Citrus Sinensis ID: 020465

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320------
METSMKMMSIRPSSSISSVDSINEEEPRPPHEALFLALAYLPLFELLAMSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHLKLNSSRQNEQKRQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVFDCSKQLCKGKPPARCCRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCNLCNKPYCRQHANLGSNSSCSSGFICDICQYQNQKCYSEEFLN
ccccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHcccccEEEccccccccHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHccccccHHHHHHccccEEccccccccccccccccEEEEcccccccccccccccccccccccccccccccccEEccccccccccccccccHHHHHHHHHcHHHHccccccccccHHHHHHHccccccccccccEEccHHHHHHcccccccccc
ccHHHHHccccccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHcccccHcccccHHHHHHHHHHcccccEEEEEcccHHccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHccccccccHHcccccEEcccccEEEEcccccccEEEEEEcccccccEEEEcccccHcccccccHHccEEEEEHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHccHccccccccccEEEccEEEcccccccHHHcc
metsmkmmsirpsssissvdsineeeprpphEALFLALAYLPLFELLAMSVVCLSLRDavnkdilpwlniivdrplnrrlsDEILMKITSKANGRLTTLALINCVRITNAGLQRVieknpfikklyipgctglspqGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHLklnssrqneqkrqpilyhkarhypvlvnrendhsidveicpscsevrmvfdcskqlckgkpparccrgcyhciprcaecggciqpeemedavcndmlcsdcwlqlpkcnlcnkpycrqhanlgsnsscssgficdicqyqnqkcyseefln
metsmkmmsirpsssissvdsiNEEEPRPPHEALFLALAYLPLFELLAMSVVCLSLRDavnkdilpwlniivdrplnrrlSDEILMKItskangrlttLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHlklnssrqneqKRQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVFDCSKQLCKGKPPARCCRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCNLCNKPYCRQHANLGSNSSCSSGFICDICQYQNQKCYSEEFLN
METsmkmmsirpsssissvdsiNEEEPRPPHealflalaylplfellaMSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHLKLNSSRQNEQKRQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVFDCSKQLCKGKPPARCCRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCNLCNKPYCRQHANLGSNSSCSSGFICDICQYQNQKCYSEEFLN
********************************ALFLALAYLPLFELLAMSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSH***************ILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVFDCSKQLCKGKPPARCCRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCNLCNKPYCRQHANLGSNSSCSSGFICDICQYQNQKCY******
**************************PRPPHEALFLALAYLPLFELLAMSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHLKLNS******KRQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVFDCSKQLCKGKPPARCCRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCNLCNKPYCRQHA********S*GFICDICQYQNQKC****FL*
****************************PPHEALFLALAYLPLFELLAMSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHLKL*********RQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVFDCSKQLCKGKPPARCCRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCNLCNKPYCRQHANLGSNSSCSSGFICDICQYQNQKCYSEEFLN
***************************RPPHEALFLALAYLPLFELLAMSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHLKLNSSRQNEQKRQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVFDCSKQLCKGKPPARCCRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCNLCNKPYCRQHANLGSNSSCSSGFICDICQYQNQKCYS*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METSMKMMSIRPSSSISSVDSINEEEPRPPHEALFLALAYLPLFELLAMSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHLKLNSSRQNEQKRQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVFDCSKQLCKGKPPARCCRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCNLCNKPYCRQHANLGSNSSCSSGFICDICQYQNQKCYSEEFLN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query326 2.2.26 [Sep-21-2011]
Q9ZU90292 F-box protein SKIP28 OS=A yes no 0.788 0.880 0.419 5e-62
Q9LU91453 F-box protein SKIP14 OS=A no no 0.791 0.569 0.349 7e-39
Q9LK24382 F-box protein At3g27290 O no no 0.687 0.586 0.388 1e-33
>sp|Q9ZU90|SKI28_ARATH F-box protein SKIP28 OS=Arabidopsis thaliana GN=SKIP28 PE=1 SV=1 Back     alignment and function desciption
 Score =  238 bits (607), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 125/298 (41%), Positives = 181/298 (60%), Gaps = 41/298 (13%)

Query: 28  RPPHEALFLALAYL-PLFELLAMSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILM 86
           R  HE L + L YL  LFELL+M  V  SLRDA+  +   W  ++++ PL+ RL+D+IL 
Sbjct: 14  RSVHEVLLIVLPYLHSLFELLSMIRVSRSLRDAIRDETALWTKLVIEPPLSSRLTDDILS 73

