Citrus Sinensis ID: 020389


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------
MVSKIPNPAEGFYLDPNGMALPGLGPFASSATTPTAAAAAAGTSTVSTSEDPSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLPPPRPKRKAAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSPASKGPEVANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSINLTSPDFEDHRRLLSSYEIDPETANHSGTNNLLLGGGQ
cccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccccccccc
ccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccccccccccEEEcccc
mvskipnpaegfyldpngmalpglgpfassattptaaaaaagtstvstsedpskkirkpytitksreswtepehDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVqkngtaehlppprpkrkaahpypqkasknapmlsqvsgsfqsssaqlepghflrpdsssmlmipmasaatswtnnvqtvslspaskgpevannrsnstdstpkarvsgeltdqggeltdqgnnshplrvlpdfAQVYTFigsvfdpnasdhvqklkkmdpiDVETVLLLMRNLsinltspdfedHRRLLSsyeidpetanhsgtnnlllgggq
mvskipnpaEGFYLDPNGMALPGLGPFASSATTPTAAAAAagtstvstsedpskkirkpytitksreswtepehDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQkngtaehlppprpkrkaAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSpaskgpevannrsnstdstpkarvSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSInltspdfedHRRLLSsyeidpetanhsgtnnlllgggq
MVSKIPNPAEGFYLDPNGMALPGLGPFassattptaaaaaagtstvstsEDPSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLppprpkrkaahpypQKASKNAPMLsqvsgsfqsssaqLEPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSPASKGPEVANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSINLTSPDFEDHRRLLSSYEIDPETANHSGTNNLLLGGGQ
**************************************************************************DKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKV******************************************************************************************************************************LRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSINLTSPDF*******************************
************************************************************************EHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF****************************************************************************************************************************************AQVYTFIGSVFDPNAS***Q*LKKMDPIDVETVLLLMRNLSINLTSPDFEDHRRL*************************
MVSKIPNPAEGFYLDPNGMALPGLGPFASS************************KIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLP******************NAPMLSQ************EPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSP**************************LTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSINLTSPDFEDHRRLLSSYEIDPETANHSGTNNLLLGGGQ
****IPNPAEGFYL*PNGMALPG*******************************KIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGT*EHLP*******************************************************************************************************************PLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSINLTSPDFEDHRRLLSSYEID******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSKIPNPAEGFYLDPNGMALPGLGPFASSATTPTAAAAAAGTSTVSTSEDPSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLPPPRPKRKAAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMASAATSWTNNVQTVSLSPASKGPEVANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSINLTSPDFEDHRRLLSSYEIDPETANHSGTNNLLLGGGQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query327 2.2.26 [Sep-21-2011]
Q6R0H0287 Transcription factor ASG4 no no 0.844 0.961 0.523 1e-77
Q54IF9 423 Myb-like protein G OS=Dic yes no 0.730 0.565 0.404 2e-46
Q6R0H1 645 Protein LHY OS=Arabidopsi no no 0.333 0.168 0.470 3e-22
P92973 608 Protein CCA1 OS=Arabidops no no 0.235 0.126 0.584 5e-21
Q54Z40 1217 Myb-like protein H OS=Dic no no 0.159 0.042 0.518 5e-11
Q869R9734 Myb-like protein J OS=Dic no no 0.155 0.069 0.442 7e-08
Q5VVJ2 828 Histone H2A deubiquitinas yes no 0.189 0.074 0.393 5e-06
Q5RGA4 822 Histone H2A deubiquitinas yes no 0.174 0.069 0.379 6e-06
Q54HX6 977 Myb-like protein I OS=Dic no no 0.162 0.054 0.388 7e-06
Q5F3F2 832 Histone H2A deubiquitinas yes no 0.162 0.063 0.415 2e-05
>sp|Q6R0H0|ASG4_ARATH Transcription factor ASG4 OS=Arabidopsis thaliana GN=ASG4 PE=2 SV=1 Back     alignment and function desciption
 Score =  290 bits (742), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 203/304 (66%), Gaps = 28/304 (9%)

