Citrus Sinensis ID: 020317
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 327 | ||||||
| 225459360 | 508 | PREDICTED: probable glucan 1,3-beta-gluc | 0.831 | 0.535 | 0.792 | 1e-118 | |
| 224082158 | 298 | predicted protein [Populus trichocarpa] | 0.746 | 0.818 | 0.861 | 1e-118 | |
| 255545648 | 506 | conserved hypothetical protein [Ricinus | 0.828 | 0.535 | 0.759 | 1e-118 | |
| 356548252 | 506 | PREDICTED: glucan 1,3-beta-glucosidase A | 0.795 | 0.513 | 0.728 | 1e-109 | |
| 357489425 | 505 | Glucan 1,3-beta-glucosidase [Medicago tr | 0.807 | 0.522 | 0.714 | 1e-108 | |
| 388508714 | 505 | unknown [Medicago truncatula] | 0.807 | 0.522 | 0.711 | 1e-108 | |
| 356548266 | 508 | PREDICTED: probable glucan 1,3-beta-gluc | 0.792 | 0.509 | 0.732 | 1e-108 | |
| 357489413 | 483 | Glucan 1,3-beta-glucosidase [Medicago tr | 0.767 | 0.519 | 0.730 | 1e-106 | |
| 356552862 | 498 | PREDICTED: probable glucan 1,3-beta-gluc | 0.776 | 0.510 | 0.684 | 1e-96 | |
| 359497371 | 529 | PREDICTED: probable glucan 1,3-beta-gluc | 0.825 | 0.510 | 0.630 | 2e-96 |
| >gi|225459360|ref|XP_002285806.1| PREDICTED: probable glucan 1,3-beta-glucosidase A [Vitis vinifera] gi|302141928|emb|CBI19131.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 432 bits (1111), Expect = e-118, Method: Compositional matrix adjust.
Identities = 218/275 (79%), Positives = 240/275 (87%), Gaps = 3/275 (1%)
Query: 6 STKQLFSI-CIILSFMLSFSYGRSPNPAFRIKAVNLGGWLVTEGWIKPSLFDGIPNKDFL 64
ST +L SI C S +LS SYGR NP F++KAVNLGGWLVTEGWIKPSLFD IPNKDFL
Sbjct: 5 STTKLLSILCAAFSCILSLSYGRV-NPNFQVKAVNLGGWLVTEGWIKPSLFDDIPNKDFL 63
Query: 65 DGTQLQFKSVTVGKYLCAENGGGTIVVANRTSASGWETFKLWRINETNFHFRVFNKQFIG 124
DGT+LQFKSVT+GKYLCAE GGGTI+V NRT+ASGWETF+LWRINET FHFRVFNKQF+G
Sbjct: 64 DGTELQFKSVTIGKYLCAETGGGTIIVVNRTAASGWETFRLWRINETAFHFRVFNKQFMG 123
Query: 125 LDTNGNGIDIVAESNTPRSSETFEIVRNSNDLSRVRIKAPNGFFLQAKTEELVTADYEGA 184
LDT GNGIDIVA SNTP SETF+IV+N ND RVRIKAPNGFFLQAKTEELVTADY G
Sbjct: 124 LDTAGNGIDIVAVSNTPGGSETFQIVKNPNDSKRVRIKAPNGFFLQAKTEELVTADYAGD 183
Query: 185 TSWGDDDPSVFEMTIAGRMQGEFQVTNGYGPQKAPQVMR-HWSTYIVEDDFKFIAGNGLN 243
WGDDDP+VF MT+ ++GEFQVTNGYGP KAPQVM+ HWST+IVEDDFKFI+ NGLN
Sbjct: 184 GGWGDDDPTVFVMTVNVALEGEFQVTNGYGPDKAPQVMKEHWSTFIVEDDFKFISENGLN 243
Query: 244 AVRIPVGWWMASDPTPPAPYVGGSLRALDNAFTWA 278
AVRIPVGWW+A DPTPP+P+VGGSL ALDNAFTWA
Sbjct: 244 AVRIPVGWWIACDPTPPSPFVGGSLYALDNAFTWA 278
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224082158|ref|XP_002306586.1| predicted protein [Populus trichocarpa] gi|222856035|gb|EEE93582.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255545648|ref|XP_002513884.1| conserved hypothetical protein [Ricinus communis] gi|223546970|gb|EEF48467.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356548252|ref|XP_003542517.1| PREDICTED: glucan 1,3-beta-glucosidase A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357489425|ref|XP_003615000.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] gi|355516335|gb|AES97958.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388508714|gb|AFK42423.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356548266|ref|XP_003542524.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357489413|ref|XP_003614994.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] gi|355516329|gb|AES97952.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356552862|ref|XP_003544781.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359497371|ref|XP_003635494.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Vitis vinifera] gi|296080899|emb|CBI18831.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 327 | ||||||
| ASPGD|ASPL0000016384 | 405 | exgC [Emericella nidulans (tax | 0.259 | 0.209 | 0.431 | 1e-17 | |
| POMBASE|SPBC1105.05 | 407 | exg1 "glucan 1,6-beta-glucosid | 0.189 | 0.152 | 0.428 | 1.4e-11 | |
| SGD|S000004291 | 448 | EXG1 "Major exo-1,3-beta-gluca | 0.177 | 0.129 | 0.45 | 7.5e-10 | |
| CGD|CAL0006153 | 438 | XOG1 [Candida albicans (taxid: | 0.262 | 0.196 | 0.408 | 6e-09 | |
| UNIPROTKB|P29717 | 438 | XOG1 "Glucan 1,3-beta-glucosid | 0.262 | 0.196 | 0.408 | 6e-09 | |
| SGD|S000005716 | 445 | SPR1 "Sporulation-specific exo | 0.220 | 0.161 | 0.4 | 2.5e-05 | |
| SGD|S000002669 | 562 | EXG2 "Exo-1,3-beta-glucanase" | 0.480 | 0.279 | 0.294 | 7.7e-05 | |
| CGD|CAL0006050 | 479 | EXG2 [Candida albicans (taxid: | 0.262 | 0.179 | 0.340 | 0.00013 | |
| UNIPROTKB|Q5AIA1 | 479 | EXG2 "Putative uncharacterized | 0.262 | 0.179 | 0.340 | 0.00013 | |
| CGD|CAL0006247 | 525 | SPR1 [Candida albicans (taxid: | 0.461 | 0.287 | 0.276 | 0.00015 |
| ASPGD|ASPL0000016384 exgC [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Score = 182 (69.1 bits), Expect = 1.0e-17, Sum P(2) = 1.0e-17
Identities = 38/88 (43%), Positives = 52/88 (59%)
Query: 192 PSVFEMTIAGRMQGEFQVTNGYGPQKAP-QVMRHWSTYIVEDDFKFIAGNGLNAVRIPVG 250
PS+F+ E+ +T G ++A ++ HW+T+I E+DF IA GLN VRIP+G
Sbjct: 46 PSLFDEA-GDEAVDEYTLTEVLGVEEAAARLSEHWNTFITEEDFALIAEAGLNYVRIPIG 104
Query: 251 WWMASDPTPPAPYVGGSLRALDNAFTWA 278
+W A+ P PYV G L LDNA WA
Sbjct: 105 YWAAA-PLDGEPYVSGQLEHLDNAVAWA 131
|
|
| POMBASE|SPBC1105.05 exg1 "glucan 1,6-beta-glucosidase Exg1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004291 EXG1 "Major exo-1,3-beta-glucanase of the cell wall" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006153 XOG1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P29717 XOG1 "Glucan 1,3-beta-glucosidase" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| SGD|S000005716 SPR1 "Sporulation-specific exo-1,3-beta-glucanase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| SGD|S000002669 EXG2 "Exo-1,3-beta-glucanase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006050 EXG2 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5AIA1 EXG2 "Putative uncharacterized protein EXG2" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006247 SPR1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.V.5003.1 | hypothetical protein (298 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 327 | |||
| cd00257 | 119 | cd00257, Fascin, Fascin-like domain; members inclu | 7e-09 | |
| COG2730 | 407 | COG2730, BglC, Endoglucanase [Carbohydrate transpo | 4e-08 | |
| COG2723 | 460 | COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu | 4e-04 |
| >gnl|CDD|238160 cd00257, Fascin, Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) | Back alignment and domain information |
|---|
Score = 52.7 bits (127), Expect = 7e-09
Identities = 33/121 (27%), Positives = 54/121 (44%), Gaps = 8/121 (6%)
Query: 67 TQLQFKSVTVGKYLCAENGGGTIVVANRTSASGWETFKLWRINETNFHFRVFNKQFIGLD 126
Q+ +SV G+YL AE GG V ANR S G ETF L N + R + +++ D
Sbjct: 2 PQVVLRSVN-GRYLSAEAGGDK-VDANRDSLKGDETFTLEFDNTGKYALRSHDGKYLSAD 59