Query: 87  KITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLS 146
           + +SK+ G+L TL L  C+ +TN GL+RV++ NP I K+ +PGC+GL+P+G++E VE LS
Sbjct: 74  EFSSKSAGKLKTLILRQCLMVTNKGLRRVVDANPLITKIIVPGCSGLTPEGIMECVESLS 133

Query: 147 ENDHTLEILHISGVYNITKEHLRTLHSHLKLNSSRQNEQKRQPILYHKARHYPVLVNREN 206
           +N+H LE LHI+GV   TK+HL  L+++L                              +
Sbjct: 134 KNNHKLETLHINGVNGFTKQHLSALYTYLS-----------------------------S 164

Query: 207 DHSIDVEICPSCSEVRMVFDCSKQLCKGKPPARCCRGCYHCIPRCAECGGCI--QPEEME 264
           + +ID+E+CP C EVRM+  CS++ C  K   R CRGC+ CIPRCAEC  C+     E +
Sbjct: 165 EGTIDLEVCPKCDEVRMIPSCSRESCNQK--QRKCRGCWLCIPRCAECAVCLVGSDTESQ 222

Query: 265 DAVC--NDMLCSDCWLQLPKCNLCNKPYC-----RQHANLGSNSSCSSGFICDICQYQ 315
           +A C  +D+LC +CWL LPKC  CNKPYC     R+H    ++++    F C+ C Y+
Sbjct: 223 EAACGNDDVLCLECWLVLPKCRFCNKPYCTNHSSRRHEIAITDAASRPSFECEACYYR 280
Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity). Required during the endosperm development in embryos.
Arabidopsis thaliana (taxid: 3702)
>sp|Q9LU91|SKI14_ARATH F-box protein SKIP14 OS=Arabidopsis thaliana GN=SKIP14 PE=1 SV=1 Back     alignment and function description
>sp|Q9LK24|FB327_ARATH F-box protein At3g27290 OS=Arabidopsis thaliana GN=At3g27290 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
255573704332 conserved hypothetical protein [Ricinus 0.953 0.936 0.556 1e-94
225424337338 PREDICTED: F-box protein SKIP28-like [Vi 0.950 0.917 0.571 3e-91
357521249320 F-box protein SKIP28 [Medicago truncatul 0.929 0.946 0.534 4e-89
388507158322 unknown [Lotus japonicus] 0.944 0.956 0.543 6e-88
388496774299 unknown [Lotus japonicus] 0.914 0.996 0.552 2e-87
356527827313 PREDICTED: LOW QUALITY PROTEIN: F-box pr 0.901 0.939 0.526 2e-85
449464814336 PREDICTED: F-box protein SKIP28-like [Cu 0.874 0.848 0.530 3e-85
224111462306 predicted protein [Populus trichocarpa] 0.837 0.892 0.547 5e-85
449532167370 PREDICTED: F-box protein SKIP28-like, pa 0.831 0.732 0.536 7e-82
358248760278 uncharacterized protein LOC100806504 [Gl 0.806 0.946 0.560 2e-79
>gi|255573704|ref|XP_002527773.1| conserved hypothetical protein [Ricinus communis] gi|223532808|gb|EEF34583.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  352 bits (904), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 178/320 (55%), Positives = 231/320 (72%), Gaps = 9/320 (2%)

Query: 4   SMKMMSIRPS----SSISSVDSINEEEPRPPHEALFLALAYLPLFELLAMSVVCLSLRDA 59
           S++ +SI P      S  +  +  + EP PPHEALFL LAYLP+FELL MS VC+SLRDA
Sbjct: 15  SLRTLSILPRLESHPSFQNESANQQAEPGPPHEALFLVLAYLPVFELLNMSEVCMSLRDA 74

Query: 60  VNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKN 119
           VN+D+LPWL IIVDRPL+ RLSDEILMKI SKAN RL TL L NC +IT+ GL++VIEKN
Sbjct: 75  VNRDLLPWLTIIVDRPLSSRLSDEILMKIASKANCRLRTLILRNCTKITDDGLEKVIEKN 134

Query: 120 PFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHLKLNS 179
           P+I KL++P CTGL+P+G+I+AV+ LS++ ++L+ L I+G+YN+ K+HL TL+S+L++N 
Sbjct: 135 PYINKLHLPACTGLTPEGIIKAVKILSQHPNSLKSLQINGIYNLKKQHLETLYSYLQMNP 194