Query: 7   NPAEGFYLDPNGMALPGLGPFASSATTPTAAAAAAGTSTVSTSEDPSKKIRKPYTITKSR 66
           NP++   L P  M+LPG      +ATT     +     T+S  EDP+KK+RKPYTITKSR
Sbjct: 5   NPSQAHCL-PMKMSLPGFNTLPHTATT--IPVSIRSNRTMSFFEDPTKKVRKPYTITKSR 61

Query: 67  ESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEHLPPP 126
           E+WTE EHDKFLEAL LFDRDWKKI+AF+GSKTVIQIRSHAQKYFLKVQKNGT EHLPPP
Sbjct: 62  ENWTEQEHDKFLEALHLFDRDWKKIKAFVGSKTVIQIRSHAQKYFLKVQKNGTKEHLPPP 121

Query: 127 RPKRKAAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMASAATSW 186
           RPKRKA HPYPQKA K          +  SS+A  +  +    +S  ++       +T+ 
Sbjct: 122 RPKRKANHPYPQKAPK---------FTLSSSNALFQHDYLYNTNSHPVI-------STTR 165

Query: 187 TNNVQTVSLS-PASKGPE---VANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSHPLR 242
            + +    +S P+S   E   V+ N  +++ S  K R     T    E  DQ +   P R
Sbjct: 166 KHGLVHCDVSIPSSVIKEEFGVSENCCSTSSSRDKQR-----TRIVTETNDQESCGKPHR 220

Query: 243 VLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSINLTSPDFEDHRRL 302
           V P+FA+VY FIGSVFDP  + HV++LK+MDPI++ETVLLLM+NLS+NLTSP+F++ R+L
Sbjct: 221 VAPNFAEVYNFIGSVFDPKTTGHVKRLKEMDPINLETVLLLMKNLSVNLTSPEFDEQRKL 280

Query: 303 LSSY 306
           +SSY
Sbjct: 281 ISSY 284




Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q54IF9|MYBG_DICDI Myb-like protein G OS=Dictyostelium discoideum GN=mybG PE=3 SV=1 Back     alignment and function description
>sp|Q6R0H1|LHY_ARATH Protein LHY OS=Arabidopsis thaliana GN=LHY PE=1 SV=2 Back     alignment and function description
>sp|P92973|CCA1_ARATH Protein CCA1 OS=Arabidopsis thaliana GN=CCA1 PE=1 SV=1 Back     alignment and function description
>sp|Q54Z40|MYBH_DICDI Myb-like protein H OS=Dictyostelium discoideum GN=mybH PE=3 SV=1 Back     alignment and function description
>sp|Q869R9|MYBJ_DICDI Myb-like protein J OS=Dictyostelium discoideum GN=mybJ PE=3 SV=1 Back     alignment and function description
>sp|Q5VVJ2|MYSM1_HUMAN Histone H2A deubiquitinase MYSM1 OS=Homo sapiens GN=MYSM1 PE=1 SV=1 Back     alignment and function description
>sp|Q5RGA4|MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio GN=mysm1 PE=2 SV=2 Back     alignment and function description
>sp|Q54HX6|MYBI_DICDI Myb-like protein I OS=Dictyostelium discoideum GN=mybI PE=3 SV=1 Back     alignment and function description
>sp|Q5F3F2|MYSM1_CHICK Histone H2A deubiquitinase MYSM1 OS=Gallus gallus GN=MYSM1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
255545170318 DNA binding protein, putative [Ricinus c 0.929 0.955 0.749 1e-125
359490474337 PREDICTED: transcription factor ASG4-lik 0.941 0.913 0.689 1e-119
295883125324 putative MYB transcription factor [Rosa 0.935 0.944 0.728 1e-118
358248018301 uncharacterized protein LOC100783949 [Gl 0.886 0.963 0.713 1e-118
224079756317 predicted protein [Populus trichocarpa] 0.932 0.962 0.715 1e-118
356576006304 PREDICTED: transcription factor ASG4 [Gl 0.920 0.990 0.682 1e-116
356534101314 PREDICTED: LOW QUALITY PROTEIN: transcri 0.926 0.964 0.656 1e-115
388501910306 unknown [Lotus japonicus] 0.880 0.941 0.690 1e-115
449456325311 PREDICTED: transcription factor ASG4-lik 0.886 0.932 0.694 1e-114
351722518302 MYB transcription factor MYB136 [Glycine 0.902 0.976 0.688 1e-113
>gi|255545170|ref|XP_002513646.1| DNA binding protein, putative [Ricinus communis] gi|223547554|gb|EEF49049.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  452 bits (1164), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 239/319 (74%), Positives = 258/319 (80%), Gaps = 15/319 (4%)