Query: 127 TNGNGIDIVAESNTPRSSETFEIVRNSNDLSRVRIKAPNGFFLQAKTEELVTADYEGATS 186
++G + E + P + F + + + + ++A NG +L + A E
Sbjct: 60 SDGG---VQLEGH-PNADCRFTLEFHGD--GKWALRAENGRYLGGDGSGTLKASSETVGP 113
Query: 187 W 187
Sbjct: 114 D 114
|
Length = 119 |
| >gnl|CDD|225344 COG2730, BglC, Endoglucanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 327 | |||
| cd00257 | 119 | Fascin Fascin-like domain; members include actin-b | 99.72 | |
| COG2730 | 407 | BglC Endoglucanase [Carbohydrate transport and met | 99.67 | |
| PF06268 | 111 | Fascin: Fascin domain; InterPro: IPR022768 This fa | 99.61 | |
| PF00150 | 281 | Cellulase: Cellulase (glycosyl hydrolase family 5) | 99.29 | |
| cd00257 | 119 | Fascin Fascin-like domain; members include actin-b | 99.0 | |
| PF06268 | 111 | Fascin: Fascin domain; InterPro: IPR022768 This fa | 98.6 | |
| PF06229 | 191 | FRG1: FRG1-like family; InterPro: IPR010414 This e | 98.59 | |
| TIGR03356 | 427 | BGL beta-galactosidase. | 98.09 | |
| PF06229 | 191 | FRG1: FRG1-like family; InterPro: IPR010414 This e | 97.88 | |
| PRK09852 | 474 | cryptic 6-phospho-beta-glucosidase; Provisional | 97.59 | |
| PF02449 | 374 | Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 | 97.46 | |
| PRK15014 | 477 | 6-phospho-beta-glucosidase BglA; Provisional | 97.29 | |
| COG2723 | 460 | BglB Beta-glucosidase/6-phospho-beta-glucosidase/b | 96.76 | |
| PF07745 | 332 | Glyco_hydro_53: Glycosyl hydrolase family 53; Inte | 96.69 | |
| PRK13511 | 469 | 6-phospho-beta-galactosidase; Provisional | 96.54 | |
| PF00232 | 455 | Glyco_hydro_1: Glycosyl hydrolase family 1; InterP | 96.51 | |
| COG3867 | 403 | Arabinogalactan endo-1,4-beta-galactosidase [Carbo | 96.43 | |
| TIGR01233 | 467 | lacG 6-phospho-beta-galactosidase. This enzyme is | 96.4 | |
| PRK09589 | 476 | celA 6-phospho-beta-glucosidase; Reviewed | 96.4 | |
| PLN02998 | 497 | beta-glucosidase | 96.29 | |
| PRK09593 | 478 | arb 6-phospho-beta-glucosidase; Reviewed | 96.28 | |
| PF04601 | 142 | DUF569: Protein of unknown function (DUF569); Inte | 96.23 | |
| PLN02814 | 504 | beta-glucosidase | 96.23 | |
| PLN02849 | 503 | beta-glucosidase | 96.16 | |
| PF01301 | 319 | Glyco_hydro_35: Glycosyl hydrolases family 35; Int | 95.85 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 95.73 | |
| PF00128 | 316 | Alpha-amylase: Alpha amylase, catalytic domain; In | 95.47 | |
| KOG3962 | 246 | consensus Predicted actin-bundling protein [Cytosk | 94.76 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 94.68 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 94.36 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 94.04 | |
| smart00791 | 139 | Agglutinin Amaranthus caudatus agglutinin or amara | 93.63 | |
| PLN00196 | 428 | alpha-amylase; Provisional | 93.53 | |
| TIGR02403 | 543 | trehalose_treC alpha,alpha-phosphotrehalase. Treha | 93.5 | |
| COG1523 | 697 | PulA Type II secretory pathway, pullulanase PulA a | 93.44 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 93.4 | |
| COG1874 | 673 | LacA Beta-galactosidase [Carbohydrate transport an | 93.37 | |
| PF14200 | 105 | RicinB_lectin_2: Ricin-type beta-trefoil lectin do | 93.08 | |
| PLN02361 | 401 | alpha-amylase | 93.02 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 92.96 | |
| PRK10933 | 551 | trehalose-6-phosphate hydrolase; Provisional | 92.93 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 92.91 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 92.84 | |
| PF04601 | 142 | DUF569: Protein of unknown function (DUF569); Inte | 92.8 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 92.77 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 92.72 | |
| smart00791 | 139 | Agglutinin Amaranthus caudatus agglutinin or amara | 92.66 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 92.22 | |
| PLN02960 | 897 | alpha-amylase | 92.01 | |
| TIGR02456 | 539 | treS_nterm trehalose synthase. Trehalose synthase | 92.0 | |
| PF07468 | 153 | Agglutinin: Agglutinin; InterPro: IPR008998 Agglut | 91.63 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 91.61 | |
| PRK10785 | 598 | maltodextrin glucosidase; Provisional | 91.22 | |
| PRK09441 | 479 | cytoplasmic alpha-amylase; Reviewed | 91.12 | |
| PRK09505 | 683 | malS alpha-amylase; Reviewed | 91.02 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 90.98 | |
| PF07468 | 153 | Agglutinin: Agglutinin; InterPro: IPR008998 Agglut | 90.74 | |
| PLN02784 | 894 | alpha-amylase | 90.58 | |
| COG0366 | 505 | AmyA Glycosidases [Carbohydrate transport and meta | 90.32 | |
| PF00167 | 122 | FGF: Fibroblast growth factor; InterPro: IPR002348 | 90.2 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 89.49 | |
| KOG3962 | 246 | consensus Predicted actin-bundling protein [Cytosk | 89.28 | |
| PLN03059 | 840 | beta-galactosidase; Provisional | 89.05 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 88.73 | |
| PF03198 | 314 | Glyco_hydro_72: Glucanosyltransferase; InterPro: I | 88.7 | |
| PF14488 | 166 | DUF4434: Domain of unknown function (DUF4434) | 88.68 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 87.0 | |
| PF02836 | 298 | Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM | 86.19 | |
| PRK14511 | 879 | maltooligosyl trehalose synthase; Provisional | 85.5 | |
| TIGR02401 | 825 | trehalose_TreY malto-oligosyltrehalose synthase. T | 85.45 | |
| PF00167 | 122 | FGF: Fibroblast growth factor; InterPro: IPR002348 | 85.21 | |
| PRK14507 | 1693 | putative bifunctional 4-alpha-glucanotransferase/m | 84.4 | |
| COG3589 | 360 | Uncharacterized conserved protein [Function unknow | 84.22 | |
| PLN02801 | 517 | beta-amylase | 83.4 | |
| PLN02705 | 681 | beta-amylase | 82.94 | |
| PLN02161 | 531 | beta-amylase | 82.93 | |
| PLN02803 | 548 | beta-amylase | 82.16 | |
| PF01373 | 402 | Glyco_hydro_14: Glycosyl hydrolase family 14; Inte | 81.58 | |
| PLN00197 | 573 | beta-amylase; Provisional | 81.07 | |
| PF13204 | 289 | DUF4038: Protein of unknown function (DUF4038); PD | 80.31 | |
| PLN02905 | 702 | beta-amylase | 80.1 |
| >cd00257 Fascin Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) | Back alignment and domain information |
|---|
Probab=99.72 E-value=3.4e-17 Score=135.31 Aligned_cols=114 Identities=28% Similarity=0.391 Sum_probs=101.5
Q ss_pred cceeeeeeeecccccccCCCchHHHhhhcccccccccEEeeeCCCcEEEEEcCCcEEEEecCCCCceEEEeccCCCCCcc
Q 020317 67 TQLQFKSVTVGKYLCAENGGGTIVVANRTSASGWETFKLWRINETNFHFRVFNKQFIGLDTNGNGIDIVAESNTPRSSET 146 (327)
Q Consensus 67 ~~v~l~e~~~gkyv~ae~gg~~~l~Anr~~~~hWEtF~~~~ite~d~alrs~n~~yv~a~~~~g~~~l~a~~~~~~~we~ 146 (327)
.++.|++. +|+||+++.+|. .+.|++...+.||+|++++.+++.++||+.||+||+++. . +.+.|+++ ++++|.