Query: 180 SRQNEQKRQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVFDCSKQLCKGKPPAR 239
           S   + K Q ILYH  R  P   + E+   +DV+ICP C+EV++VFDCS++ C  K    
Sbjct: 195 S---QHKPQHILYHIYRISPSSRSTESGRIVDVDICPQCNEVQIVFDCSRETCMQKRDRL 251

Query: 240 C--CRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCNLCNKPYCRQHANL 297
              CRGC  CI RC ECGGCI  EE EDA C D+LCSDCWL L KCN CNKPYC++H N 
Sbjct: 252 VADCRGCNFCISRCEECGGCIDAEEQEDAACADILCSDCWLCLSKCNYCNKPYCKRHTNQ 311

Query: 298 GSNSSCSSGFICDICQYQNQ 317
             +S    GFIC+ C   ++
Sbjct: 312 QFSSPGFCGFICEACHMTSE 331

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225424337|ref|XP_002284829.1| PREDICTED: F-box protein SKIP28-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|357521249|ref|XP_003630913.1| F-box protein SKIP28 [Medicago truncatula] gi|355524935|gb|AET05389.1| F-box protein SKIP28 [Medicago truncatula] Back     alignment and taxonomy information
>gi|388507158|gb|AFK41645.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|388496774|gb|AFK36453.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356527827|ref|XP_003532508.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein SKIP28-like [Glycine max] Back     alignment and taxonomy information
>gi|449464814|ref|XP_004150124.1| PREDICTED: F-box protein SKIP28-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|224111462|ref|XP_002315864.1| predicted protein [Populus trichocarpa] gi|222864904|gb|EEF02035.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449532167|ref|XP_004173054.1| PREDICTED: F-box protein SKIP28-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|358248760|ref|NP_001240191.1| uncharacterized protein LOC100806504 [Glycine max] gi|255635560|gb|ACU18130.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query326
TAIR|locus:2092145453 AT3G26000 "AT3G26000" [Arabido 0.708 0.509 0.348 2.9e-39
TAIR|locus:2065418292 MEE11 "maternal effect embryo 0.610 0.681 0.353 6.9e-31
TAIR|locus:2086548382 AT3G27290 "AT3G27290" [Arabido 0.684 0.583 0.363 7.9e-30
RGD|1597772193 LOC685110 "hypothetical protei 0.263 0.445 0.288 0.00069
TAIR|locus:2092145 AT3G26000 "AT3G26000" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 419 (152.6 bits), Expect = 2.9e-39, P = 2.9e-39
 Identities = 84/241 (34%), Positives = 139/241 (57%)

Query:    49 MSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVRIT 108
             +S+VC SL   V  D L W +I + RPLN ++++E L+ +T +A G +  L +++C RIT
Sbjct:   219 VSMVCKSLHTTVCDDTLLWKHIHICRPLNEKITEEALLHLTERAQGTMQCLRIVDCCRIT 278

Query:   109 NAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHIS--GVYNITKE 166
             +  L+RV+ +N  + K+ +PGCT ++  G++  +  L ++   L++ H+   G++ +TK+
Sbjct:   279 DDCLKRVVARNRQVVKIGVPGCTRITIDGILSVLRDL-KSAGKLQVKHLQLRGLFGVTKD 337

Query:   167 HLRTLHSHLKL-NSSRQNEQKRQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRMVF 225
             H   L   L + N  +Q  QK  P  YH+       V+ ++D ++D+E+CP C   ++V+
Sbjct:   338 HYDELIDLLNIDNKVKQTIQK--PRFYHRGE---ACVSCDDDRALDIEMCPKCQNFKLVY 392

Query:   226 DCSKQLCKGKPP-ARCCRGCYHCIPRCAECGGCIQPEEMEDAVCNDMLCSDCWLQLPKCN 284
             DC  + CKGK   +  CR C  CI RC  CG CI   E E+  C ++LC+ C    PK  
Sbjct:   393 DCPAEDCKGKKKGSEECRACSLCIQRCYHCGRCIIDTEYEEMFCLELLCAVCSKPTPKLT 452