Query: 1   MVSKIPNPAEGFYLDPNGMALPGLGPFASSATTPTAAAAAAGTSTVSTSEDPSKKIRKPY 60
           MVSK PNP EGFYLDPNGMALPGLGPFA         A    TST S+SEDPSKKIRKPY
Sbjct: 1   MVSKNPNPPEGFYLDPNGMALPGLGPFA-------TTAPTTTTSTTSSSEDPSKKIRKPY 53

Query: 61  TITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTA 120
           TITKSRESWTEPEHDKFLEALQLFDRDWKKIEAF+GSKTVIQIRSHAQKYFLKVQK+G  
Sbjct: 54  TITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFVGSKTVIQIRSHAQKYFLKVQKSGAN 113

Query: 121 EHLPPPRPKRKAAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMA 180
           EHLPPPRPKRKAAHPYPQKASKNA ML Q S SFQSSSA LEPG+  RPDSSSM   P+ 
Sbjct: 114 EHLPPPRPKRKAAHPYPQKASKNAQMLLQPSVSFQSSSALLEPGYIRRPDSSSMPTNPIT 173

Query: 181 S-AATSWTNNVQTVSLSPASKGPEVANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSH 239
           S AA SWTNN+  VS S  +KGP V NN  +ST+STP+       T   GE  + GN+SH
Sbjct: 174 SAAAASWTNNLPAVSFSNQAKGPIVTNNCCSSTESTPR-------TKPIGETAELGNHSH 226

Query: 240 PLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSINLTSPDFEDH 299
           PLRVLPDF QVY+FIGSVFDPNA+ H+Q+LKKMDPIDVETVLLLMRNLS+NLTS DFEDH
Sbjct: 227 PLRVLPDFVQVYSFIGSVFDPNATGHLQRLKKMDPIDVETVLLLMRNLSVNLTSSDFEDH 286

Query: 300 RRLLSSYEIDPETANHSGT 318
           R+LLSSYEID E A  + T
Sbjct: 287 RKLLSSYEIDTEAAGANKT 305




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359490474|ref|XP_002273319.2| PREDICTED: transcription factor ASG4-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|295883125|gb|ADG56764.1| putative MYB transcription factor [Rosa rugosa] Back     alignment and taxonomy information
>gi|358248018|ref|NP_001240048.1| uncharacterized protein LOC100783949 [Glycine max] gi|255634506|gb|ACU17617.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224079756|ref|XP_002305938.1| predicted protein [Populus trichocarpa] gi|222848902|gb|EEE86449.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356576006|ref|XP_003556126.1| PREDICTED: transcription factor ASG4 [Glycine max] Back     alignment and taxonomy information
>gi|356534101|ref|XP_003535596.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ASG4-like [Glycine max] Back     alignment and taxonomy information
>gi|388501910|gb|AFK39021.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|449456325|ref|XP_004145900.1| PREDICTED: transcription factor ASG4-like [Cucumis sativus] gi|449497272|ref|XP_004160358.1| PREDICTED: transcription factor ASG4-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|351722518|ref|NP_001235967.1| MYB transcription factor MYB136 [Glycine max] gi|110931718|gb|ABH02858.1| MYB transcription factor MYB136 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query327
TAIR|locus:2149589331 AT5G52660 [Arabidopsis thalian 0.948 0.936 0.580 4.1e-88
TAIR|locus:2124928303 AT4G01280 [Arabidopsis thalian 0.889 0.960 0.477 3.8e-62
TAIR|locus:2025411287 ASG4 "ALTERED SEED GERMINATION 0.348 0.397 0.632 1.3e-59
TAIR|locus:2075049298 RVE8 "REVEILLE 8" [Arabidopsis 0.764 0.838 0.519 1.4e-57
TAIR|locus:2151251293 LCL1 "LHY/CCA1-like 1" [Arabid 0.740 0.825 0.512 4.3e-54
DICTYBASE|DDB_G0288783 423 mybG "myb domain-containing pr 0.217 0.167 0.774 8.3e-39
TAIR|locus:2044345 608 CCA1 "circadian clock associat 0.220 0.118 0.597 3e-21
TAIR|locus:2167210387 RVE1 "REVEILLE 1" [Arabidopsis 0.211 0.178 0.608 1.1e-19
TAIR|locus:2169135287 RVE2 "REVEILLE 2" [Arabidopsis 0.192 0.219 0.634 2.5e-19
TAIR|locus:504955668336 AT3G10113 [Arabidopsis thalian 0.183 0.178 0.616 1.4e-18
TAIR|locus:2149589 AT5G52660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 880 (314.8 bits), Expect = 4.1e-88, P = 4.1e-88
 Identities = 194/334 (58%), Positives = 218/334 (65%)

Query:     1 MVSKIPNPAEGFYLDPNGMALPGLGP-FXXXXXXXXXXXXXXXXXX--------XXXXED 51
             MVS+  N ++G++LDP GM +PGLGP F                              ED
Sbjct:     1 MVSR--N-SDGYFLDPTGMTVPGLGPSFTAAVSSSSSPTTSSTAVAVADVTAMVSSSEED 57

Query:    52 PSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF 111
              SKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF
Sbjct:    58 LSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF 117

Query:   112 LKVQKNGTAEHLXXXXXXXXXXXXXXQKASKNAPMLXXXXXXXXXXXXXLEPGHFLRPDS 171
             LKVQK+GT EHL              QKA KN  +               +P    RP+S
Sbjct:   118 LKVQKSGTGEHLPPPRPKRKAAHPYPQKAHKNVQLQVPGSFKSTSEPN--DPSFMFRPES 175

Query:   172 SSMLMI-PMASAATSWTNNVQTVSLSPASKGPEVANNR-SNSTDSTPKARVSGELTDQGG 229
             SSMLM  P  +AA  WTNN QT+S +P  K    ANN  S+S+++TP+ R          
Sbjct:   176 SSMLMTSPTTAAAAPWTNNAQTISFTPLPKAGAGANNNCSSSSENTPRPR-------SNR 228

Query:   230 ELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSI 289
             +  D GN  H LRVLPDFAQVY FIGSVFDP AS+H+QKLKKMDPIDVETVLLLMRNLSI
Sbjct:   229 DARDHGNVGHSLRVLPDFAQVYGFIGSVFDPYASNHLQKLKKMDPIDVETVLLLMRNLSI 288

Query:   290 NLTSPDFEDHRRLLSSYEIDPETA-NHSGTNNLL 322
             NL+SPDFEDHRRLLSSY+I  ETA +H G N  L
Sbjct:   289 NLSSPDFEDHRRLLSSYDIGSETATDHGGVNKTL 322




GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0009651 "response to salt stress" evidence=IEP
GO:0009723 "response to ethylene stimulus" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0009739 "response to gibberellin stimulus" evidence=IEP
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009753 "response to jasmonic acid stimulus" evidence=IEP
GO:0046686 "response to cadmium ion" evidence=IEP
TAIR|locus:2124928 AT4G01280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025411 ASG4 "ALTERED SEED GERMINATION 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075049 RVE8 "REVEILLE 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2151251 LCL1 "LHY/CCA1-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288783 mybG "myb domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2044345 CCA1 "circadian clock associated 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167210 RVE1 "REVEILLE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169135 RVE2 "REVEILLE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504955668 AT3G10113 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
TIGR0155757 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai 3e-16
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 6e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-08
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 6e-08
>gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
 Score = 71.7 bits (176), Expect = 3e-16
 Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 6/57 (10%)

Query: 64  KSRESWTEPEHDKFLEALQLFDR-DW---KKI-EAFIGSK-TVIQIRSHAQKYFLKV 114
           K R  WTE  HD+FL+A+Q     DW   K+I E  +    T  Q+ SH QKY LK 
Sbjct: 1   KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57