T Consensus 2 p~v~Lrs~-~gkyl~~~~~g~-~v~a~~~~~~~~e~F~l~~~~~g~v~Lrs~~G~yls~~~-~--g~l~~~~~-~~~~e~ 75 (119)
T cd00257 2 PQVVLRSV-NGRYLSAEAGGD-KVDANRDSLKGDETFTLEFDNTGKYALRSHDGKYLSADS-D--GGVQLEGH-PNADCR 75 (119)
T ss_pred cEEEEEEc-CCCEEEEeccCC-EEEEcCccCCCceEEEEEECCCCeEEEEECCCcEEEEEC-C--CCEEecCC-CCCCcE
Confidence 46889987 999999999873 688999998899999999988888999999999999987 4 46899999 999999
Q ss_pred eEEEEccCCCceEEEecCCCcEEEecccceeeecccCCCCCC
Q 020317 147 FEIVRNSNDLSRVRIKAPNGFFLQAKTEELVTADYEGATSWG 188 (327)
Q Consensus 147 F~l~~~~~~~~~~~Lra~ng~yv~a~~~~~L~A~~~~~~~W~ 188 (327)
|+++.++++ +++||+.||+||+++.++.|.|+....+.|+
T Consensus 76 F~~e~~~~g--~~al~~~~G~yl~~~~~g~l~~~~~~~~~~e 115 (119)
T cd00257 76 FTLEFHGDG--KWALRAENGRYLGGDGSGTLKASSETVGPDE 115 (119)
T ss_pred EEEEECCCC--eEEEEcCCCCEEeecCCCeEEEecCCCCccc
Confidence 999999764 6999999999999998889999998877664
|
|
| >COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF06268 Fascin: Fascin domain; InterPro: IPR022768 This family consists of several eukaryotic fascin or singed proteins | Back alignment and domain information |
|---|
| >PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd00257 Fascin Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) | Back alignment and domain information |
|---|
| >PF06268 Fascin: Fascin domain; InterPro: IPR022768 This family consists of several eukaryotic fascin or singed proteins | Back alignment and domain information |
|---|
| >PF06229 FRG1: FRG1-like family; InterPro: IPR010414 This entry represents Frg1 (FSHD region gene 1), a protein that is considered to be a candidate for facioscapulohumeral muscular dystrophy (FSHD) | Back alignment and domain information |
|---|
| >TIGR03356 BGL beta-galactosidase | Back alignment and domain information |
|---|
| >PF06229 FRG1: FRG1-like family; InterPro: IPR010414 This entry represents Frg1 (FSHD region gene 1), a protein that is considered to be a candidate for facioscapulohumeral muscular dystrophy (FSHD) | Back alignment and domain information |
|---|
| >PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional | Back alignment and domain information |
|---|
| >PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK15014 6-phospho-beta-glucosidase BglA; Provisional | Back alignment and domain information |
|---|
| >COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK13511 6-phospho-beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01233 lacG 6-phospho-beta-galactosidase | Back alignment and domain information |
|---|
| >PRK09589 celA 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >PLN02998 beta-glucosidase | Back alignment and domain information |
|---|
| >PRK09593 arb 6-phospho-beta-glucosidase; Reviewed | Back alignment and domain information |
|---|
| >PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins | Back alignment and domain information |
|---|
| >PLN02814 beta-glucosidase | Back alignment and domain information |
|---|
| >PLN02849 beta-glucosidase | Back alignment and domain information |
|---|
| >PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >KOG3962 consensus Predicted actin-bundling protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >smart00791 Agglutinin Amaranthus caudatus agglutinin or amaranthin is a lectin from the ancient South American crop, amaranth grain | Back alignment and domain information |
|---|
| >PLN00196 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A | Back alignment and domain information |
|---|
| >PLN02361 alpha-amylase | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >PRK10933 trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >smart00791 Agglutinin Amaranthus caudatus agglutinin or amaranthin is a lectin from the ancient South American crop, amaranth grain | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >TIGR02456 treS_nterm trehalose synthase | Back alignment and domain information |
|---|
| >PF07468 Agglutinin: Agglutinin; InterPro: IPR008998 Agglutinins are sugar-specific lectins that can agglutinate erythrocytes and other cell types | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10785 maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >PRK09441 cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09505 malS alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >PF07468 Agglutinin: Agglutinin; InterPro: IPR008998 Agglutinins are sugar-specific lectins that can agglutinate erythrocytes and other cell types | Back alignment and domain information |
|---|
| >PLN02784 alpha-amylase | Back alignment and domain information |
|---|
| >COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00167 FGF: Fibroblast growth factor; InterPro: IPR002348 The interleukin-1 (IL1) and heparin-binding growth factor (HBGF) families share low sequence similarity (about 25% []) but have very similar structures | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >KOG3962 consensus Predicted actin-bundling protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PLN03059 beta-galactosidase; Provisional | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane | Back alignment and domain information |
|---|
| >PF14488 DUF4434: Domain of unknown function (DUF4434) | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
| >PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK14511 maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >PF00167 FGF: Fibroblast growth factor; InterPro: IPR002348 The interleukin-1 (IL1) and heparin-binding growth factor (HBGF) families share low sequence similarity (about 25% []) but have very similar structures | Back alignment and domain information |
|---|
| >PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >COG3589 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN02801 beta-amylase | Back alignment and domain information |
|---|
| >PLN02705 beta-amylase | Back alignment and domain information |
|---|
| >PLN02161 beta-amylase | Back alignment and domain information |
|---|
| >PLN02803 beta-amylase | Back alignment and domain information |
|---|
| >PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PLN00197 beta-amylase; Provisional | Back alignment and domain information |
|---|
| >PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D | Back alignment and domain information |
|---|
| >PLN02905 beta-amylase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 327 | ||||
| 1eqp_A | 394 | Exo-B-(1,3)-Glucanase From Candida Albicans Length | 2e-10 | ||
| 1cz1_A | 394 | Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 | 3e-10 | ||
| 3n9k_A | 399 | F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase | 3e-10 | ||
| 3o6a_A | 399 | F144yF258Y DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase | 3e-10 | ||
| 2pf0_A | 400 | F258i Mutant Of Exo-B-(1,3)-Glucanase From Candida | 3e-10 | ||
| 2pb1_A | 400 | Exo-b-(1,3)-glucanase From Candida Albicans In Comp | 4e-10 | ||
| 2pc8_A | 400 | E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida | 4e-10 | ||
| 2pbo_A | 400 | E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida A | 4e-10 | ||
| 1h4p_A | 408 | Crystal Structure Of Exo-1,3-Beta Glucanse From Sac | 3e-06 |
| >pdb|1EQP|A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans Length = 394 | Back alignment and structure |
|
| >pdb|1CZ1|A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Resolution Length = 394 | Back alignment and structure |
| >pdb|3N9K|A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A Length = 399 | Back alignment and structure |
| >pdb|3O6A|A Chain A, F144yF258Y DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans At 2 A Length = 399 | Back alignment and structure |
| >pdb|2PF0|A Chain A, F258i Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.9 A Length = 400 | Back alignment and structure |
| >pdb|2PB1|A Chain A, Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Unhydrolysed And Covalently Linked 2,4-dinitrophenyl-2-deoxy-2- Fluoro-b-d-glucopyranoside At 1.9 A Length = 400 | Back alignment and structure |
| >pdb|2PC8|A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A Length = 400 | Back alignment and structure |
| >pdb|2PBO|A Chain A, E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Length = 400 | Back alignment and structure |
| >pdb|1H4P|A Chain A, Crystal Structure Of Exo-1,3-Beta Glucanse From Saccharomyces Cerevisiae Length = 408 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 327 | |||
| 3llp_A | 493 | Fascin; beta-trefoil, actin bundling protein, canc | 3e-24 | |
| 3llp_A | 493 | Fascin; beta-trefoil, actin bundling protein, canc | 2e-06 | |