Query:   285 L 285
             L
Sbjct:   453 L 453
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2065418 MEE11 "maternal effect embryo arrest 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2086548 AT3G27290 "AT3G27290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1597772 LOC685110 "hypothetical protein LOC685110" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00030569001
SubName- Full=Chromosome chr1 scaffold_5, whole genome shotgun sequence; (309 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
COG2358321 COG2358, Imp, TRAP-type uncharacterized transport 6e-04
>gnl|CDD|225233 COG2358, Imp, TRAP-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information 
 Score = 40.8 bits (96), Expect = 6e-04
 Identities = 30/110 (27%), Positives = 41/110 (37%), Gaps = 19/110 (17%)

Query: 96  LTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEIL 155
           L T   I  V I+   + ++ EK P+  K  IP  T       I  V           IL
Sbjct: 204 LATTCDIVLVPISGEEIDKLEEKYPYYAKATIPAGTYPGIDEDIPTVA-------VAAIL 256

Query: 156 HIS------GVYNITK---EH---LRTLHSHLKLNSSRQNEQKRQPILYH 193
             S       VY +TK   E+   L+TLH  L+     +N +    I  H
Sbjct: 257 VTSDDVSEDLVYKLTKALFENLDELKTLHPALEDLKELENAKSGLVIPLH 306

Length = 321

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 326
KOG4341 483 consensus F-box protein containing LRR [General fu 99.85
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.84
KOG4341483 consensus F-box protein containing LRR [General fu 99.53
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.39
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 99.16
KOG1947482 consensus Leucine rich repeat proteins, some prote 99.04
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.58
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.44
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.28
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.17
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.16
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.85
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 97.54
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 97.37
KOG3864221 consensus Uncharacterized conserved protein [Funct 97.36
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.13
KOG2997366 consensus F-box protein FBX9 [General function pre 96.96
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 96.62
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 96.43
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.01
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 95.68
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 95.41
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 95.01
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.56
PLN03210 1153 Resistant to P. syringae 6; Provisional 94.35
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 94.18
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 93.52
KOG0274 537 consensus Cdc4 and related F-box and WD-40 protein 92.6
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 92.12
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 90.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 90.58
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 90.57
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 90.39
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 90.11
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 89.71
PF0668941 zf-C4_ClpX: ClpX C4-type zinc finger; InterPro: IP 89.59
PLN03210 1153 Resistant to P. syringae 6; Provisional 88.55
KOG4308478 consensus LRR-containing protein [Function unknown 86.11
PF1463444 zf-RING_5: zinc-RING finger domain 84.52
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 84.38
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 83.55
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 83.45
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 82.34
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 82.3
KOG4308 478 consensus LRR-containing protein [Function unknown 82.13
PF13013109 F-box-like_2: F-box-like domain 80.15
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information 
Probab=99.85  E-value=4.3e-22  Score=194.18  Aligned_cols=183  Identities=16%  Similarity=0.191  Sum_probs=135.4

Q ss_pred             CCCCHHHHHHHHccCChHHHHHHhhcCHHhhhhhccCCCCceeeeecCCCCCCCCHHHHHHHHhhcCCCccEEecCCCCC
Q 020465           27 PRPPHEALFLALAYLPLFELLAMSVVCLSLRDAVNKDILPWLNIIVDRPLNRRLSDEILMKITSKANGRLTTLALINCVR  106 (326)
Q Consensus        27 ~~LP~E~Ll~IfsyL~~~dLl~~s~VCr~Wr~lv~~dp~LW~~ldL~~~l~~~itD~~L~~l~~~~~~~L~~L~Ls~C~~  106 (326)
                      ..||+|++++||+||+.+.++++++||+.|+.. +.|..-|++||+... .+.+....+..+++++++.|+.|+|.||..
T Consensus        73 ~~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~-AlD~~~~q~idL~t~-~rDv~g~VV~~~~~Rcgg~lk~LSlrG~r~  150 (483)
T KOG4341|consen   73 RSLPPELLLKVFSMLDTKSLCRAAQCCTMWNKL-ALDGSCWQHIDLFTF-QRDVDGGVVENMISRCGGFLKELSLRGCRA  150 (483)
T ss_pred             ccCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhh-hhccccceeeehhcc-hhcCCCcceehHhhhhcccccccccccccc
Confidence            469999999999999999999999999999999 899999999999621 122334455666666667777777777777


Q ss_pred             CCHHHHHHHHHhCCCccEEEeCCCCCCCHHHHHHHHHHHHhcCCCCCeeeccCccccchHHHHHHHHhcccCcchhhhhc
Q 020465          107 ITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISGVYNITKEHLRTLHSHLKLNSSRQNEQK  186 (326)
Q Consensus       107 ITD~gL~~v~~~cp~L~~L~Ls~C~~ITd~gi~~~L~~L~~~C~~Lk~L~LsgC~~lTd~~l~~La~~l~~~~~l~~l~~  186 (326)
                      +-|..+...+..||++++|+|.+|..+||..    +..++++|++|++|+|..|.++||..|+.+++.+++++.+   ++
T Consensus       151 v~~sslrt~~~~CpnIehL~l~gc~~iTd~s----~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~l---Nl  223 (483)
T KOG4341|consen  151 VGDSSLRTFASNCPNIEHLALYGCKKITDSS----LLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYL---NL  223 (483)
T ss_pred             CCcchhhHHhhhCCchhhhhhhcceeccHHH----HHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHh---hh
Confidence            7777777777777777777777777777777    6667777777777777777777777777777777666433   55


Q ss_pred             cCCcccccCCccccccCCCCceeeecCCCCCC
Q 020465          187 RQPILYHKARHYPVLVNRENDHSIDVEICPSC  218 (326)
Q Consensus       187 ~~~~~~~~~gl~~l~~~c~~Lr~lDL~~Cp~c  218 (326)
                      .|+.-.+..|+.++.++|..++++.+.+|-..
T Consensus       224 Swc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~  255 (483)
T KOG4341|consen  224 SWCPQISGNGVQALQRGCKELEKLSLKGCLEL  255 (483)
T ss_pred             ccCchhhcCcchHHhccchhhhhhhhcccccc
Confidence            55555555666666677777666666666553

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PF06689 zf-C4_ClpX: ClpX C4-type zinc finger; InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query326
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 1e-06
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 3e-05
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 9e-05
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 5e-04
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
 Score = 48.3 bits (115), Expect = 1e-06
 Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 6/99 (6%)

Query: 79  RLSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGV 138
           RLSD I+  +    N  L  L L  C   +   LQ ++     + +L +  C   + + V
Sbjct: 129 RLSDPIVNTLAK--NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHV 186

Query: 139 IEAVEKLSENDHTLEILHISGVY-NITKEHLRTLHSHLK 176
             AV  +SE    +  L++SG   N+ K  L TL     
Sbjct: 187 QVAVAHVSET---ITQLNLSGYRKNLQKSDLSTLVRRCP 222
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.85
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.71
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 99.62
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.54
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 99.48
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 99.25
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.02
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.01
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.99
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.93
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.8
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.79
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.55
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.49
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.44
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 98.43
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.39
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.37
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.35
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.33
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.15
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.11
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 98.11
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 98.1
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.05
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.01
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.65
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 97.39
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.0
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.84
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.83
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 96.28
4fmz_A347 Internalin; leucine rich repeat, structural genomi 96.12
4fmz_A347 Internalin; leucine rich repeat, structural genomi 95.87
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 95.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 95.71
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 95.58
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 95.37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 95.24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 94.98
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 94.96
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 94.89
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 94.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 94.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 94.73
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 94.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 94.55
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 94.47
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 94.36
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 94.17
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 94.16
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 94.16
1o6v_A466 Internalin A; bacterial infection, extracellular r 94.16
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 94.04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 93.92
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 93.88
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 93.86
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 93.75
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 93.72
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 93.68
1o6v_A466 Internalin A; bacterial infection, extracellular r 93.64
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 93.55
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 93.24
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 93.23
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 93.11
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 93.05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 92.99
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 92.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 92.94
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 92.92
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 92.91
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 92.82
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 92.72
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 92.37
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 92.34
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 92.33
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 92.27
3m19_A251 Variable lymphocyte receptor A diversity region; a 92.27
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 92.22
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 92.12
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 91.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 91.86
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 91.85
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 91.71
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 91.6
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 91.6
3e6j_A229 Variable lymphocyte receptor diversity region; var 91.58
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 91.41
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 91.4
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 91.26
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 91.21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 91.08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 90.9
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 90.81
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 90.74
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 90.7
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 90.64
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 90.6
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 90.57
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 90.55
1w8a_A192 SLIT protein; signaling protein, secreted protein, 90.54
3e6j_A229 Variable lymphocyte receptor diversity region; var 89.97
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 89.81
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 89.77
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 89.71
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 89.52
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 89.47
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 89.44
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 89.39
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 89.34
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 89.18
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 88.97
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 88.73
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 88.69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 88.69
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 88.66
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 88.62
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 88.37
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 88.2
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 88.1
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 88.08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 87.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 87.95
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 87.84
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 87.62
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 86.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 85.98
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 85.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 85.84
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 85.81
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 85.66
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 85.65
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 85.41
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 84.99
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 84.89
2co8_A82 NEDD9 interacting protein with calponin homology a 84.03
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 81.68
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 81.3
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 81.16
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
Probab=99.85  E-value=3.4e-20  Score=173.22  Aligned_cols=190  Identities=19%  Similarity=0.217  Sum_probs=115.3

Q ss_pred             CCCCCCCCHHHHHHHHccCChHHHHHHhhcCHHhhhhhccCCCCceeeeecCC--------------C-----C------
Q 020465           23 NEEEPRPPHEALFLALAYLPLFELLAMSVVCLSLRDAVNKDILPWLNIIVDRP--------------L-----N------   77 (326)
Q Consensus        23 ~~~~~~LP~E~Ll~IfsyL~~~dLl~~s~VCr~Wr~lv~~dp~LW~~ldL~~~--------------l-----~------   77 (326)
                      +..+..||+|++..||+||+.+|++++++|||+|+++ ..+|.+|+++|+...              +     +      
T Consensus         6 ~~~~~~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~-~~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~l~~   84 (336)
T 2ast_B            6 GVSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRL-ASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQ   84 (336)
T ss_dssp             -CCSSSSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHH-HTCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCEECS
T ss_pred             cCChhhCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHH-hcCchhheeeccccccCCHHHHHhhhhccceEEEcCCccccc
Confidence            4567889999999999999999999999999999999 678999999998521              0     0      


Q ss_pred             ------------------CCCCHHHHHHHHhhc-----------------------CCCccEEecCCCCCCCHHHHHHHH
Q 020465           78 ------------------RRLSDEILMKITSKA-----------------------NGRLTTLALINCVRITNAGLQRVI  116 (326)
Q Consensus        78 ------------------~~itD~~L~~l~~~~-----------------------~~~L~~L~Ls~C~~ITD~gL~~v~  116 (326)
                                        ..+++..+..+....                       .++|++|+|++|..+++.++..++
T Consensus        85 ~~~~~~~~~~L~~L~L~~~~l~~~~~~~~~~~~~~L~~L~L~~~~l~~~~~~~l~~~~~L~~L~L~~~~~l~~~~l~~~~  164 (336)
T 2ast_B           85 PLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFSEFALQTLL  164 (336)
T ss_dssp             CCCSCCCCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHHHTTCTTCSEEECTTCBSCCHHHHHHHH
T ss_pred             cchhhccCCCCCEEEccCCCcCHHHHHHHHhhCCCCCEEeCcCcccCHHHHHHHhcCCCCCEEECCCCCCCCHHHHHHHH
Confidence                              113344344433332                       145555555555555555555555


Q ss_pred             HhCCCccEEEeCCCCCCCHHHHHHHHHHHHhcCC-CCCeeeccCcc-ccchHHHHHHHHhcccCcchhhhhccCCccccc
Q 020465          117 EKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDH-TLEILHISGVY-NITKEHLRTLHSHLKLNSSRQNEQKRQPILYHK  194 (326)
Q Consensus       117 ~~cp~L~~L~Ls~C~~ITd~gi~~~L~~L~~~C~-~Lk~L~LsgC~-~lTd~~l~~La~~l~~~~~l~~l~~~~~~~~~~  194 (326)
                      .++|+|++|+|++|..+++.+    +..+...++ +|++|+|+++. .+++..+..+...++.+..   +.+.....+++
T Consensus       165 ~~~~~L~~L~l~~~~~l~~~~----~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~---L~l~~~~~l~~  237 (336)
T 2ast_B          165 SSCSRLDELNLSWCFDFTEKH----VQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVH---LDLSDSVMLKN  237 (336)
T ss_dssp             HHCTTCCEEECCCCTTCCHHH----HHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSE---EECTTCTTCCG
T ss_pred             hcCCCCCEEcCCCCCCcChHH----HHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCE---EeCCCCCcCCH
Confidence            556666666666655555555    444445555 66666666665 4565555555554444332   23333333333


Q ss_pred             CCccccccCCCCceeeecCCCCCCccc
Q 020465          195 ARHYPVLVNRENDHSIDVEICPSCSEV  221 (326)
Q Consensus       195 ~gl~~l~~~c~~Lr~lDL~~Cp~c~~~  221 (326)
                      .++. .+..++.|+.|||..|+..++.
T Consensus       238 ~~~~-~l~~l~~L~~L~l~~~~~~~~~  263 (336)
T 2ast_B          238 DCFQ-EFFQLNYLQHLSLSRCYDIIPE  263 (336)
T ss_dssp             GGGG-GGGGCTTCCEEECTTCTTCCGG
T ss_pred             HHHH-HHhCCCCCCEeeCCCCCCCCHH
Confidence            3332 2245566777777766644443
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query326
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.56
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.95
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.82
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.81
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.81
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.81
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.69
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.43
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 98.31
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.3
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 98.28
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.06
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 96.02
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 95.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 93.89
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 93.55
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 92.6
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 91.95
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 91.94
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 91.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 90.02
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 89.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 88.47
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 87.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 86.97
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 84.22
d2ds5a138 ClpX chaperone zinc binding domain {Escherichia co 82.44
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 82.43
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 82.31
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.64  E-value=4.7e-16  Score=142.37  Aligned_cols=135  Identities=17%  Similarity=0.244  Sum_probs=78.0

Q ss_pred             CCHHHHHHHHhhcCCCccEEecCCCCCCCHHHHHHHHHhCCCccEEEeCCCCCCCHHHHHHHHHHHHhcCCCCCeeeccC
Q 020465           80 LSDEILMKITSKANGRLTTLALINCVRITNAGLQRVIEKNPFIKKLYIPGCTGLSPQGVIEAVEKLSENDHTLEILHISG  159 (326)
Q Consensus        80 itD~~L~~l~~~~~~~L~~L~Ls~C~~ITD~gL~~v~~~cp~L~~L~Ls~C~~ITd~gi~~~L~~L~~~C~~Lk~L~Lsg  159 (326)
                      ++|..+..+++.  ++|++|+|++|.+|||+|+..+++++|+|++|+|++|..++++|+.   ..++..+++|++|++++
T Consensus        83 l~~~~~~~l~~~--~~L~~L~Ls~c~~itd~~l~~l~~~~~~L~~L~ls~c~~~~~~~~~---~~~~~~~~~L~~L~l~~  157 (284)
T d2astb2          83 LSDPIVNTLAKN--SNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQ---VAVAHVSETITQLNLSG  157 (284)
T ss_dssp             CCHHHHHHHTTC--TTCSEEECTTCBSCCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHH---HHHHHSCTTCCEEECCS
T ss_pred             CCcHHHHHHhcC--CCCcCccccccccccccccchhhHHHHhccccccccccccccccch---hhhcccccccchhhhcc
Confidence            455555555432  4666666666666666666666666666666666666666666621   22334556666666666


Q ss_pred             cc-ccchHHHHHHHHhcccCcchhhhhccCCcccccCCccccccCCCCceeeecCCCCCCccchh
Q 020465          160 VY-NITKEHLRTLHSHLKLNSSRQNEQKRQPILYHKARHYPVLVNRENDHSIDVEICPSCSEVRM  223 (326)
Q Consensus       160 C~-~lTd~~l~~La~~l~~~~~l~~l~~~~~~~~~~~gl~~l~~~c~~Lr~lDL~~Cp~c~~~~L  223 (326)
                      |. ++++.++..++.+++....   +.+..+..+++.++..+ ..++.|+.|+|.+|..+++..+
T Consensus       158 ~~~~i~~~~l~~l~~~~~~L~~---L~L~~~~~itd~~~~~l-~~~~~L~~L~L~~C~~i~~~~l  218 (284)
T d2astb2         158 YRKNLQKSDLSTLVRRCPNLVH---LDLSDSVMLKNDCFQEF-FQLNYLQHLSLSRCYDIIPETL  218 (284)
T ss_dssp             CGGGSCHHHHHHHHHHCTTCSE---EECTTCTTCCGGGGGGG-GGCTTCCEEECTTCTTCCGGGG
T ss_pred             cccccccccccccccccccccc---cccccccCCCchhhhhh-cccCcCCEEECCCCCCCChHHH
Confidence            53 4666666666666555433   34444444444444333 3466666666666666665544
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ds5a1 g.39.1.11 (A:11-48) ClpX chaperone zinc binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure