Citrus Sinensis ID: 020381
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 327 | ||||||
| 298204854 | 383 | unnamed protein product [Vitis vinifera] | 0.850 | 0.725 | 0.489 | 2e-55 | |
| 225451342 | 423 | PREDICTED: light-inducible protein CPRF2 | 0.850 | 0.657 | 0.489 | 2e-55 | |
| 16797791 | 450 | bZIP transcription factor [Nicotiana tab | 0.877 | 0.637 | 0.470 | 2e-53 | |
| 147796457 | 446 | hypothetical protein VITISV_022136 [Viti | 0.853 | 0.625 | 0.462 | 6e-53 | |
| 255559911 | 441 | DNA binding protein, putative [Ricinus c | 0.917 | 0.680 | 0.490 | 6e-53 | |
| 444300790 | 444 | bZIP transcription factor family protein | 0.868 | 0.639 | 0.448 | 3e-51 | |
| 351720703 | 417 | bZIP protein [Glycine max] gi|183014149| | 0.877 | 0.688 | 0.466 | 6e-50 | |
| 351725229 | 404 | bZIP transcription factor bZIP89 [Glycin | 0.877 | 0.710 | 0.463 | 2e-48 | |
| 224123412 | 371 | predicted protein [Populus trichocarpa] | 0.767 | 0.676 | 0.447 | 8e-48 | |
| 118486477 | 445 | unknown [Populus trichocarpa] | 0.938 | 0.689 | 0.521 | 2e-47 |
| >gi|298204854|emb|CBI34161.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 222 bits (565), Expect = 2e-55, Method: Compositional matrix adjust.
Identities = 157/321 (48%), Positives = 205/321 (63%), Gaps = 43/321 (13%)
Query: 1 MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASD 60
M+ VFS D+ + F +SP +S MNRS SEW ++FLQE + P + S S++
Sbjct: 1 MDRVFSVDEIPEQFWASPPS--SSKEPSQMNRSASEWAFQRFLQESSSPPSSSSVSASGP 58
Query: 61 NSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRD--------------QSLDPPVIPSST 106
++ ++DVVE+K D SLDPP
Sbjct: 59 SA-------------------ENDVVELKVPIDDPKPTPAPPAPPAPATSLDPP----PN 95
Query: 107 APVDSDEYRAYLKTKLDLACAAVAL-RTAPVKPEDKSSLIENQTQAAKPSELGSQAMATV 165
P+DS+EY+A+LK++L+LACAAVAL R + VKP+D ++L + +QA+K S+L SQA
Sbjct: 96 VPIDSEEYQAFLKSRLNLACAAVALSRASFVKPQDSAALADTGSQASKTSQLRSQAPCK- 154
Query: 166 NVSTAHDALGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETI 225
+ +D G K PLG LPA+Q + AQ+R +TS SSRE SDDDE+EG+TETI
Sbjct: 155 --GSGYDLSGAPDKEAGGPLGIPSLPAMQKKAGAQLRPTTSESSREHSDDDEVEGETETI 212
Query: 226 EGLDSVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKY 285
E +D D KR RRMLSNRESARRSRRRKQAHL ELETQ QLR E+SSLLK LTD++QKY
Sbjct: 213 ENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVAQLRLENSSLLKRLTDISQKY 272
Query: 286 DESAVNNRILKADIETLRAKV 306
+E+AV+NR+LKAD+ETLRAKV
Sbjct: 273 NEAAVDNRVLKADVETLRAKV 293
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225451342|ref|XP_002279520.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|16797791|gb|AAL27150.1| bZIP transcription factor [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|147796457|emb|CAN74806.1| hypothetical protein VITISV_022136 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255559911|ref|XP_002520974.1| DNA binding protein, putative [Ricinus communis] gi|223539811|gb|EEF41391.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|444300790|gb|AGD98704.1| bZIP transcription factor family protein 6 [Camellia sinensis] | Back alignment and taxonomy information |
|---|
| >gi|351720703|ref|NP_001237953.1| bZIP protein [Glycine max] gi|183014149|dbj|BAG24402.1| bZIP protein [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351725229|ref|NP_001237085.1| bZIP transcription factor bZIP89 [Glycine max] gi|113367196|gb|ABI34655.1| bZIP transcription factor bZIP89 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224123412|ref|XP_002319072.1| predicted protein [Populus trichocarpa] gi|222857448|gb|EEE94995.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118486477|gb|ABK95078.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 327 | ||||||
| TAIR|locus:505006398 | 403 | BZIP25 "basic leucine zipper 2 | 0.238 | 0.193 | 0.576 | 1.8e-34 | |
| TAIR|locus:2184251 | 314 | BZO2H3 "AT5G28770" [Arabidopsi | 0.223 | 0.232 | 0.575 | 7e-34 | |
| TAIR|locus:2149403 | 277 | BZIP9 "AT5G24800" [Arabidopsis | 0.238 | 0.281 | 0.423 | 2.4e-09 | |
| TAIR|locus:2053124 | 171 | bZIP2 "AT2G18160" [Arabidopsis | 0.235 | 0.450 | 0.285 | 0.00059 |
| TAIR|locus:505006398 BZIP25 "basic leucine zipper 25" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 221 (82.9 bits), Expect = 1.8e-34, Sum P(2) = 1.8e-34
Identities = 45/78 (57%), Positives = 54/78 (69%)
Query: 229 DSVDDKRARRMLXXXXXXXXXXXXKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDES 288
D D KRARRML KQ +NE +TQ GQLRAEHS+L+ L+D+N KYD +
Sbjct: 226 DPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAA 285
Query: 289 AVNNRILKADIETLRAKV 306
AV+NRIL+ADIETLR KV
Sbjct: 286 AVDNRILRADIETLRTKV 303
|
|
| TAIR|locus:2184251 BZO2H3 "AT5G28770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149403 BZIP9 "AT5G24800" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 327 | |||
| smart00338 | 65 | smart00338, BRLZ, basic region leucin zipper | 1e-14 | |
| pfam00170 | 64 | pfam00170, bZIP_1, bZIP transcription factor | 3e-10 | |
| cd12193 | 54 | cd12193, B_zip1, basic leucine zipper DNA-binding | 1e-05 | |
| pfam07716 | 54 | pfam07716, bZIP_2, Basic region leucine zipper | 3e-05 |
| >gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper | Back alignment and domain information |
|---|
Score = 67.2 bits (165), Expect = 1e-14
Identities = 25/62 (40%), Positives = 37/62 (59%)
Query: 232 DDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVN 291
D+KR RR NRE+ARRSR RK+A + ELE + QL AE+ L K + + ++ ++
Sbjct: 3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62
Query: 292 NR 293
Sbjct: 63 LE 64
|
Length = 65 |
| >gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor | Back alignment and domain information |
|---|
| >gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 327 | |||
| smart00338 | 65 | BRLZ basic region leucin zipper. | 99.34 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 99.32 | |
| KOG4343 | 655 | consensus bZIP transcription factor ATF6 [Transcri | 99.26 | |
| KOG0709 | 472 | consensus CREB/ATF family transcription factor [Tr | 99.21 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 99.16 | |
| KOG3584 | 348 | consensus cAMP response element binding protein an | 99.03 | |
| PF07716 | 54 | bZIP_2: Basic region leucine zipper; InterPro: IPR | 99.0 | |
| PF03131 | 92 | bZIP_Maf: bZIP Maf transcription factor; InterPro: | 98.1 | |
| KOG0837 | 279 | consensus Transcriptional activator of the JUN fam | 98.06 | |
| KOG4571 | 294 | consensus Activating transcription factor 4 [Trans | 97.44 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 97.15 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 96.83 | |
| KOG3863 | 604 | consensus bZIP transcription factor NRF1 [Transcri | 96.47 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 96.32 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 96.1 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 95.81 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 95.27 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 95.27 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 95.03 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.96 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 94.77 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 94.71 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 94.67 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 94.61 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 94.55 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 94.51 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 94.31 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 94.09 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 93.87 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 93.82 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 93.61 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 93.17 | |
| PF07989 | 75 | Microtub_assoc: Microtubule associated; InterPro: | 92.57 | |
| PF10224 | 80 | DUF2205: Predicted coiled-coil protein (DUF2205); | 91.5 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 90.97 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 90.89 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 90.4 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 90.36 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 90.23 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 89.79 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 89.73 | |
| PRK11637 | 428 | AmiB activator; Provisional | 89.7 | |
| PRK11637 | 428 | AmiB activator; Provisional | 89.69 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 89.49 | |
| TIGR00219 | 283 | mreC rod shape-determining protein MreC. MreC (mur | 89.21 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 89.03 | |
| smart00340 | 44 | HALZ homeobox associated leucin zipper. | 88.77 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 88.68 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 88.41 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 88.24 | |
| PRK09039 | 343 | hypothetical protein; Validated | 88.1 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 87.56 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 87.51 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 87.44 | |
| PF04899 | 70 | MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th | 87.34 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 87.33 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 87.31 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 87.25 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 87.22 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 87.21 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 87.1 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 86.91 | |
| PF05377 | 55 | FlaC_arch: Flagella accessory protein C (FlaC); In | 86.17 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 85.96 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 85.8 | |
| TIGR02209 | 85 | ftsL_broad cell division protein FtsL. This model | 85.73 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 85.73 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 85.63 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 85.63 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 85.41 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 85.31 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 85.29 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 85.28 | |
| PF10224 | 80 | DUF2205: Predicted coiled-coil protein (DUF2205); | 85.23 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 85.23 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 84.86 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 84.71 | |
| KOG1414 | 395 | consensus Transcriptional activator FOSB/c-Fos and | 84.54 | |
| PHA03155 | 115 | hypothetical protein; Provisional | 84.42 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 84.31 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 84.17 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 83.94 | |
| PF12808 | 52 | Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 | 83.77 | |
| PRK13922 | 276 | rod shape-determining protein MreC; Provisional | 83.69 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 83.39 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 83.32 | |
| PF07798 | 177 | DUF1640: Protein of unknown function (DUF1640); In | 83.31 | |
| PF05278 | 269 | PEARLI-4: Arabidopsis phospholipase-like protein ( | 83.16 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 83.07 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 82.95 | |
| PHA03162 | 135 | hypothetical protein; Provisional | 82.84 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 82.74 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 82.7 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 82.27 | |
| KOG3756 | 340 | consensus Pinin (desmosome-associated protein) [Cy | 82.17 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 82.16 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 82.11 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 81.87 | |
| PF10828 | 110 | DUF2570: Protein of unknown function (DUF2570); In | 81.68 | |
| KOG1414 | 395 | consensus Transcriptional activator FOSB/c-Fos and | 81.64 | |
| PF01166 | 59 | TSC22: TSC-22/dip/bun family; InterPro: IPR000580 | 81.5 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 81.47 | |
| PF04999 | 97 | FtsL: Cell division protein FtsL; InterPro: IPR007 | 81.45 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 81.43 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 81.35 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 81.35 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 81.34 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 81.23 | |
| PF05812 | 118 | Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: | 81.2 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 81.05 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 80.84 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 80.78 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 80.5 | |
| KOG1103 | 561 | consensus Predicted coiled-coil protein [Function | 80.27 | |
| PF04880 | 166 | NUDE_C: NUDE protein, C-terminal conserved region; | 80.26 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 80.23 | |
| KOG4797 | 123 | consensus Transcriptional regulator [Transcription | 80.16 | |
| PF10506 | 67 | MCC-bdg_PDZ: PDZ domain of MCC-2 bdg protein for U | 80.15 |
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
Probab=99.34 E-value=8.6e-12 Score=94.39 Aligned_cols=61 Identities=41% Similarity=0.566 Sum_probs=54.5
Q ss_pred HHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 020381 232 DDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNN 292 (327)
Q Consensus 232 e~KR~RR~lsNRESArRSR~RKk~~l~eLE~qV~~L~~EN~~L~~~l~~L~qk~~~l~~EN 292 (327)
+.|+.||+++||+||++||.||++|+.+||.+|..|+.+|..|..++..|..++..+..+|
T Consensus 3 ~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~ 63 (65)
T smart00338 3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL 63 (65)
T ss_pred cHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 5799999999999999999999999999999999999999999999987776666655544
|
|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >KOG4343 consensus bZIP transcription factor ATF6 [Transcription] | Back alignment and domain information |
|---|
| >KOG0709 consensus CREB/ATF family transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization | Back alignment and domain information |
|---|
| >PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell | Back alignment and domain information |
|---|
| >KOG0837 consensus Transcriptional activator of the JUN family [Transcription] | Back alignment and domain information |
|---|
| >KOG4571 consensus Activating transcription factor 4 [Transcription] | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG3863 consensus bZIP transcription factor NRF1 [Transcription] | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] | Back alignment and domain information |
|---|
| >PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >TIGR00219 mreC rod shape-determining protein MreC | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >smart00340 HALZ homeobox associated leucin zipper | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02209 ftsL_broad cell division protein FtsL | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PHA03155 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi | Back alignment and domain information |
|---|
| >PRK13922 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PF07798 DUF1640: Protein of unknown function (DUF1640); InterPro: IPR024461 This family consists of uncharacterised proteins | Back alignment and domain information |
|---|
| >PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03162 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >KOG3756 consensus Pinin (desmosome-associated protein) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF10828 DUF2570: Protein of unknown function (DUF2570); InterPro: IPR022538 This entry is represented by Bacteriophage IME08, pseT | Back alignment and domain information |
|---|
| >KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF04999 FtsL: Cell division protein FtsL; InterPro: IPR007082 In Escherichia coli, nine gene products are known to be essential for assembly of the division septum | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PF05812 Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: IPR008642 This family consists of several herpes virus BLRF2 tegument proteins | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1103 consensus Predicted coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >KOG4797 consensus Transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF10506 MCC-bdg_PDZ: PDZ domain of MCC-2 bdg protein for Usher syndrome; InterPro: IPR019536 The entry represents a protein that has a high homology to the tumour suppressor Usher syndrome type-1C protein-binding protein 1, or known as MCC2 (mutated in colon cancer) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 327 | |||
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 2e-13 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 1e-09 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 2e-08 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 7e-08 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 8e-08 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 1e-07 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 7e-07 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 7e-07 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 2e-06 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-05 |
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 | Back alignment and structure |
|---|
Score = 62.8 bits (153), Expect = 2e-13
Identities = 18/52 (34%), Positives = 32/52 (61%)
Query: 234 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKY 285
KR R++ NRE+AR SRR+K+ ++ LE + L ++ +L++ L + Y
Sbjct: 1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52
|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 327 | |||
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 99.52 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 99.27 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 99.2 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 99.18 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 99.12 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 98.99 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 98.85 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 98.49 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 98.47 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 98.44 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 98.18 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 97.15 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 95.98 | |
| 1skn_P | 92 | DNA-binding domain of SKN-1; complex (transcriptio | 95.93 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 95.4 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 94.53 | |
| 2w6a_A | 63 | ARF GTPase-activating protein GIT1; PIX, zinc, sig | 94.24 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 93.71 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 93.18 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 92.48 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 91.5 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 91.44 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 91.31 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 91.29 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 91.07 | |
| 1kd8_B | 36 | GABH BLL, GCN4 acid base heterodimer base-D12LA16L | 90.8 | |
| 2oxj_A | 34 | Hybrid alpha/beta peptide based on the GCN4-P1 Se | 90.74 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 89.83 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 89.36 | |
| 3c3f_A | 34 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 88.48 | |
| 2c9l_Y | 63 | EB1, zebra, BZLF1 trans-activator protein; viral p | 88.48 | |
| 1kd8_A | 36 | GABH AIV, GCN4 acid base heterodimer acid-D12IA16V | 88.45 | |
| 1wlq_A | 83 | Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z | 88.26 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 88.23 | |
| 1p9i_A | 31 | Cortexillin I/GCN4 hybrid peptide; coiled-coil, un | 87.94 | |
| 3he5_A | 49 | Synzip1; heterodimeric coiled-coil, de novo protei | 87.67 | |
| 2wvr_A | 209 | Geminin; DNA replication license, DNA replication | 87.66 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 87.59 | |
| 3vmx_A | 48 | Voltage-gated hydrogen channel 1; coiled-coil, ION | 87.45 | |
| 3c3g_A | 33 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 87.08 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 87.02 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 86.84 | |
| 1uo4_A | 34 | General control protein GCN4; four helix bundle, c | 86.84 | |
| 2bni_A | 34 | General control protein GCN4; four helix bundle, a | 86.61 | |
| 2hy6_A | 34 | General control protein GCN4; protein design, para | 86.34 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 85.92 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 85.84 | |
| 3a2a_A | 58 | Voltage-gated hydrogen channel 1; voltage-gated pr | 85.35 | |
| 2wq1_A | 33 | General control protein GCN4; TAA, nucleus, coiled | 85.22 | |
| 2kz5_A | 91 | Transcription factor NF-E2 45 kDa subunit; structu | 85.19 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 85.08 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 84.66 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 84.45 | |
| 2ve7_C | 250 | Kinetochore protein NUF2, kinetochore protein SPC; | 84.25 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 84.14 | |
| 3m91_A | 51 | Proteasome-associated ATPase; coil COIL alpha heli | 83.56 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 83.44 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 83.07 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 83.03 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 82.32 | |
| 2zxx_A | 79 | Geminin; coiled-coil, cell cycle, coiled coil, DNA | 82.21 | |
| 3swf_A | 74 | CGMP-gated cation channel alpha-1; coiled-coil, as | 81.84 | |
| 3swy_A | 46 | Cyclic nucleotide-gated cation channel alpha-3; co | 81.82 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 81.61 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 81.47 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 81.43 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 81.33 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 81.26 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 81.24 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 81.18 | |
| 2oa5_A | 110 | Hypothetical protein BQLF2; MHR28B, NESG, structur | 80.92 | |
| 2w83_C | 77 | C-JUN-amino-terminal kinase-interacting protein 4; | 80.57 | |
| 2yy0_A | 53 | C-MYC-binding protein; conserved hypothetical prot | 80.36 | |
| 3s4r_A | 93 | Vimentin; alpha-helix, cytoskeleton, intermediate | 80.15 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 80.07 |
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
Probab=99.52 E-value=1.6e-14 Score=106.47 Aligned_cols=53 Identities=34% Similarity=0.596 Sum_probs=49.7
Q ss_pred HHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 020381 234 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYD 286 (327)
Q Consensus 234 KR~RR~lsNRESArRSR~RKk~~l~eLE~qV~~L~~EN~~L~~~l~~L~qk~~ 286 (327)
||.+|+++||+||++||.||++|+++||.+|..|+.||..|..++..|++.|.
T Consensus 1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~~ 53 (55)
T 1dh3_A 1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLYS 53 (55)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTST
T ss_pred ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 58899999999999999999999999999999999999999999998887653
|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B | Back alignment and structure |
|---|
| >2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y | Back alignment and structure |
|---|
| >1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A | Back alignment and structure |
|---|
| >1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} | Back alignment and structure |
|---|
| >2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} | Back alignment and structure |
|---|
| >3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* | Back alignment and structure |
|---|
| >2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... | Back alignment and structure |
|---|
| >2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... | Back alignment and structure |
|---|
| >2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* | Back alignment and structure |
|---|
| >3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} | Back alignment and structure |
|---|
| >3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >2oa5_A Hypothetical protein BQLF2; MHR28B, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: PE5; 2.10A {Murid herpesvirus 4} SCOP: d.362.1.1 PDB: 2h3r_A* | Back alignment and structure |
|---|
| >2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 327 | |||
| d1sknp_ | 74 | Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | 91.31 | |
| d2oa5a1 | 96 | Uncharacterized protein BQLF2 {Murid herpesvirus 4 | 82.75 |
| >d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: A DNA-binding domain in eukaryotic transcription factors superfamily: A DNA-binding domain in eukaryotic transcription factors family: A DNA-binding domain in eukaryotic transcription factors domain: Skn-1 species: Caenorhabditis elegans [TaxId: 6239]
Probab=91.31 E-value=0.046 Score=40.55 Aligned_cols=28 Identities=25% Similarity=0.338 Sum_probs=24.1
Q ss_pred HHHHHHHHHHhhHHHHHHHHHHHHHHHH
Q 020381 232 DDKRARRMLSNRESARRSRRRKQAHLNE 259 (327)
Q Consensus 232 e~KR~RR~lsNRESArRSR~RKk~~l~e 259 (327)
-.+-.||.=+|+.+||++|+||....++
T Consensus 46 lirDIRRRGKNKvAAqnCRKRKld~~d~ 73 (74)
T d1sknp_ 46 LIRKIRRRGKNKVAARTCRQRRTDRHDK 73 (74)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred HHHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence 4677899999999999999999876654
|
| >d2oa5a1 d.362.1.1 (A:7-102) Uncharacterized protein BQLF2 {Murid herpesvirus 4 [TaxId: 33708]} | Back information, alignment and structure |
|---|