| 2yug_A | 155 | Protein FRG1; spliceosome, facioscapulohumeral mus | 2e-17 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 2e-15 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 3e-14 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 1e-06 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 2e-13 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 1e-06 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 7e-13 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 1e-11 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 8e-10 | |
| 3q7x_A | 132 | De novo designed beta-trefoil architecture with S | 5e-08 | |
| 3q7x_A | 132 | De novo designed beta-trefoil architecture with S | 6e-08 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 2e-07 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 3e-07 | |
| 3ndz_A | 345 | Endoglucanase D; cellotriose, xylanase, carbohydra | 2e-06 | |
| 3qr3_A | 340 | Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A | 3e-06 | |
| 1h1n_A | 305 | Endo type cellulase ENGI; hydrolase, glycosyl hydr | 7e-06 | |
| 1hcd_A | 118 | Hisactophilin; actin binding; NMR {Dictyostelium d | 1e-05 | |
| 3l55_A | 353 | B-1,4-endoglucanase/cellulase; putative beta-1,4-e | 5e-05 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 6e-05 |
| >3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* Length = 493 | Back alignment and structure |
|---|
Score = 102 bits (254), Expect = 3e-24
Identities = 39/196 (19%), Positives = 78/196 (39%), Gaps = 22/196 (11%)
Query: 66 GTQLQFKSVTVGKYLCAENGGGTIVVANRTSASGWETFKLWRINET-NFHFRVFNKQFIG 124
Q+ ++ + + G + AN+ + ETF+L +T FR ++
Sbjct: 260 CAQVVLQAAN-ERNVSTRQGMD--LSANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWT 316
Query: 125 LDTNGNGIDIVAESNTPRSSETFEIVRNSNDLSRVRIKAPNGFFLQAKTEELVTADYEGA 184
L G + + +++ +S F+I R+ ++A NG F+ +K + A E A
Sbjct: 317 LTATGG---VQSTASSKNASCYFDIEWRDR---RITLRASNGKFVTSKKNGQLAASVETA 370
Query: 185 TSWGDDDPSVFEMTIAGRMQGEFQVTNGY--GPQKAPQVMRHWSTYIVEDDFKFIAGNGL 242
+F M + R F+ +G+ + + + S+Y D F+ +G
Sbjct: 371 GDS-----ELFLMKLINRPIIVFRGEHGFIGCRKVTGTLDANRSSY---DVFQLEFNDGA 422
Query: 243 NAVRIPVG--WWMASD 256
++ G W + SD
Sbjct: 423 YNIKDSTGKYWTVGSD 438
|
| >3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* Length = 493 | Back alignment and structure |
|---|
| >2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} Length = 155 | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Length = 408 | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Length = 408 | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Length = 399 | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Length = 399 | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 | Back alignment and structure |
|---|
| >3q7x_A De novo designed beta-trefoil architecture with S primary structure; beta-terfoil, de novo protein; 1.40A {Synthetic} PDB: 3q7w_A 3o4d_A 3q7y_A 3o4b_A 3o4c_A 3o4a_A* 3o49_A Length = 132 | Back alignment and structure |
|---|
| >3q7x_A De novo designed beta-trefoil architecture with S primary structure; beta-terfoil, de novo protein; 1.40A {Synthetic} PDB: 3q7w_A 3o4d_A 3q7y_A 3o4b_A 3o4c_A 3o4a_A* 3o49_A Length = 132 | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 | Back alignment and structure |
|---|
| >3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 | Back alignment and structure |
|---|
| >3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Length = 340 | Back alignment and structure |
|---|
| >1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Length = 305 | Back alignment and structure |
|---|
| >1hcd_A Hisactophilin; actin binding; NMR {Dictyostelium discoideum} SCOP: b.42.5.2 PDB: 1hce_A Length = 118 | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Length = 358 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 327 | |||
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 99.93 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 99.91 | |
| 3llp_A | 493 | Fascin; beta-trefoil, actin bundling protein, canc | 99.85 | |
| 2yug_A | 155 | Protein FRG1; spliceosome, facioscapulohumeral mus | 99.7 | |
| 3llp_A | 493 | Fascin; beta-trefoil, actin bundling protein, canc | 99.56 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 99.39 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 99.37 | |
| 3l55_A | 353 | B-1,4-endoglucanase/cellulase; putative beta-1,4-e | 99.37 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 99.36 | |
| 3ndz_A | 345 | Endoglucanase D; cellotriose, xylanase, carbohydra | 99.34 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 99.32 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 99.3 | |
| 1h1n_A | 305 | Endo type cellulase ENGI; hydrolase, glycosyl hydr | 99.24 | |
| 3icg_A | 515 | Endoglucanase D; cellulase, xylanase, carbohydrate | 99.19 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 99.17 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 99.16 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 99.16 | |
| 1edg_A | 380 | Endoglucanase A; family A, cellulases, xylanases, | 99.16 | |
| 1g01_A | 364 | Endoglucanase; alpha/beta barrel, TIM barrel, hydr | 99.11 | |
| 7a3h_A | 303 | Endoglucanase; hydrolase, cellulose degradation, g | 99.09 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 99.09 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 99.06 | |
| 3qr3_A | 340 | Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A | 99.06 | |
| 2whl_A | 294 | Beta-mannanase, baman5; glycoside hydrolase, hydro | 99.04 | |
| 3qho_A | 458 | Endoglucanase, 458AA long hypothetical endo-1,4-be | 99.02 | |
| 1tvn_A | 293 | Cellulase, endoglucanase G; glycoside hydrolase, C | 99.01 | |
| 1wky_A | 464 | Endo-beta-1,4-mannanase; TIM barrel, catalytic dom | 98.96 | |
| 2y8k_A | 491 | Arabinoxylanase, carbohydrate binding family 6; hy | 98.95 | |
| 1egz_A | 291 | Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL | 98.93 | |
| 3jug_A | 345 | Beta-mannanase; TIM-barrel, glycosidase, hydrolase | 98.9 | |
| 3pzt_A | 327 | Endoglucanase; alpha/beta barrel, glycosyl hydrola | 98.88 | |
| 1bqc_A | 302 | Protein (beta-mannanase); glycosyl hydrolase, fami | 98.86 | |
| 1hjs_A | 332 | Beta-1,4-galactanase; 4-galactanases, family 53 gl | 98.84 | |
| 2cks_A | 306 | Endoglucanase E-5; carbohydrate metabolism, polysa | 98.81 | |
| 4hty_A | 359 | Cellulase; (alpha/beta)8 barrel, family 5 endogluc | 98.8 | |
| 2yug_A | 155 | Protein FRG1; spliceosome, facioscapulohumeral mus | 98.76 | |
| 3vup_A | 351 | Beta-1,4-mannanase; TIM barrel, digestive fluid, H | 98.52 | |
| 2c0h_A | 353 | Mannan endo-1,4-beta-mannosidase; hydrolase, signa | 98.48 | |
| 1qnr_A | 344 | Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt | 98.46 | |
| 1ur4_A | 399 | Galactanase; hydrolase, beta-1, glycoside hydrolas | 98.4 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 98.32 | |
| 1uuq_A | 440 | Mannosyl-oligosaccharide glucosidase; hydrolase, m | 98.25 | |
| 3pzg_A | 383 | Mannan endo-1,4-beta-mannosidase. glycosyl hydrol | 98.24 | |
| 1vem_A | 516 | Beta-amylase; beta-alpha-barrels, optimum PH, hydr | 97.98 | |
| 2xhy_A | 479 | BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, | 97.92 | |
| 1vff_A | 423 | Beta-glucosidase; glycosyl hydrolase, membrane-bou | 97.91 | |
| 2j78_A | 468 | Beta-glucosidase A; family 1, hydrolase, inhibitor | 97.88 | |
| 1ug6_A | 431 | Beta-glycosidase; glucosidase, atomic resolution, | 97.77 | |
| 1kwg_A | 645 | Beta-galactosidase; TIM barrel, glycoside hydrolas | 97.72 | |
| 1qox_A | 449 | Beta-glucosidase; hydrolase, cellulose degradation | 97.66 | |
| 3ahx_A | 453 | Beta-glucosidase A; cellulases, glycosyl hydrolase | 97.65 | |
| 3fj0_A | 465 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase | 97.63 | |
| 1e4i_A | 447 | Beta-glucosidase; hydrolase, family 1 glycosyl hyd | 97.62 | |
| 2o9p_A | 454 | Beta-glucosidase B; family 1 glycoside hydrolase; | 97.56 | |
| 1fob_A | 334 | Beta-1,4-galactanase; B/A barrel, glycosyl hydrola | 97.56 | |
| 4awe_A | 387 | Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana | 97.54 | |
| 3tty_A | 675 | Beta-GAL, beta-galactosidase; TIM barrel, glycosid | 97.52 | |
| 1gnx_A | 479 | Beta-glucosidase; hydrolase, glycosyltransferase, | 97.47 | |
| 2e3z_A | 465 | Beta-glucosidase; TIM barrel, glycoside hydrolase | 97.39 | |
| 2e9l_A | 469 | Cytosolic beta-glucosidase; novel cytosolic neutra | 97.37 | |
| 4hz8_A | 444 | Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba | 97.36 | |
| 1v08_A | 512 | Beta-glucosidase; glycoside hydrolase, dimboa-gluc | 97.33 | |
| 1pbg_A | 468 | PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g | 97.31 | |
| 2dga_A | 565 | Beta-glucosidase; alpha/beta barrel, hydrolase; 1. | 97.29 | |
| 1e4m_M | 501 | Myrosinase MA1; hydrolase, family 1 glycosyl hydro | 97.25 | |
| 4b3l_A | 479 | Beta-glucosidase; hydrolase, glycosidase, carbohyd | 97.24 | |
| 3f5l_A | 481 | Beta-glucosidase; beta-alpha-barrels, glycosidase, | 97.21 | |
| 2jf7_A | 532 | Strictosidine-O-beta-D-glucosidase; alkaloid, hydr | 97.2 | |
| 3ahy_A | 473 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 97.2 | |
| 3gnp_A | 488 | OS03G0212800 protein; beta-alpha barrel, glycosida | 97.16 | |
| 1cbg_A | 490 | Cyanogenic beta-glucosidase; hydrolase (O-glycosyl | 97.09 | |
| 3d3a_A | 612 | Beta-galactosidase; protein structure initiative I | 97.09 | |
| 1wcg_A | 464 | Thioglucosidase, myrosinase; aphid, beta-glucosida | 97.09 | |
| 3ta9_A | 458 | Glycoside hydrolase family 1; TIM barrel, glucosid | 97.01 | |
| 1v02_A | 565 | Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri | 96.99 | |
| 3u7v_A | 552 | Beta-galactosidase; structural genomics, PSI-biolo | 96.95 | |
| 3apg_A | 473 | Beta-glucosidase; TIM barrel, hydrolase, sugar bin | 96.88 | |
| 3qom_A | 481 | 6-phospho-beta-glucosidase; structural genomics, P | 96.87 | |
| 1qvb_A | 481 | Beta-glycosidase; TIM-barrel, thermostable, hydrol | 96.87 | |
| 4dde_A | 480 | 6-phospho-beta-glucosidase; structural genomics, P | 96.73 | |
| 4atd_A | 513 | Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr | 96.63 | |
| 3vii_A | 487 | Beta-glucosidase; cellulases, glycosyl hydrolase, | 96.54 | |
| 3ptm_A | 505 | Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly | 96.52 | |
| 4e8d_A | 595 | Glycosyl hydrolase, family 35; TIM barrel, beta-pr | 96.49 | |
| 1w91_A | 503 | Beta-xylosidase; MAD, seMet, tetramer, hydrolase; | 96.48 | |
| 1uhv_A | 500 | Beta-xylosidase; family 39 glycoside hydrolase, xy | 96.41 | |
| 3thd_A | 654 | Beta-galactosidase; TIM-barrel domain, glycosyl hy | 96.33 | |
| 2w61_A | 555 | GAS2P, glycolipid-anchored surface protein 2; glyc | 96.21 | |
| 1tg7_A | 971 | Beta-galactosidase; TIM barrel domain, glycoside h | 96.14 | |
| 3civ_A | 343 | Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. | 96.13 | |
| 4gqr_A | 496 | Pancreatic alpha-amylase; glycosyl hydrolase, diab | 95.86 | |
| 4a3y_A | 540 | Raucaffricine-O-beta-D-glucosidase; hydrolase, alk | 95.85 | |
| 3og2_A | 1003 | Beta-galactosidase; TIM barrel domain, glycoside h | 95.69 | |
| 1jlx_A | 303 | Agglutinin, amaranthin, ACA; complex (lectin/sacch | 95.33 | |
| 1uwi_A | 489 | Beta-galactosidase; hydrolase, beta-glycosidase, g | 95.2 | |
| 4aie_A | 549 | Glucan 1,6-alpha-glucosidase; hydrolase, glycoside | 94.84 | |
| 1jlx_A | 303 | Agglutinin, amaranthin, ACA; complex (lectin/sacch | 94.81 | |
| 4ha4_A | 489 | Beta-galactosidase; TIM barrel, beta-glycosidase, | 94.77 | |
| 1hcd_A | 118 | Hisactophilin; actin binding; NMR {Dictyostelium d | 94.49 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 94.37 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 94.32 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 94.15 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 93.86 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 93.75 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 93.66 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 93.5 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 93.49 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 93.46 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 93.46 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 93.45 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 93.4 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 93.4 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 93.37 | |
| 1hcd_A | 118 | Hisactophilin; actin binding; NMR {Dictyostelium d | 93.36 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 93.34 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 93.33 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 93.2 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 93.18 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 93.12 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 93.03 | |
| 3hn3_A | 613 | Beta-G1, beta-glucuronidase; lysosomal enzyme, aci | 92.96 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 92.94 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 92.89 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 92.87 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 92.83 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 92.77 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 92.66 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 92.57 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 92.42 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 92.39 | |
| 1nq6_A | 302 | XYS1; glycoside hydrolase family 10, xylanase, xyl | 92.39 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 92.32 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 92.29 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 92.16 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 92.14 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 92.1 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 92.05 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 91.99 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 91.96 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 91.81 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 91.68 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 91.66 | |
| 1wdp_A | 495 | Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 | 91.61 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 91.59 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 91.58 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 91.29 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 91.26 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 91.25 | |
| 2xfr_A | 535 | Beta-amylase; hydrolase, carbohydrate metabolism, | 91.19 | |
| 1fa2_A | 498 | Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 | 91.17 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 91.08 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 90.98 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 90.91 | |
| 3cmg_A | 667 | Putative beta-galactosidase; structural genomics, | 90.71 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 90.61 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 90.44 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 89.95 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 89.86 | |
| 1xyz_A | 347 | 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola | 89.55 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 89.4 | |
| 3lpf_A | 605 | Beta-glucuronidase; alpha/beta barrel, sugar-bindi | 89.23 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 89.2 | |
| 3cui_A | 315 | EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine | 89.17 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 89.05 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 88.55 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 88.55 | |
| 1v0l_A | 313 | Endo-1,4-beta-xylanase A; glycoside hydrolase fami | 88.44 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 88.22 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 87.87 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 87.43 | |
| 2dep_A | 356 | Xylanase B, thermostable celloxylanase; glycosidas | 87.35 | |
| 3fn9_A | 692 | Putative beta-galactosidase; structural genomics, | 87.14 | |
| 1ur1_A | 378 | Endoxylanase; hydrolase, family 10, glycoside hydr | 87.13 | |
| 2d1z_A | 436 | Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en | 87.03 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 87.01 | |
| 1n82_A | 331 | Xylanase, intra-cellular xylanase; hydrolase; 1.45 | 86.91 | |
| 4ekj_A | 500 | Beta-xylosidase; TIM-barrel fold, hemicellulase, h | 86.69 | |
| 2je8_A | 848 | Beta-mannosidase; glycoside hydrolase, hydrolase; | 86.39 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 86.22 | |
| 1ta3_B | 303 | Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), | 85.83 | |
| 3kzs_A | 463 | Glycosyl hydrolase family 5; structural genomics, | 85.73 | |
| 3gyc_A | 393 | Putative glycoside hydrolase; YP_001304622.1, stru | 85.26 | |
| 1r85_A | 379 | Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A | 84.87 | |
| 3q7x_A | 132 | De novo designed beta-trefoil architecture with S | 84.39 | |
| 1jz7_A | 1023 | Lactase, beta-galactosidase, LACZ; TIM barrel (alp | 84.21 | |
| 3gm8_A | 801 | Glycoside hydrolase family 2, candidate beta-GLYC; | 84.04 | |
| 1yq2_A | 1024 | Beta-galactosidase; glycosyl hydrolase family 2, T | 83.91 | |
| 4h41_A | 340 | Putative alpha-L-fucosidase; hydrolase, carbohydra | 82.33 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 82.27 | |
| 3bga_A | 1010 | Beta-galactosidase; NYSGXRC, protein structure ini | 82.24 | |
| 3pg0_A | 165 | Threefoil; symmetric design, beta-trefoil, enginee | 81.5 | |
| 2uwf_A | 356 | Endoxylanase, alkaline active endoxylanase; hydrol | 81.46 | |
| 1i1w_A | 303 | Endo-1,4-beta-xylanase; xylan degradation, hydrola | 80.44 |
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A | Back alignment and structure |
|---|
Probab=99.93 E-value=1.5e-27 Score=234.62 Aligned_cols=135 Identities=31% Similarity=0.453 Sum_probs=114.8
Q ss_pred ccCCCCCCC----CCCccchhc-c----cCCcceeEEEeccCCCCchhhhhh-cccccCCHHHHHHHHHcCCCEEEeccc
Q 020317 181 YEGATSWGD----DDPSVFEMT-I----AGRMQGEFQVTNGYGPQKAPQVMR-HWSTYIVEDDFKFIAGNGLNAVRIPVG 250 (327)
Q Consensus 181 ~~~~~~W~~----~~ps~F~~~-~----~~~l~~E~~~~~~~G~~~a~~~l~-~~~~~ite~Df~~i~~~G~n~VRiPi~ 250 (327)
++++|||++ |+|++|... . .+...|||+|++.+|.+++..+|+ ||++||||+||+.|+++|+|+|||||+
T Consensus 16 GVNlGgWlvlE~witps~f~~~~~~~~~~~~~~dE~~l~~~lG~~~a~~~~~~hw~~~ite~D~~~ik~~G~N~VRipi~ 95 (399)
T 3n9k_A 16 GVNLGGWFVLEPYMTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIG 95 (399)
T ss_dssp EEECTTSSSCCTTTSGGGTGGGCBTTBCTTSCCSHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCEEEEEEE
T ss_pred EEehhhhhccCCccCchhhhcccCccccCcccccHHHHHHHhCHHHHHHHHHHhhcccCcHHHHHHHHHcCCCEEEEccc
Confidence 456899999 555566553 1 224679999999999999999999 999999999999999999999999999
Q ss_pred cccccCCCCCCCCCcchHHHHHHHHHHHHHCCCcEEEecCCCCCCCCCCCCCCCCCCCCCCCCCCccc
Q 020317 251 WWMASDPTPPAPYVGGSLRALDNAFTWAGYAFFPVPSDITISVTTSQDLTIMGGPVHNTPKYGVPKPM 318 (327)
Q Consensus 251 yw~~~~~~~~~p~~~~~~~~ld~~v~wa~~~gl~VilDlH~~~PG~qn~~~~sG~~~~~~~~~~~~~~ 318 (327)
||.+. +.+.+||..+.+++||++|+||+++||+||||+|+ +||+||+.+|+|... ...|.++.++
T Consensus 96 ~~~~~-~~~~~py~~~~~~~ld~vV~~a~~~Gl~VILDlH~-~pG~qng~~~sG~~~-~~~w~~~~~~ 160 (399)
T 3n9k_A 96 YWAFQ-LLDNDPYVQGQVQYLEKALGWARKNNIRVWIDLHG-APGSQNGFDNSGLRD-SYNFQNGDNT 160 (399)
T ss_dssp GGGTC-CCTTCCCCCCHHHHHHHHHHHHHHTTCEEEEEEEE-CTTCSSCCGGGSSTT-CCCTTSTTHH
T ss_pred HHHcc-CCCCCccchhHHHHHHHHHHHHHHCCCEEEEEecC-CCcccccccCCCCCC-CCCCCCHHHH
Confidence 99874 33467888779999999999999999999999999 999999999999763 4457776553
|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* 4gov_A 4goy_A 4gp3_A 4gp0_A* | Back alignment and structure |
|---|
| >2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* 4gov_A 4goy_A 4gp3_A 4gp0_A* | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* | Back alignment and structure |
|---|
| >1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* | Back alignment and structure |
|---|
| >7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* | Back alignment and structure |
|---|
| >3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A | Back alignment and structure |
|---|
| >3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* | Back alignment and structure |
|---|
| >1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* | Back alignment and structure |
|---|
| >1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 | Back alignment and structure |
|---|
| >2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} | Back alignment and structure |
|---|
| >3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A | Back alignment and structure |
|---|
| >1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* | Back alignment and structure |
|---|
| >1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* | Back alignment and structure |
|---|
| >2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* | Back alignment and structure |
|---|
| >4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* | Back alignment and structure |
|---|
| >2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} | Back alignment and structure |
|---|
| >2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* | Back alignment and structure |
|---|
| >1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* | Back alignment and structure |
|---|
| >3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* | Back alignment and structure |
|---|
| >1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A | Back alignment and structure |
|---|
| >2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... | Back alignment and structure |
|---|
| >1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A | Back alignment and structure |
|---|
| >1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* | Back alignment and structure |
|---|
| >1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} | Back alignment and structure |
|---|
| >1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* | Back alignment and structure |
|---|
| >2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* | Back alignment and structure |
|---|
| >1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A | Back alignment and structure |
|---|
| >4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} | Back alignment and structure |
|---|
| >3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* | Back alignment and structure |
|---|
| >1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A | Back alignment and structure |
|---|
| >2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* | Back alignment and structure |
|---|
| >2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* | Back alignment and structure |
|---|
| >4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* | Back alignment and structure |
|---|
| >1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A | Back alignment and structure |
|---|
| >1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* | Back alignment and structure |
|---|
| >2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* | Back alignment and structure |
|---|
| >1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* | Back alignment and structure |
|---|
| >4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A | Back alignment and structure |
|---|
| >3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* | Back alignment and structure |
|---|
| >2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A | Back alignment and structure |
|---|
| >3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} | Back alignment and structure |
|---|
| >3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* | Back alignment and structure |
|---|
| >1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} | Back alignment and structure |
|---|
| >1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* | Back alignment and structure |
|---|
| >3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} | Back alignment and structure |
|---|
| >3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A | Back alignment and structure |
|---|
| >1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 | Back alignment and structure |
|---|
| >4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* | Back alignment and structure |
|---|
| >3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* | Back alignment and structure |
|---|
| >3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* | Back alignment and structure |
|---|
| >4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A | Back alignment and structure |
|---|
| >1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* | Back alignment and structure |
|---|
| >1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A | Back alignment and structure |
|---|
| >3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* | Back alignment and structure |
|---|
| >2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* | Back alignment and structure |
|---|
| >1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* | Back alignment and structure |
|---|
| >3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... | Back alignment and structure |
|---|
| >4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* | Back alignment and structure |
|---|
| >3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* | Back alignment and structure |
|---|
| >1jlx_A Agglutinin, amaranthin, ACA; complex (lectin/saccharide), T-disaccharide homodimer, bivalent, lectin; HET: GAL A2G; 2.20A {Amaranthus caudatus} SCOP: b.42.3.1 b.42.3.1 PDB: 1jly_A | Back alignment and structure |
|---|
| >1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A | Back alignment and structure |
|---|
| >4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >1jlx_A Agglutinin, amaranthin, ACA; complex (lectin/saccharide), T-disaccharide homodimer, bivalent, lectin; HET: GAL A2G; 2.20A {Amaranthus caudatus} SCOP: b.42.3.1 b.42.3.1 PDB: 1jly_A | Back alignment and structure |
|---|
| >4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A | Back alignment and structure |
|---|
| >1hcd_A Hisactophilin; actin binding; NMR {Dictyostelium discoideum} SCOP: b.42.5.2 PDB: 1hce_A | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >1hcd_A Hisactophilin; actin binding; NMR {Dictyostelium discoideum} SCOP: b.42.5.2 PDB: 1hce_A | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* | Back alignment and structure |
|---|
| >3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* | Back alignment and structure |
|---|
| >1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* | Back alignment and structure |
|---|
| >3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} | Back alignment and structure |
|---|
| >3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* | Back alignment and structure |
|---|
| >2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A | Back alignment and structure |
|---|
| >1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A | Back alignment and structure |
|---|
| >4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} | Back alignment and structure |
|---|
| >2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} | Back alignment and structure |
|---|
| >1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} | Back alignment and structure |
|---|
| >1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A | Back alignment and structure |
|---|
| >3q7x_A De novo designed beta-trefoil architecture with S primary structure; beta-terfoil, de novo protein; 1.40A {Synthetic} PDB: 3q7w_A 3o4d_A 3q7y_A 3o4b_A 3o4c_A 3o4a_A* 3o49_A | Back alignment and structure |
|---|
| >1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... | Back alignment and structure |
|---|
| >3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 | Back alignment and structure |
|---|
| >4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A | Back alignment and structure |
|---|
| >3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} | Back alignment and structure |
|---|
| >2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* | Back alignment and structure |
|---|
| >1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 327 | ||||
| d1dfca3 | 123 | b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens | 6e-20 | |
| d1dfca1 | 133 | b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens | 8e-17 | |
| d1dfca1 | 133 | b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens | 0.001 | |
| d1h4pa_ | 408 | c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea | 8e-15 | |
| d1h4pa_ | 408 | c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea | 4e-06 | |
| d2pb1a1 | 394 | c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast | 9e-14 | |
| d2pb1a1 | 394 | c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast | 2e-06 | |
| d1ceoa_ | 340 | c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm | 5e-13 | |
| d1hcda_ | 118 | b.42.5.2 (A:) Histidine-rich actin-binding protein | 2e-11 | |
| d1hcda_ | 118 | b.42.5.2 (A:) Histidine-rich actin-binding protein | 2e-05 | |
| d1vjza_ | 325 | c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm | 2e-09 | |
| d1h1na_ | 305 | c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran | 3e-08 | |
| d1ecea_ | 358 | c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellul | 8e-07 | |
| d1edga_ | 380 | c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu | 2e-06 | |
| d1rh9a1 | 370 | c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycoper | 4e-04 | |
| d1kwga2 | 393 | c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t | 5e-04 | |
| d1wkya2 | 297 | c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JA | 0.001 | |
| d1uuqa_ | 410 | c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta | 0.002 |
| >d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
class: All beta proteins fold: beta-Trefoil superfamily: Actin-crosslinking proteins family: Fascin domain: Fascin species: Human (Homo sapiens) [TaxId: 9606]
Score = 81.9 bits (202), Expect = 6e-20
Identities = 25/121 (20%), Positives = 50/121 (41%), Gaps = 10/121 (8%)
Query: 68 QLQFKSVTVGKYLCAENGGGTIVVANRTSASGWETFKLWRINETN-FHFRVFNKQFIGLD 126
Q+ ++ + + G + AN+ + ETF+L +T FR ++ L
Sbjct: 3 QVVLQAAN-ERNVSTRQGMD--LSANQDEETDQETFQLEIDRDTKKCAFRTHTGKYWTLT 59
Query: 127 TNGNGIDIVAESNTPRSSETFEIVRNSNDLSRVRIKAPNGFFLQAKTEELVTADYEGATS 186
G + + +++ +S F+I R+ ++A NG F+ +K + A E A
Sbjct: 60 ATGG---VQSTASSKNASCYFDIEWRDR---RITLRASNGKFVTSKKNGQLAASVETAGD 113
Query: 187 W 187
Sbjct: 114 S 114
|
| >d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 | Back information, alignment and structure |
|---|
| >d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Length = 118 | Back information, alignment and structure |
|---|
| >d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Length = 118 | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 | Back information, alignment and structure |
|---|
| >d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 | Back information, alignment and structure |
|---|
| >d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 370 | Back information, alignment and structure |
|---|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 | Back information, alignment and structure |
|---|
| >d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Length = 297 | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 327 | |||
| d1h4pa_ | 408 | Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom | 99.97 | |
| d2pb1a1 | 394 | Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) | 99.97 | |
| d1dfca3 | 123 | Fascin {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1dfca1 | 133 | Fascin {Human (Homo sapiens) [TaxId: 9606]} | 99.74 | |
| d1hcda_ | 118 | Histidine-rich actin-binding protein (hisactophili | 99.73 | |
| d1ceoa_ | 340 | Endoglucanase CelC {Clostridium thermocellum [TaxI | 99.66 | |
| d1vjza_ | 325 | Endoglucanase homologue TM1752 {Thermotoga maritim | 99.61 | |
| d1dfca4 | 111 | Fascin {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1h1na_ | 305 | Endocellulase EngI {Thermoascus aurantiacus [TaxId | 99.42 | |
| d1ecea_ | 358 | Endocellulase E1 {Acidothermus cellulolyticus [Tax | 99.4 | |
| d1edga_ | 380 | Endoglucanase CelA {Clostridium cellulolyticum [Ta | 99.39 | |
| d1hcda_ | 118 | Histidine-rich actin-binding protein (hisactophili | 99.32 | |
| d1dfca3 | 123 | Fascin {Human (Homo sapiens) [TaxId: 9606]} | 99.29 | |
| d1dfca1 | 133 | Fascin {Human (Homo sapiens) [TaxId: 9606]} | 99.21 | |
| d1g01a_ | 357 | Alkaline cellulase K catalytic domain {Bacillus sp | 99.09 | |
| d1wkya2 | 297 | Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 | 99.08 | |
| d1bqca_ | 302 | Beta-mannanase {Thermomonospora fusca [TaxId: 2021 | 98.97 | |
| d1ur4a_ | 387 | Beta-1,4-galactanase {Bacillus licheniformis [TaxI | 98.91 | |
| d1tvna1 | 293 | Endoglucanase Cel5a {Pseudoalteromonas haloplankti | 98.89 | |
| d7a3ha_ | 300 | Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId | 98.86 | |
| d1egza_ | 291 | Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: | 98.79 | |
| d2c0ha1 | 350 | endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed | 98.73 | |
| d1rh9a1 | 370 | Beta-mannanase {Tomato (Lycopersicon esculentum) [ | 98.57 | |
| d1uuqa_ | 410 | Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | 98.53 | |
| d1hjsa_ | 332 | Beta-1,4-galactanase {Thielavia heterothallica, ak | 98.49 | |
| d1qnra_ | 344 | Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | 98.35 | |
| d1dfca4 | 111 | Fascin {Human (Homo sapiens) [TaxId: 9606]} | 98.08 | |
| d1kwga2 | 393 | A4 beta-galactosidase {Thermus thermophilus [TaxId | 98.03 | |
| d1foba_ | 334 | Beta-1,4-galactanase {Fungus (Aspergillus aculeatu | 97.97 | |
| d1tg7a5 | 354 | Beta-galactosidase LacA, N-terminal domain {Penici | 97.48 | |
| d1ug6a_ | 426 | Beta-glucosidase A {Thermus thermophilus [TaxId: 2 | 97.32 | |
| d2j78a1 | 443 | Beta-glucosidase A {Thermotoga maritima [TaxId: 23 | 97.26 | |
| d1e4ia_ | 447 | Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 | 97.04 | |
| d1wcga1 | 462 | Thioglucosidase {Cabbage aphid (Brevicoryne brassi | 96.99 | |
| d1gnxa_ | 464 | Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] | 96.97 | |
| d1qoxa_ | 449 | Beta-glucosidase A {Bacillus circulans, subsp. alk | 96.94 | |
| d1v02a_ | 484 | Plant beta-glucosidase (myrosinase) {Sorghum bicol | 96.89 | |
| d1e4mm_ | 499 | Plant beta-glucosidase (myrosinase) {White mustard | 96.88 | |
| d1cbga_ | 490 | Plant beta-glucosidase (myrosinase) {Creeping whit | 96.8 | |
| d1vffa1 | 423 | Beta-glucosidase A {Archaeon Pyrococcus horikoshii | 96.8 | |
| d1pbga_ | 468 | 6-phospho-beta-D-galactosidase, PGAL {Lactococcus | 96.68 | |
| d1vema2 | 417 | Bacterial beta-amylase {Bacillus cereus [TaxId: 13 | 96.53 | |
| d1ud2a2 | 390 | Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta | 96.18 | |
| d1m7xa3 | 396 | 1,4-alpha-glucan branching enzyme, central domain | 96.14 | |
| d1eh9a3 | 400 | Glycosyltrehalose trehalohydrolase, central domain | 96.05 | |
| d1uwsa_ | 489 | beta-Glycosidase {Archaeon Sulfolobus solfataricus | 96.03 | |
| d3bmva4 | 406 | Cyclodextrin glycosyltransferase {Thermoanaerobact | 96.02 | |
| d1gcya2 | 357 | G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase | 95.98 | |
| d1bf2a3 | 475 | Isoamylase, central domain {Pseudomonas amyloderam | 95.96 | |
| d1hx0a2 | 403 | Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 | 95.84 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 95.78 | |
| d1ht6a2 | 347 | Plant alpha-amylase {Barley (Hordeum vulgare), AMY | 95.67 | |
| d1h3ga3 | 422 | Cyclomaltodextrinase, central domain {Flavobacteri | 95.66 | |
| d1gjwa2 | 572 | Maltosyltransferase {Thermotoga maritima [TaxId: 2 | 95.62 | |
| d1hvxa2 | 393 | Bacterial alpha-amylase {Bacillus stearothermophil | 95.58 | |
| d1qvba_ | 481 | beta-Glycosidase {Archaeon Thermosphaera aggregans | 95.51 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 95.46 | |
| d1lwha2 | 391 | 4-alpha-glucanotransferase {Thermotoga maritima [T | 95.29 | |
| d1j0ha3 | 382 | Neopullulanase, central domain {Bacillus stearothe | 95.22 | |
| d1wzla3 | 382 | Maltogenic amylase, central domain {Thermoactinomy | 95.21 | |
| d1qhoa4 | 407 | Cyclodextrin glycosyltransferase {Bacillus stearot | 95.17 | |
| d2guya2 | 381 | Fungal alpha-amylases {Aspergillus oryzae, Taka-am | 95.03 | |
| d1m53a2 | 478 | Isomaltulose synthase PalI {Klebsiella sp., lx3 [T | 95.0 | |
| d1dfca2 | 119 | Fascin {Human (Homo sapiens) [TaxId: 9606]} | 94.84 | |
| d1e43a2 | 393 | Bacterial alpha-amylase {Chimera (Bacillus amyloli | 94.82 | |
| d1ea9c3 | 382 | Maltogenic amylase, central domain {Bacillus sp., | 94.74 | |
| d2d3na2 | 394 | Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: | 94.69 | |
| d1uoka2 | 479 | Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 | 94.67 | |
| d2aaaa2 | 381 | Fungal alpha-amylases {Aspergillus niger, acid amy | 94.57 | |
| d1mxga2 | 361 | Bacterial alpha-amylase {Archaeon Pyrococcus woese | 94.57 | |
| d1g5aa2 | 554 | Amylosucrase {Neisseria polysaccharea [TaxId: 489] | 94.39 | |
| d1dfca2 | 119 | Fascin {Human (Homo sapiens) [TaxId: 9606]} | 94.32 | |
| d1ua7a2 | 344 | Bacterial alpha-amylase {Bacillus subtilis [TaxId: | 94.23 | |
| d1jaea2 | 378 | Animal alpha-amylase {Yellow mealworm (Tenebrio mo | 94.23 | |
| d1wzaa2 | 409 | Bacterial alpha-amylase {Halothermothrix orenii [T | 94.05 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 93.86 | |
| d1uhva2 | 346 | Beta-D-xylosidase, catalytic domain {Thermoanaerob | 93.61 | |
| d2vzsa5 | 339 | Exochitosanase CsxA {Amycolatopsis orientalis [Tax | 93.5 | |
| d1jlxa2 | 146 | Agglutinin {Love-lies-bleeding (Amaranthus caudatu | 93.17 | |
| d1bhga3 | 304 | beta-Glucuronidase, domain 3 {Human (Homo sapiens) | 92.89 | |
| d2je8a5 | 348 | Five-domain beta-mannosidase, domain 3 {Bacteroide | 92.5 | |
| d1yq2a5 | 297 | beta-Galactosidase, domain 3 {Arthrobacter sp. c2- | 91.81 | |
| d1jz8a5 | 292 | beta-Galactosidase, domain 3 {Escherichia coli [Ta | 91.49 | |
| d1jlxa1 | 153 | Agglutinin {Love-lies-bleeding (Amaranthus caudatu | 87.74 | |
| d1upsa2 | 131 | GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi | 86.68 | |
| d1iv8a2 | 653 | Maltooligosyl trehalose synthase {Archaeon Sulfolo | 86.52 | |
| d1x7fa2 | 244 | Outer surface protein, N-terminal domain {Bacillus | 85.56 | |
| d1jlxa2 | 146 | Agglutinin {Love-lies-bleeding (Amaranthus caudatu | 84.92 | |
| d1ji1a3 | 432 | Maltogenic amylase, central domain {Thermoactinomy | 81.71 | |
| d1nuna_ | 139 | Fibroblast growth factor-10, FGF10 {Human (Homo sa | 80.6 |
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: beta-glycanases domain: Exo-beta-(1,3)-glucanase species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.97 E-value=2.3e-33 Score=273.99 Aligned_cols=112 Identities=30% Similarity=0.430 Sum_probs=98.6
Q ss_pred ceeEEEeccCCCCchhhhhh-cccccCCHHHHHHHHHcCCCEEEeccccccccCCCCCCCCCc-chHHHHHHHHHHHHHC
Q 020317 204 QGEFQVTNGYGPQKAPQVMR-HWSTYIVEDDFKFIAGNGLNAVRIPVGWWMASDPTPPAPYVG-GSLRALDNAFTWAGYA 281 (327)
Q Consensus 204 ~~E~~~~~~~G~~~a~~~l~-~~~~~ite~Df~~i~~~G~n~VRiPi~yw~~~~~~~~~p~~~-~~~~~ld~~v~wa~~~ 281 (327)
.+|++|++.+|.+.+.++|+ ||++||||+||+.|+++|+|+|||||+||.+.. .+.+|++. ..+++||++|+||+++
T Consensus 48 ~de~~~~~~~G~~~~~~~~~~h~~~~ite~D~~~i~~~G~N~VRiPi~~~~~~~-~~~~~~~~~~~~~~ld~~v~~a~~~ 126 (408)
T d1h4pa_ 48 VDEYHFCQYLGKDLAKSRLQSHWSTFYQEQDFANIASQGFNLVRIPIGYWAFQI-LDDDPYVSGLQESYLDQAIGWARNN 126 (408)
T ss_dssp SSHHHHHHHHCHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCEEEEEEEGGGTCC-CTTCCCCCSSHHHHHHHHHHHHHHT
T ss_pred chHHHHHHHhCHHHHHHHHHHHHhccCCHHHHHHHHHCCCCEEEEeccHHHhcC-CCCCCCcChhHHHHHHHHHHHHHHC
Confidence 47889999999999999999 999999999999999999999999999998754 34567654 4899999999999999
Q ss_pred CCcEEEecCCCCCCCCCCCCCCCCCCCCCCCCCCccc
Q 020317 282 FFPVPSDITISVTTSQDLTIMGGPVHNTPKYGVPKPM 318 (327)
Q Consensus 282 gl~VilDlH~~~PG~qn~~~~sG~~~~~~~~~~~~~~ 318 (327)
||+||||||+ +||+||+.+|+|... .+.|.++.++
T Consensus 127 gl~VilDlH~-~pG~~~~~~~~~~~~-~~~~~~~~~~ 161 (408)
T d1h4pa_ 127 SLKVWVDLHG-AAGSQNGFDNSGLRD-SYKFLEDSNL 161 (408)
T ss_dssp TCEEEEEEEE-CTTCSSCCGGGSSTT-CCCTTSHHHH
T ss_pred CCEEEEEeCC-CCCCCcCCCCCCccc-ccccCCchHH
Confidence 9999999999 999999999999753 4557666554
|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} | Back information, alignment and structure |
|---|
| >d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} | Back information, alignment and structure |
|---|
| >d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} | Back information, alignment and structure |
|---|
| >d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} | Back information, alignment and structure |
|---|
| >d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} | Back information, alignment and structure |
|---|
| >d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} | Back information, alignment and structure |
|---|
| >d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} | Back information, alignment and structure |
|---|
| >d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} | Back information, alignment and structure |
|---|
| >d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} | Back information, alignment and structure |
|---|
| >d1dfca2 b.42.5.1 (A:1141-1259) Fascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} | Back information, alignment and structure |
|---|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} | Back information, alignment and structure |
|---|
| >d1dfca2 b.42.5.1 (A:1141-1259) Fascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} | Back information, alignment and structure |
|---|
| >d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1jlxa2 b.42.3.1 (A:154-299) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]} | Back information, alignment and structure |
|---|
| >d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} | Back information, alignment and structure |
|---|
| >d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jlxa1 b.42.3.1 (A:1-153) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]} | Back information, alignment and structure |
|---|
| >d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1jlxa2 b.42.3.1 (A:154-299) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]} | Back information, alignment and structure |
|---|
| >d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1nuna_ b.42.1.1 (A:) Fibroblast growth factor-10, FGF10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|