This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57

>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 327
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 99.61
KOG0724335 consensus Zuotin and related molecular chaperones 99.48
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.45
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.12
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.1
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 99.01
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.95
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.93
KOG1279506 consensus Chromatin remodeling factor subunit and 98.71
PLN03212249 Transcription repressor MYB5; Provisional 98.49
PLN03212249 Transcription repressor MYB5; Provisional 98.49
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 98.37
PLN03091 459 hypothetical protein; Provisional 98.36
PLN03091 459 hypothetical protein; Provisional 98.33
KOG0048238 consensus Transcription factor, Myb superfamily [T 98.19
KOG0048238 consensus Transcription factor, Myb superfamily [T 97.59
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.29
PLN03162526 golden-2 like transcription factor; Provisional 96.88
KOG4329445 consensus DNA-binding protein [General function pr 96.79
KOG4468 782 consensus Polycomb-group transcriptional regulator 96.65
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.97
KOG0051607 consensus RNA polymerase I termination factor, Myb 95.58
KOG0724335 consensus Zuotin and related molecular chaperones 95.22
KOG0049 939 consensus Transcription factor, Myb superfamily [T 95.16
KOG0051607 consensus RNA polymerase I termination factor, Myb 94.84
PLN031421033 Probable chromatin-remodeling complex ATPase chain 94.56
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 94.19
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 94.09
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 93.75
KOG4167907 consensus Predicted DNA-binding protein, contains 93.67
KOG1194534 consensus Predicted DNA-binding protein, contains 93.61
KOG3841455 consensus TEF-1 and related transcription factor, 93.57
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 91.57
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 91.31
smart0042668 TEA TEA domain. 88.25
COG5147 512 REB1 Myb superfamily proteins, including transcrip 86.94
COG5147 512 REB1 Myb superfamily proteins, including transcrip 86.59
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 84.89
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 82.96
PF01285 431 TEA: TEA/ATTS domain family; InterPro: IPR000818 T 81.53
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
Probab=99.61  E-value=8.1e-16  Score=115.40  Aligned_cols=50  Identities=48%  Similarity=0.716  Sum_probs=46.0

Q ss_pred             cCCCCCCHHHHHHHHHHHHHcCc-ch---HhHHhhcC-CC-CHHHHHHHHHHHHHH
Q 020389           64 KSRESWTEPEHDKFLEALQLFDR-DW---KKIEAFIG-SK-TVIQIRSHAQKYFLK  113 (327)
Q Consensus        64 k~r~~WT~EEh~lFLeaLe~yGr-dW---kkIA~~Vg-TR-T~~QVrSHAQKYf~k  113 (327)
                      |.|..||+|||.+||+||+.||+ +|   ++|+++++ ++ |..||+||+||||++
T Consensus         1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k   56 (57)
T TIGR01557         1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLK   56 (57)
T ss_pred             CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHcc
Confidence            46789999999999999999998 99   99998765 67 999999999999986



This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif.

>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03162 golden-2 like transcription factor; Provisional Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
2cu7_A72 Solution Structure Of The Sant Domain Of Human Kiaa 4e-06
>pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 Back     alignment and structure

Iteration: 1

Score = 48.9 bits (115), Expect = 4e-06, Method: Composition-based stats. Identities = 22/50 (44%), Positives = 31/50 (62%) Query: 69 WTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNG 118 WT E + F + L F R W KI IGS+TV+Q++S+A++YF K G Sbjct: 12 WTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCG 61

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query327
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 3e-26
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 4e-20
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 2e-19
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 4e-15
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 4e-13
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 8e-13
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 2e-10
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 3e-09
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 3e-09
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 7e-07
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-06
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 8e-06
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 2e-05
2cjj_A93 Radialis; plant development, DNA-binding protein, 2e-04
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
 Score = 98.3 bits (245), Expect = 3e-26
 Identities = 23/65 (35%), Positives = 35/65 (53%)

Query: 63  TKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEH 122
           +     WT  E + F + L  F R W KI   IGS+TV+Q++S+A++YF    K G  + 
Sbjct: 6   SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKE 65

Query: 123 LPPPR 127
            P  +
Sbjct: 66  TPNQK 70


>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.64
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.62
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.58
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.46
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.46
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.44
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 99.33
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.33
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.31
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.29
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.29
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.27
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.26
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.24
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 98.86
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.19
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.18
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.17
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.16
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.11
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 99.11
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.09
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.08
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.02
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.0
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.0
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.98
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.97
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.97
2crg_A70 Metastasis associated protein MTA3; transcription 98.94
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.92
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.88
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.88
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 98.86
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.86
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.78
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.77
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 98.73
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.71
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 98.68
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 98.64
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 98.64
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 98.62
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.62
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 98.29
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.5
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.5
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 97.16
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.14
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 97.14
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 96.33
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 96.09
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.94
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 95.9
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 95.82
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 94.49
1ig6_A107 MRF-2, modulator recognition factor 2; DNA binding 92.47
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 91.47
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 87.09
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 86.93
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 84.69
2cxy_A125 BAF250B subunit, HBAF250B; DNA-binding domain, str 80.22
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 80.13
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
Probab=99.64  E-value=1.6e-16  Score=124.28  Aligned_cols=60  Identities=27%  Similarity=0.385  Sum_probs=56.2

Q ss_pred             CCCCCCCCcccccCCCCCCHHHHHHHHHHHHHcCcchHhHHhhcCCCCHHHHHHHHHHHH
Q 020389           52 PSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF  111 (327)
Q Consensus        52 ~~kk~rkPyt~tk~r~~WT~EEh~lFLeaLe~yGrdWkkIA~~VgTRT~~QVrSHAQKYf  111 (327)
                      ..++.++++.....+..||+||+++||+||++||++|++||++|++||..||+.||++|+
T Consensus         4 g~~~~~~~~~~~~~~~~WT~eEd~~Ll~~v~~~G~~W~~IA~~v~~RT~~qcr~r~~~~~   63 (79)
T 2yus_A            4 GSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLP   63 (79)
T ss_dssp             SSSCCCCCCCSSCCSCCCCHHHHHHHHHHHHHSSSCHHHHHHHHSSCCHHHHHHHHTTSC
T ss_pred             cccCccCCccccccCCCcCHHHHHHHHHHHHHhCCCHHHHHHHcCCCCHHHHHHHHHHhc
Confidence            467888999999999999999999999999999999999999999999999999998763



>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cxy_A BAF250B subunit, HBAF250B; DNA-binding domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Homo sapiens} PDB: 2eh9_A 1ryu_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 327
d1irza_64 a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th 2e-14
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-13
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 1e-12
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-12
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 3e-11
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 1e-08
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 3e-06
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 3e-04
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 4e-04
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.002
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: GARP response regulators
domain: Arr10-B
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 65.3 bits (159), Expect = 2e-14
 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 5/58 (8%)

Query: 64  KSRESWTEPEHDKFLEALQLFDRDWKKIEA-----FIGSKTVIQIRSHAQKYFLKVQK 116
           K R  WT   H+KFL A+     +    +       +   T   + SH QK+ + ++K
Sbjct: 5   KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKK 62


>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query327
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.56
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 99.52
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.5
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.38
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.35
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.32
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.3
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.26
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.21
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.17
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.1
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.99
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.91
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 98.82
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.54
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 98.46
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.44
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 97.94
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 97.06
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 93.55
d1ig6a_107 MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta 87.11
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 81.39
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 81.04
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: MYSM1 (KIAA1915)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.56  E-value=3.5e-15  Score=109.37  Aligned_cols=53  Identities=42%  Similarity=0.720  Sum_probs=49.7

Q ss_pred             CCCCHHHHHHHHHHHHHcCcchHhHHhhcCCCCHHHHHHHHHHHHHHHhhcCC
Q 020389           67 ESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGT  119 (327)
Q Consensus        67 ~~WT~EEh~lFLeaLe~yGrdWkkIA~~VgTRT~~QVrSHAQKYf~kl~k~g~  119 (327)
                      ..||.||+.+|+++|++||++|..||.+|++||..||++||++|+.+..+.+.
T Consensus         3 ~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~ry~~~~~~~~k~~~   55 (65)
T d2cu7a1           3 VKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGL   55 (65)
T ss_dssp             CCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHHSCSCT
T ss_pred             CCCCHHHHHHHHHHHHHhcchHHHHHHHcCCCCHHHHHHHHHHHHHHHHhcCC
Confidence            57999999999999999999999999999999999999999999999876553



>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure