m5v_A		301	DHDPS, dihydrodipicolinate synthase; TIM barrel, c	91.84
4gj1_A		243	1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me	91.75
3lmz_A		257	Putative sugar isomerase; structural genomics, joi	91.74
1tqj_A		230	Ribulose-phosphate 3-epimerase; beta-alpha barrel	91.7
1wbh_A		214	KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli}	91.65
4fxs_A		496	Inosine-5'-monophosphate dehydrogenase; structural	91.6
3cpr_A		304	Dihydrodipicolinate synthetase; (beta/alpha)8-barr	91.24
1h1y_A		228	D-ribulose-5-phosphate 3-epimerase; oxidative pent	91.14
2bdq_A		224	Copper homeostasis protein CUTC; alpha beta protei	91.09
3usb_A		511	Inosine-5'-monophosphate dehydrogenase; structural	91.08
1xky_A		301	Dihydrodipicolinate synthase; TIM barrel, , lysine	90.85
3flu_A		297	DHDPS, dihydrodipicolinate synthase; TIM barrel, b	90.82
3e96_A		316	Dihydrodipicolinate synthase; structural genomics,	90.81
3qze_A		314	DHDPS, dihydrodipicolinate synthase; alpha beta ba	90.69
4avf_A		490	Inosine-5'-monophosphate dehydrogenase; oxidoreduc	90.61
3na8_A		315	Putative dihydrodipicolinate synthetase; lyase; HE	90.56
3tr9_A		314	Dihydropteroate synthase; biosynthesis of cofactor	90.52
2ehh_A		294	DHDPS, dihydrodipicolinate synthase; structural ge	90.36
2yxg_A		289	DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b	90.26
2y7e_A		282	3-keto-5-aminohexanoate cleavage enzyme; lyase, al	90.12
3fst_A		304	5,10-methylenetetrahydrofolate reductase; TIM barr	90.05
3si9_A		315	DHDPS, dihydrodipicolinate synthase; structural ge	90.03
1f6k_A		293	N-acetylneuraminate lyase; beta barrel; 1.60A {Hae	89.97
3fkr_A		309	L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f	89.78
2vc6_A		292	MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar	89.77
2rfg_A		297	Dihydrodipicolinate synthase; beta barrel, amino-a	89.75
3d0c_A		314	Dihydrodipicolinate synthase; lysine biosynthesis,	89.74
3daq_A		292	DHDPS, dihydrodipicolinate synthase; lysine biosyn	89.68
1m5w_A		243	Pyridoxal phosphate biosynthetic protein PDXJ; TIM	89.67
3l21_A		304	DHDPS, dihydrodipicolinate synthase; DAPA, dimer,	89.65
2v9d_A		343	YAGE; dihydrodipicolinic acid synthase, N-acetyl n	89.51
1o5k_A		306	DHDPS, dihydrodipicolinate synthase; TM1521, struc	89.42
3b4u_A		294	Dihydrodipicolinate synthase; structural genomics,	89.32
3dxi_A		320	Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX	89.28
3tak_A		291	DHDPS, dihydrodipicolinate synthase; TIM barrel, l	89.24
1jvn_A		555	Glutamine, bifunctional histidine biosynthesis pro	89.19
3bg3_A		718	Pyruvate carboxylase, mitochondrial; TIM barrel, A	89.17
2r8w_A		332	AGR_C_1641P; APC7498, dihydrodipicolinate synthase	89.16
2ojp_A		292	DHDPS, dihydrodipicolinate synthase; dimer, lysine	88.96
2wkj_A		303	N-acetylneuraminate lyase; directed evolution, sia	88.93
3chv_A		284	Prokaryotic domain of unknown function (DUF849) W	88.78
3gk0_A		278	PNP synthase, pyridoxine 5'-phosphate synthase; de	88.78
1qwg_A		251	PSL synthase;, (2R)-phospho-3-sulfolactate synthas	88.63
1qop_A		268	Tryptophan synthase alpha chain; lyase, carbon-oxy	88.54
3no5_A		275	Uncharacterized protein; PFAM DUF849 domain contai	88.51
1twd_A		256	Copper homeostasis protein CUTC; TIM-like protein,	88.42
3s5o_A		307	4-hydroxy-2-oxoglutarate aldolase, mitochondrial;	87.78
3a5f_A		291	Dihydrodipicolinate synthase; TIM barrel, enzyme,	87.49
2w6r_A		266	Imidazole glycerol phosphate synthase subunit HISF	87.38
3eb2_A		300	Putative dihydrodipicolinate synthetase; lysine bi	87.36
3h5d_A		311	DHDPS, dihydrodipicolinate synthase; lysine biosyn	87.3
3ctl_A		231	D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p	87.18
3p6l_A		262	Sugar phosphate isomerase/epimerase; TIM barrel, s	86.2
3qfe_A		318	Putative dihydrodipicolinate synthase family PROT;	86.15
1vrd_A		494	Inosine-5'-monophosphate dehydrogenase; TM1347, st	86.08
1vc4_A		254	Indole-3-glycerol phosphate synthase; lyase, trypt	86.06
1i60_A		278	IOLI protein; beta barrel, structural genomics, PS	86.0
3mcm_A		442	2-amino-4-hydroxy-6-hydroxymethyldihydropteridine	85.6
4fo4_A		366	Inosine 5'-monophosphate dehydrogenase; structural	85.59
3dz1_A		313	Dihydrodipicolinate synthase; lysine biosynthesis,	85.51
1qpo_A		284	Quinolinate acid phosphoribosyl transferase; type	85.37
1tx2_A		297	DHPS, dihydropteroate synthase; folate biosynthesi	85.36
1tqx_A		227	D-ribulose-5-phosphate 3-epimerase, putative; stru	85.13
3apt_A		310	Methylenetetrahydrofolate reductase; TIM barrel, o	84.95
3o6c_A		260	PNP synthase, pyridoxine 5'-phosphate synthase; st	84.89
2hmc_A		344	AGR_L_411P, dihydrodipicolinate synthase; alpha-be	84.62
3c6c_A		316	3-keto-5-aminohexanoate cleavage enzyme; DUF849 fa	84.31
2ftp_A		302	Hydroxymethylglutaryl-COA lyase; structural genomi	84.25
4fo4_A		366	Inosine 5'-monophosphate dehydrogenase; structural	84.19
2b7n_A		273	Probable nicotinate-nucleotide pyrophosphorylase;	83.74
3noy_A		366	4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth;	83.24
3khj_A		361	Inosine-5-monophosphate dehydrogenase; enzyme-inhi	83.12
2jbm_A		299	Nicotinate-nucleotide pyrophosphorylase; NAD, enzy	82.98
4djd_D		323	C/Fe-SP, corrinoid/iron-sulfur protein small subun	82.83
3k13_A		300	5-methyltetrahydrofolate-homocysteine methyltrans;	82.31
2ekc_A		262	AQ_1548, tryptophan synthase alpha chain; structur	82.14
1nvm_A		345	HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered	82.1
3tva_A		290	Xylose isomerase domain protein TIM barrel; struct	81.93
1qop_A		268	Tryptophan synthase alpha chain; lyase, carbon-oxy	81.69
3ble_A		337	Citramalate synthase from leptospira interrogans;	81.62
3hbl_A		1150	Pyruvate carboxylase; TIM barrel, ligase; HET: BTI	81.18
1pii_A		452	N-(5'phosphoribosyl)anthranilate isomerase; bifunc	81.12
1hjs_A		332	Beta-1,4-galactanase; 4-galactanases, family 53 gl	81.05
3tha_A		252	Tryptophan synthase alpha chain; structural genomi	80.83
1o4u_A		285	Type II quinolic acid phosphoribosyltransferase; s	80.8
2isw_A		323	Putative fructose-1,6-bisphosphate aldolase; class	80.75
3e49_A		311	Uncharacterized protein DUF849 with A TIM barrel;	80.41
3e02_A		311	Uncharacterized protein DUF849; structural genomic	80.34

>3t7v_A Methylornithine synthase PYLB; TIM-barrel fold, mutase, [4Fe-4S]-cluster, SAM, lysine, transferase; HET: SAM MD0; 1.50A {Methanosarcina barkeri}	Back alignment and structure

Probab=99.97  E-value=2.8e-30  Score=241.80  Aligned_cols=227  Identities=18%  Similarity=0.281  Sum_probs=187.2

Q ss_pred             hhhhhccCCcchHH--HHHHHhcC---CHHHHHHhcCCCCccccccCCCCceeeEEEEEeCCCCCCCCCCCccCCCCCC-
Q 020304           55 WLRQKAPQGQRFQE--VKESLSSL---KLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGDTCTRGCRFCAVKTSRNP-  128 (328)
Q Consensus        55 ~i~~~~~~g~~~~~--~~~~l~~~---~l~~l~~~a~~p~i~~~~~~~~~~~~~~~~i~~t~gC~~~C~FC~~~~~~~~-  128 (328)
                      .|.+|+.+|++++.  +..+++..   +++.|++.|+  .++++++|  +.+..++++++|++|+.+|.||+++..... 
T Consensus        12 ~i~~k~~~~~~l~~~e~~~l~~~~~~~~~~~L~~~A~--~~r~~~~g--~~v~~~~~i~~t~~C~~~C~fC~~~~~~~~~   87 (350)
T 3t7v_A           12 SLGDKVIEGYQLTDNDLRTLLSLESKEGLERLYSAAR--KVRDHYFG--NRVFLNCFIYFSTYCKNQCSFCYYNCRNEIN   87 (350)
T ss_dssp             CHHHHHHTTCCCCHHHHHHHHTCCSHHHHHHHHHHHH--HHHHHHHT--TEEEEEEEEEEECCCCCCCTTCTTCTTSCCC
T ss_pred             HHHHHHHcCCCCCHHHHHHHhcCCChhHHHHHHHHHH--HHHHHHCC--CEEEEEEeeecCCCcCCCCCcCCCcCcCCCC
Confidence            46688889988755  66677643   5778999999  99988887  467778889999999999999999765422 


Q ss_pred             -CCCCCCchHHHHHHHHHCCCcEEEEEeccCCCCCCCcHHHHHHHHHHHHHhCCCcEEEEEeCCCCCCHHHHHHHHHcCC
Q 020304          129 -APPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGL  207 (328)
Q Consensus       129 -~~~~~~ei~~~~~~~~~~G~~~i~l~gg~~~~l~~~~~~~l~~li~~ik~~~~~~~i~~~t~~~~~~~e~l~~L~~aG~  207 (328)
                       ..++++++.+.++++.+.|+++++|+||+.|.+. .+.+++.++++.+++.+ ++.+.+ +++ .++++.++.|+++|+
T Consensus        88 ~~~ls~eei~~~~~~~~~~G~~~i~l~gGe~p~~~-~~~~~~~~l~~~ik~~~-~i~i~~-s~g-~~~~e~l~~L~~aG~  163 (350)
T 3t7v_A           88 RYRLTMEEIKETCKTLKGAGFHMVDLTMGEDPYYY-EDPNRFVELVQIVKEEL-GLPIMI-SPG-LMDNATLLKAREKGA  163 (350)
T ss_dssp             CCBCCHHHHHHHHHHHTTSCCSEEEEEECCCHHHH-HSTHHHHHHHHHHHHHH-CSCEEE-ECS-SCCHHHHHHHHHTTE
T ss_pred             ceeCCHHHHHHHHHHHHHCCCCEEEEeeCCCCccc-cCHHHHHHHHHHHHhhc-CceEEE-eCC-CCCHHHHHHHHHcCC
Confidence             2356788888899888999999999998854331 01488999999999865 566643 343 469999999999999


Q ss_pred             cEEeechhhH-HHHHhhhcCCCCCHHHHHHHHHHHHHhCCCCeEEEeEEEEcCCCHHHHHHHHHHHHhCCCCEEeeeccc
Q 020304          208 DVFAHNIETV-KRLQRIVRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVDILTLGQYL  286 (328)
Q Consensus       208 ~~i~~~~et~-~~~~~~~~~~~~~~~~~l~~i~~~~~~~~Gi~v~~~~ivGlgEt~e~~~~~l~~l~~l~~~~i~i~~~l  286 (328)
                      +++.+++|++ +++++.++ +++++++++++++.+++  .|+.+++++|+|+|||.+++.++++++++++++.+++++|.
T Consensus       164 ~~i~i~lEt~~~~~~~~i~-~~~~~~~~l~~i~~a~~--~Gi~v~~~~i~Glget~e~~~~~l~~l~~l~~~~v~~~~f~  240 (350)
T 3t7v_A          164 NFLALYQETYDTELYRKLR-VGQSFDGRVNARRFAKQ--QGYCVEDGILTGVGNDIESTILSLRGMSTNDPDMVRVMTFL  240 (350)
T ss_dssp             EEEECCCBCSCHHHHHHHS-TTCCHHHHHHHHHHHHH--HTCEEEEEEEESSSCCHHHHHHHHHHHHHTCCSEEEEEECC
T ss_pred             CEEEEeeecCCHHHHHHhC-CCCCHHHHHHHHHHHHH--cCCeEccceEeecCCCHHHHHHHHHHHHhCCCCEEEeccee
Confidence            9999999998 45777776 47899999999999999  99999999999999999999999999999999999998777


Q ss_pred             C-C-CCCC
Q 020304          287 Q-P-TPLH  292 (328)
Q Consensus       287 ~-P-Tp~~  292 (328)
                      . | ||++
T Consensus       241 p~~gT~l~  248 (350)
T 3t7v_A          241 PQEGTPLE  248 (350)
T ss_dssp             CCTTSTTT
T ss_pred             eCCCCcCc
Confidence            3 2 7765

PyMOL of 3t7v

>3iix_A Biotin synthetase, putative; adoMet radical, SAM radical, adoMet cleavage, Fe4S4 cluster, HYDE, hydrogenase, maturation, beta barrel; HET: OTY CSO 5AD CPS; 1.25A {Thermotoga maritima} PDB: 3ciw_A* 3iiz_A* 3cix_A*	Back alignment and structure

>1r30_A Biotin synthase; SAM radical protein, TIM barrel, FES cluster, transferase; HET: SAM DTB; 3.40A {Escherichia coli} SCOP: c.1.28.1	Back alignment and structure

>2qgq_A Protein TM_1862; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: CXS; 2.00A {Thermotoga maritima MSB8}	Back alignment and structure

>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2	Back alignment and structure

>3c8f_A Pyruvate formate-lyase 1-activating enzyme; adoMet radical, SAM radical, activase, glycyl radical, 4Fe- 4S, carbohydrate metabolism, cytoplasm; HET: MT2 PGE; 2.25A {Escherichia coli} PDB: 3cb8_A*	Back alignment and structure

>1tv8_A MOAA, molybdenum cofactor biosynthesis protein A; TIM barrel, ligand binding protein; HET: SAM; 2.20A {Staphylococcus aureus} SCOP: c.1.28.3 PDB: 1tv7_A* 2fb3_A* 2fb2_A*	Back alignment and structure

>2yx0_A Radical SAM enzyme; predicted tRNA modification enzyme, metal binding protein, structural genomics, NPPSFA; 2.21A {Pyrococcus horikoshii}	Back alignment and structure

>2z2u_A UPF0026 protein MJ0257; metal binding protein; 2.40A {Methanocaldococcus jannaschii}	Back alignment and structure

>3rfa_A Ribosomal RNA large subunit methyltransferase N; radical SAM, S-adenosylmethionine, iron sulfur cluster, oxidoreductase; HET: SAM; 2.05A {Escherichia coli} PDB: 3rf9_A*	Back alignment and structure

>2a5h_A L-lysine 2,3-aminomutase; radical SAM, four-iron-four-sulfur cluster, 4Fe4S, FS4, SAM, adenosylmethionine, alpha-beta channel; HET: SAM LYS PLP; 2.10A {Clostridium subterminale}	Back alignment and structure

>3can_A Pyruvate-formate lyase-activating enzyme; structural genomics, pyruvate-formate lyase-activating enzym MCSG, APC20359.1; 1.80A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>4fhd_A Spore photoproduct lyase; partial TIM-barrel, DNA repair, damaged DNA; HET: EEM 0TT; 2.00A {Geobacillus thermodenitrificans} PDB: 4fhc_A* 4fhg_A* 4fhe_A* 4fhf_A*	Back alignment and structure

>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A*	Back alignment and structure

>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis}	Back alignment and structure

>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp}	Back alignment and structure

>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa}	Back alignment and structure

>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str}	Back alignment and structure

>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406}	Back alignment and structure

>3ivs_A Homocitrate synthase, mitochondrial; TIM barrel, metalloprotein, transferase, claisen condensatio acid biosynthesis; 2.24A {Schizosaccharomyces pombe} PDB: 3ivt_A* 3ivu_A* 3mi3_A*	Back alignment and structure

>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5	Back alignment and structure

>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A*	Back alignment and structure

>2ztj_A Homocitrate synthase; (beta/alpha)8 TIM barrel, substrate complex, amino-acid BIOS lysine biosynthesis, transferase; HET: AKG; 1.80A {Thermus thermophilus} PDB: 2ztk_A* 2zyf_A* 3a9i_A*	Back alignment and structure

>3rmj_A 2-isopropylmalate synthase; LEUA, truncation, neisseria MENI TIM barrel, catalytic domain, dimer, leucine biosynthesis, ketoisovalerate; 1.95A {Neisseria meningitidis}	Back alignment and structure

>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae}	Back alignment and structure

>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A*	Back alignment and structure

>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A*	Back alignment and structure

>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3}	Back alignment and structure

>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4	Back alignment and structure

>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina}	Back alignment and structure

>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A	Back alignment and structure

>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A	Back alignment and structure

>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1	Back alignment and structure

>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A	Back alignment and structure

>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1	Back alignment and structure

>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1	Back alignment and structure

>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X*	Back alignment and structure

>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1	Back alignment and structure

>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A	Back alignment and structure

>2dqw_A Dihydropteroate synthase; dimer, structural genomics; 1.65A {Thermus thermophilus} PDB: 2dza_A* 2dzb_A*	Back alignment and structure

>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A*	Back alignment and structure

>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0	Back alignment and structure

>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A	Back alignment and structure

>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B*	Back alignment and structure

>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp}	Back alignment and structure

>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A	Back alignment and structure

>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis}	Back alignment and structure

>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A*	Back alignment and structure

>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A*	Back alignment and structure

>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1	Back alignment and structure

>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus}	Back alignment and structure

>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A*	Back alignment and structure

>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp}	Back alignment and structure

>3lmz_A Putative sugar isomerase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS isomerase; HET: MSE CIT PGE; 1.44A {Parabacteroides distasonis}	Back alignment and structure

>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2	Back alignment and structure

>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A*	Back alignment and structure

>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor}	Back alignment and structure

>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum}	Back alignment and structure

>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A	Back alignment and structure

>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae}	Back alignment and structure

>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A*	Back alignment and structure

>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A*	Back alignment and structure

>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0	Back alignment and structure

>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0	Back alignment and structure

>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A	Back alignment and structure

>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa}	Back alignment and structure

>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa}	Back alignment and structure

>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii}	Back alignment and structure

>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus}	Back alignment and structure

>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661}	Back alignment and structure

>2y7e_A 3-keto-5-aminohexanoate cleavage enzyme; lyase, aldolase; 1.28A {Candidatus cloacamonas acidaminovoransorganism_taxid} PDB: 2y7d_A 2y7f_A* 2y7g_A	Back alignment and structure

>3fst_A 5,10-methylenetetrahydrofolate reductase; TIM barrel, flavin, amino-acid biosynthesis, FAD, flavoprotein, methionine biosynthesis, NAD; HET: FAD MRY; 1.65A {Escherichia coli k-12} PDB: 3fsu_A* 1zp3_A* 1zpt_A* 1zrq_A* 1zp4_A* 2fmn_A* 2fmo_A* 1b5t_A*	Back alignment and structure

>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae}	Back alignment and structure

>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A*	Back alignment and structure

>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A	Back alignment and structure

>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti}	Back alignment and structure

>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis}	Back alignment and structure

>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831}	Back alignment and structure

>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A	Back alignment and structure

>1m5w_A Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli} SCOP: c.1.24.1 PDB: 1ho1_A 1ho4_A* 1ixn_A* 1ixo_A* 1ixp_A 1ixq_A 3f4n_A*	Back alignment and structure

>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A	Back alignment and structure

>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A*	Back alignment and structure

>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A	Back alignment and structure

>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str}	Back alignment and structure

>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482}	Back alignment and structure

>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A	Back alignment and structure

>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A	Back alignment and structure

>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A	Back alignment and structure

>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str}	Back alignment and structure

>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A	Back alignment and structure

>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A	Back alignment and structure

>3chv_A Prokaryotic domain of unknown function (DUF849) W barrel fold; TIM barrel fold, structural genomics, joint center for struc genomics; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A	Back alignment and structure

>3gk0_A PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei}	Back alignment and structure

>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1	Back alignment and structure

>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ...	Back alignment and structure

>3no5_A Uncharacterized protein; PFAM DUF849 domain containing protein, structural genomics, center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha}	Back alignment and structure

>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A	Back alignment and structure

>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A	Back alignment and structure

>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A*	Back alignment and structure

>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima}	Back alignment and structure

>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0	Back alignment and structure

>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae}	Back alignment and structure

>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A*	Back alignment and structure

>3p6l_A Sugar phosphate isomerase/epimerase; TIM barrel, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.85A {Parabacteroides distasonis}	Back alignment and structure

>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis}	Back alignment and structure

>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1	Back alignment and structure

>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4	Back alignment and structure

>1i60_A IOLI protein; beta barrel, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Bacillus subtilis} SCOP: c.1.15.4 PDB: 1i6n_A	Back alignment and structure

>3mcm_A 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase/dihydropteroate...; folate, TIM barrel, synthase, HPPK, DHPS; 2.20A {Francisella tularensis subsp} PDB: 3mcn_A* 3mco_A*	Back alignment and structure

>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A	Back alignment and structure

>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0	Back alignment and structure

>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A*	Back alignment and structure

>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ...	Back alignment and structure

>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2	Back alignment and structure

>3apt_A Methylenetetrahydrofolate reductase; TIM barrel, oxidoreductase, flavin; HET: FAD; 1.85A {Thermus thermophilus} PDB: 3apy_A* 1v93_A*	Back alignment and structure

>3o6c_A PNP synthase, pyridoxine 5'-phosphate synthase; structural genomics, IDP90671, center for structural genomic infectious diseases; HET: MSE; 1.87A {Campylobacter jejuni subsp} SCOP: c.1.24.0 PDB: 3o6d_A*	Back alignment and structure

>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str}	Back alignment and structure

>3c6c_A 3-keto-5-aminohexanoate cleavage enzyme; DUF849 family protein, TIM beta/alpha-barrel fold, structura genomics; HET: MSE; 1.72A {Ralstonia eutropha}	Back alignment and structure

>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa}	Back alignment and structure

>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A	Back alignment and structure

>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A*	Back alignment and structure

>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus}	Back alignment and structure

>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum}	Back alignment and structure

>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A	Back alignment and structure

>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D*	Back alignment and structure

>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron}	Back alignment and structure

>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus}	Back alignment and structure

>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5	Back alignment and structure

>3tva_A Xylose isomerase domain protein TIM barrel; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.15A {Planctomyces limnophilus}	Back alignment and structure

>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ...	Back alignment and structure

>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A*	Back alignment and structure

>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A*	Back alignment and structure

>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A	Back alignment and structure

>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A*	Back alignment and structure

>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni}	Back alignment and structure

>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1	Back alignment and structure

>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A*	Back alignment and structure

>3e49_A Uncharacterized protein DUF849 with A TIM barrel; structural genomics, joint center for structural genomics; HET: MSE; 1.75A {Burkholderia xenovorans LB400}	Back alignment and structure

>3e02_A Uncharacterized protein DUF849; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.90A {Burkholderia xenovorans LB400}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		328
d1r30a_		312	c.1.28.1 (A:) Biotin synthase {Escherichia coli [T	6e-12
d1muwa_		386	c.1.15.3 (A:) D-xylose isomerase {Streptomyces oli	0.002

>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]} Length = 312	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Biotin synthase
domain: Biotin synthase
species: Escherichia coli [TaxId: 562]

 Score = 63.0 bits (152), Expect = 6e-12
 Identities = 35/256 (13%), Positives = 79/256 (30%), Gaps = 17/256 (6%)

Query: 52  KPEWLRQKAPQGQRFQEVKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLLGD 111
           +P W   +             L    L  +  EAQ   +            +  + +   
Sbjct: 1   RPRWTLSQV----------TELFEKPLLDLLFEAQ--QVHRQHFDPRQVQVSTLLSIKTG 48

Query: 112 TCTRGCRFCAV-KTSRNPAPPDPMEPENTAKAIASWGVDYIVLTSVDRDDIPDGGSGHFA 170
            C   C++C      +     + +         A                  +       
Sbjct: 49  ACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARKAKAAGSTRFCMGAAWKNPHERDMP 108

Query: 171 RTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQRIVRDPRAG 230
              + ++  K   +  C+T     + +A     ++GLD + HN++T       +      
Sbjct: 109 YLEQMVQGVKAMGLEACMTLGTLSESQAQRL-ANAGLDYYNHNLDTSPEFYGNII-TTRT 166

Query: 231 YEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVDILTLGQYLQPTP 290
           Y++ L+ L+  +    G+   S  ++GLGE+  D    +  L ++     ++   +    
Sbjct: 167 YQERLDTLEKVR--DAGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKV 224

Query: 291 LHLTVKEYVTPEKFDF 306
               + +    + FDF
Sbjct: 225 KGTPLADNDDVDAFDF 240

PyMOL of d1r30a_

>d1muwa_ c.1.15.3 (A:) D-xylose isomerase {Streptomyces olivochromogenes [TaxId: 1963]} Length = 386	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		328
d1r30a_		312	Biotin synthase {Escherichia coli [TaxId: 562]}	99.95
d1olta_		441	Oxygen-independent coproporphyrinogen III oxidase	99.83
d1tv8a_		327	Molybdenum cofactor biosynthesis protein A MoaA {S	99.62
d1jvna1		323	Cyclase subunit (or domain) of imidazoleglycerolph	94.92
d1thfd_		253	Cyclase subunit (or domain) of imidazoleglycerolph	94.61
d1qopa_		267	Trp synthase alpha-subunit {Salmonella typhimurium	94.11
d1h5ya_		252	Cyclase subunit (or domain) of imidazoleglycerolph	93.48
d1nvma2		289	4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d	93.26
d1qpoa1		169	Quinolinic acid phosphoribosyltransferase (Nicotin	92.49
d1m5wa_		242	Pyridoxine 5'-phosphate synthase {Escherichia coli	92.2
d1ka9f_		251	Cyclase subunit (or domain) of imidazoleglycerolph	91.85
d1mxsa_		216	KDPG aldolase {Pseudomonas putida [TaxId: 303]}	91.15
d1wbha1		213	KDPG aldolase {Escherichia coli [TaxId: 562]}	91.08
d1vhca_		212	Hypothetical protein HI0047 {Haemophilus influenza	90.7
d1eepa_		388	Inosine monophosphate dehydrogenase (IMPDH) {Lyme	90.64
d1xkya1		292	Dihydrodipicolinate synthase {Bacillus anthracis [	90.54
d1tqxa_		221	D-ribulose-5-phosphate 3-epimerase {Plasmodium fal	90.36
d1rpxa_		230	D-ribulose-5-phosphate 3-epimerase {Potato (Solanu	90.32
d1o4ua1		170	Quinolinic acid phosphoribosyltransferase (Nicotin	90.07
d1w3ia_		293	2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus	89.8
d1rd5a_		261	Trp synthase alpha-subunit {Maize (Zea mays) [TaxI	89.48
d1m3ua_		262	Ketopantoate hydroxymethyltransferase PanB {Escher	88.75
d1o66a_		260	Ketopantoate hydroxymethyltransferase PanB {Neisse	88.74
d2q02a1		271	Putative cytoplasmic protein STM4435 {Salmonella t	88.08
d1twda_		247	Copper homeostasis protein CutC {Shigella flexneri	88.04
d1vrda1		330	Inosine monophosphate dehydrogenase (IMPDH) {Therm	87.9
d1h1ya_		220	D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa	87.61
d1x5wa2		29	Zinc finger protein 64, ZFP68 {Human (Homo sapiens	87.29
d1zfja1		365	Inosine monophosphate dehydrogenase (IMPDH) {Strep	86.99
d1nvma2		289	4-hydroxy-2-oxovalerate aldolase DmpG, catalytic d	85.74
d1tqja_		221	D-ribulose-5-phosphate 3-epimerase {Synechocystis	85.7
d1e0ta2		246	Pyruvate kinase, N-terminal domain {Escherichia co	85.45
d1b5ta_		275	Methylenetetrahydrofolate reductase {Escherichia c	85.27
d7reqb2		163	Methylmalonyl-CoA mutase beta subunit, C-terminal	85.25
d1a3xa2		265	Pyruvate kinase, N-terminal domain {Baker's yeast	85.17
d1i60a_		278	Hypothetical protein IolI {Bacillus subtilis [TaxI	84.95
d1xxxa1		296	Dihydrodipicolinate synthase {Mycobacterium tuberc	84.88
d1o5ka_		295	Dihydrodipicolinate synthase {Thermotoga maritima	84.24
d1rd5a_		261	Trp synthase alpha-subunit {Maize (Zea mays) [TaxI	84.17
d1ujpa_		271	Trp synthase alpha-subunit {Thermus thermophilus [	83.77
d1hl2a_		295	N-acetylneuraminate lyase {Escherichia coli [TaxId	83.55
d1yx1a1		250	Hypothetical protein PA2260 {Pseudomonas aeruginos	83.14
d2flia1		217	D-ribulose-5-phosphate 3-epimerase {Streptococcus	82.8
d1qapa1		167	Quinolinic acid phosphoribosyltransferase (Nicotin	82.73
d1x7fa2		244	Outer surface protein, N-terminal domain {Bacillus	82.71
d1rqba2		303	Transcarboxylase 5S subunit, N-terminal domain {Pr	81.69
d1vzwa1		239	Phosphoribosylformimino-5-aminoimidazole carboxami	81.57
d1f74a_		293	N-acetylneuraminate lyase {Haemophilus influenzae	81.56
d1ad1a_		264	Dihydropteroate synthetase {Staphylococcus aureus	81.38
d1pkla2		258	Pyruvate kinase, N-terminal domain {Leishmania mex	81.12

>d1r30a_ c.1.28.1 (A:) Biotin synthase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Radical SAM enzymes
family: Biotin synthase
domain: Biotin synthase
species: Escherichia coli [TaxId: 562]

Probab=99.95  E-value=4.5e-27  Score=214.21  Aligned_cols=230  Identities=17%  Similarity=0.229  Sum_probs=174.5

Q ss_pred             HHHHHhcCCHHHHHHhcCCCCccccccCCCCceeeEEEEEe-CCCCCCCCCCCccCCCCCC-----CCCCCCchHHHHHH
Q 020304           69 VKESLSSLKLNTVCEEAQCPNIGECWNGGGDGIATATIMLL-GDTCTRGCRFCAVKTSRNP-----APPDPMEPENTAKA  142 (328)
Q Consensus        69 ~~~~l~~~~l~~l~~~a~~p~i~~~~~~~~~~~~~~~~i~~-t~gC~~~C~FC~~~~~~~~-----~~~~~~ei~~~~~~  142 (328)
                      +.++++ .++.+|+..|+  .+++..+++ +.+...+.+++ ||||+++|.||+++..+..     ...+.+++.+++++
T Consensus         9 ~~~L~~-~~~~dL~~~A~--~v~r~~~~~-~~~~~~~~~~~~TngC~~~C~fC~~~~~~~~~~~~~~~~~~e~i~~~~~~   84 (312)
T d1r30a_           9 VTELFE-KPLLDLLFEAQ--QVHRQHFDP-RQVQVSTLLSIKTGACPEDCKYCPQSSRYKTGLEAERLMEVEQVLESARK   84 (312)
T ss_dssp             THHHHH-SCHHHHHHHHH--HHHHHHSCT-TCCEEEEEEEEECSCBSSCCSSCSCBTTSCTTCCCCCCCCHHHHHHHHHH
T ss_pred             HHHHHc-CCHHHHHHHHH--HHHHHHcCC-CEEEEeeeeEeeCCCCCCcCCcCCCCccCCCCCccccccchHHHHHHHHH
Confidence            455564 47888888888  887665653 55666666655 9999999999998764321     12345678888899


Q ss_pred             HHHCCCcEEEEEeccCCCCCCCcHHHHHHHHHHHHHhCCCcEEEEEeCCCCCCHHHHHHHHHcCCcEEeechhhHHHHHh
Q 020304          143 IASWGVDYIVLTSVDRDDIPDGGSGHFARTVKAMKKQKPDIMVECLTSDFRGDLRAVETLVHSGLDVFAHNIETVKRLQR  222 (328)
Q Consensus       143 ~~~~G~~~i~l~gg~~~~l~~~~~~~l~~li~~ik~~~~~~~i~~~t~~~~~~~e~l~~L~~aG~~~i~~~~et~~~~~~  222 (328)
                      +.+.|++++++++|..+. .+...+++.++++.+++..  ..+..  +...++++.++.|++||++.+.+++|+.++.++
T Consensus        85 ~~~~G~~~~~~~~g~~~~-~~~~~~~~~~~i~~~~~~~--~~~~~--~~~~l~~e~l~~lk~aG~~~i~~~iEs~~~~~~  159 (312)
T d1r30a_          85 AKAAGSTRFCMGAAWKNP-HERDMPYLEQMVQGVKAMG--LEACM--TLGTLSESQAQRLANAGLDYYNHNLDTSPEFYG  159 (312)
T ss_dssp             HHHTTCSEEEEEECCSSC-CTTTHHHHHHHHHHHHHTT--SEEEE--ECSSCCHHHHHHHHHHCCCEEECCCBSCHHHHH
T ss_pred             HHHcCCEEEEEccCCCCC-chhhHHHHHHHHHhccccc--ceeee--ccccchHHHHHHhhcccceeEecccchhhhhhc
Confidence            999999999998886543 2344788999998888763  34432  334469999999999999999999999887655


Q ss_pred             hhcCCCCCHHHHHHHHHHHHHhCCCCeEEEeEEEEcCCCHHHHHHHHHHHHhCCCC--EEeeecccC-C-CCCCcccCCC
Q 020304          223 IVRDPRAGYEQSLEVLKHAKLSKKGLITKSSIMLGLGESDDDLKEAMADLRSIDVD--ILTLGQYLQ-P-TPLHLTVKEY  298 (328)
Q Consensus       223 ~~~~~~~~~~~~l~~i~~~~~~~~Gi~v~~~~ivGlgEt~e~~~~~l~~l~~l~~~--~i~i~~~l~-P-Tp~~~~~~~~  298 (328)
                      .+. ++.++++++++++.+++  .|+.+++++|+|+|||.+|+.+++..+++++.+  .++++.+.. | |++.  ..+.
T Consensus       160 ~~~-~~~~~~~~~~~~~~a~~--~Gi~~~~~~i~G~~et~~d~~~~l~~l~~l~~~~~~i~~~~~~p~~gT~l~--~~~~  234 (312)
T d1r30a_         160 NII-TTRTYQERLDTLEKVRD--AGIKVCSGGIVGLGETVKDRAGLLLQLANLPTPPESVPINMLVKVKGTPLA--DNDD  234 (312)
T ss_dssp             HHC-CSSCHHHHHHHHHHHHH--HHCEEECCEEECSSCCHHHHHHHHHHHHSSSSCCSEEEEEECCCCTTSTTS--SCCC
T ss_pred             cCC-CCCCHHHHHHHHHHHHH--hccceecceEecCcCcHHHHHHHHHHHHhcCCCCCeeeeccccCCCCcccc--cccC
Confidence            554 47899999999999999  999999999999999999999999999988754  676654441 2 6664  3455


Q ss_pred             CCHHHHHHHHHHHH
Q 020304          299 VTPEKFDFWKAYGE  312 (328)
Q Consensus       299 ~~~~~~~~l~~~~~  312 (328)
                      .+++++..+.++++
T Consensus       235 ~~~~e~l~~iA~~R  248 (312)
T d1r30a_         235 VDAFDFIRTIAVAR  248 (312)
T ss_dssp             CCHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHH
Confidence            66766655555544

PyMOL of d1r30a_

>d1olta_ c.1.28.2 (A:) Oxygen-independent coproporphyrinogen III oxidase HemN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tv8a_ c.1.28.3 (A:) Molybdenum cofactor biosynthesis protein A MoaA {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]}	Back information, alignment and structure

>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]}	Back information, alignment and structure

>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1m5wa_ c.1.24.1 (A:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]}	Back information, alignment and structure

>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}	Back information, alignment and structure

>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]}	Back information, alignment and structure

>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]}	Back information, alignment and structure

>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]}	Back information, alignment and structure

>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]}	Back information, alignment and structure

>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1nvma2 c.1.10.5 (A:2-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp. [TaxId: 306]}	Back information, alignment and structure

>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]}	Back information, alignment and structure

>d1e0ta2 c.1.12.1 (A:1-69,A:168-344) Pyruvate kinase, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1b5ta_ c.1.23.1 (A:) Methylenetetrahydrofolate reductase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]}	Back information, alignment and structure

>d1a3xa2 c.1.12.1 (A:1-87,A:189-366) Pyruvate kinase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1i60a_ c.1.15.4 (A:) Hypothetical protein IolI {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1yx1a1 c.1.15.7 (A:3-252) Hypothetical protein PA2260 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure

>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]}	Back information, alignment and structure

>d1rqba2 c.1.10.5 (A:4-306) Transcarboxylase 5S subunit, N-terminal domain {Propionibacterium freudenreichii shermanii [TaxId: 1752]}	Back information, alignment and structure

>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]}	Back information, alignment and structure

>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1ad1a_ c.1.21.1 (A:) Dihydropteroate synthetase {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1pkla2 c.1.12.1 (A:1-87,A:187-357) Pyruvate kinase, N-terminal domain {Leishmania mexicana [TaxId: 5665]}	Back information, alignment and structure