Citrus Sinensis ID: 020545
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 325 | ||||||
| 225447983 | 358 | PREDICTED: 11S globulin seed storage pro | 0.926 | 0.840 | 0.537 | 7e-86 | |
| 147806470 | 358 | hypothetical protein VITISV_020438 [Viti | 0.926 | 0.840 | 0.537 | 1e-85 | |
| 225447990 | 358 | PREDICTED: glutelin type-A 2 [Vitis vini | 0.926 | 0.840 | 0.537 | 1e-85 | |
| 225447981 | 358 | PREDICTED: 11S globulin seed storage pro | 0.926 | 0.840 | 0.533 | 4e-85 | |
| 359486116 | 358 | PREDICTED: LOW QUALITY PROTEIN: 11S glob | 0.926 | 0.840 | 0.530 | 7e-84 | |
| 359486094 | 359 | PREDICTED: LOW QUALITY PROTEIN: glutelin | 0.929 | 0.841 | 0.537 | 5e-83 | |
| 225447988 | 358 | PREDICTED: 11S globulin seed storage pro | 0.926 | 0.840 | 0.527 | 6e-83 | |
| 290578589 | 358 | globulin [Vitis cinerea var. helleri x V | 0.926 | 0.840 | 0.524 | 2e-82 | |
| 224128189 | 360 | predicted protein [Populus trichocarpa] | 0.92 | 0.830 | 0.527 | 1e-81 | |
| 317106764 | 358 | JHL25P11.12 [Jatropha curcas] | 0.929 | 0.843 | 0.504 | 9e-77 |
| >gi|225447983|ref|XP_002269464.1| PREDICTED: 11S globulin seed storage protein 2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 323 bits (828), Expect = 7e-86, Method: Compositional matrix adjust.
Identities = 166/309 (53%), Positives = 218/309 (70%), Gaps = 8/309 (2%)
Query: 17 DLHVIPIIIPCELGVAGMVLPNDQKHSQEEIVLGLRKGDVIPVPLGSASWWYNNGSSDVV 76
D + I ++ GV GMV PN + +E+VL L+KGD+IPVP G+ SWWYN+G S+++
Sbjct: 56 DSNRIGYVLQGSCGVVGMVSPN----ASQEVVLRLKKGDIIPVPSGAVSWWYNDGDSELI 111
Query: 77 IVFVGETSRAYVPGEFSYFLLTGAQGILGGFSSEFTGRAYNMNENEAKILAKSQTGVLII 136
IVF+GETS+AYVPGEF+YFLLTG QGILGGFS+EF RAY++N EAK LAKSQ+G+L+I
Sbjct: 112 IVFLGETSKAYVPGEFTYFLLTGTQGILGGFSTEFNSRAYDINNEEAKKLAKSQSGLLLI 171
Query: 137 KLGQDESEKIPLPHQHGNANLMVNNFANFPADFCVKKAGMVTSFTGSNFPFLEQVGLSCT 196
KL E K+P P ++ L+ N A P D V+ AG++T+ T FPFL +VGLS T
Sbjct: 172 KL--PEGHKMPHPCKNSPDKLVFNIDAALP-DIHVQNAGLLTALTAKKFPFLGEVGLSAT 228
Query: 197 ILKLDANAMLSPTYTAD-SVQVFYVVKGSGKAQIVGLNAKLVLDSEVEAGQLLVVPRCFV 255
++KLDANAM SP Y AD SVQV YV KGSG+ Q+VG+N + LD++V+AG L VVPR FV
Sbjct: 229 LVKLDANAMSSPVYAADSSVQVIYVAKGSGRIQVVGINGERALDTKVKAGHLFVVPRFFV 288
Query: 256 VAIIAGPEGIECFSITTSTRPALGKLGGKQSVMNGFSASVVQLALNVNEEFLKFFKENVA 315
A IA EG+E FS+ T+T+P G+ GK SV S V+Q +LNV EF + F+ +
Sbjct: 289 AAAIADGEGMEYFSMITTTQPVFGEFTGKTSVWGALSPQVLQASLNVGPEFEQLFRAKIK 348
Query: 316 TSEILIPPK 324
S IL+PP+
Sbjct: 349 KSTILVPPQ 357
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147806470|emb|CAN67616.1| hypothetical protein VITISV_020438 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225447990|ref|XP_002270155.1| PREDICTED: glutelin type-A 2 [Vitis vinifera] gi|298204533|emb|CBI23808.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225447981|ref|XP_002269304.1| PREDICTED: 11S globulin seed storage protein 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359486116|ref|XP_003633390.1| PREDICTED: LOW QUALITY PROTEIN: 11S globulin seed storage protein 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359486094|ref|XP_003633383.1| PREDICTED: LOW QUALITY PROTEIN: glutelin type-B 5-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225447988|ref|XP_002269868.1| PREDICTED: 11S globulin seed storage protein 2 [Vitis vinifera] gi|298204531|emb|CBI23806.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|290578589|gb|ADD51189.1| globulin [Vitis cinerea var. helleri x Vitis riparia] | Back alignment and taxonomy information |
|---|
| >gi|224128189|ref|XP_002329103.1| predicted protein [Populus trichocarpa] gi|118482429|gb|ABK93137.1| unknown [Populus trichocarpa] gi|222869772|gb|EEF06903.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|317106764|dbj|BAJ53257.1| JHL25P11.12 [Jatropha curcas] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 325 | ||||||
| TAIR|locus:2026545 | 356 | AT1G07750 "AT1G07750" [Arabido | 0.88 | 0.803 | 0.403 | 2.6e-54 | |
| TAIR|locus:2065516 | 356 | AT2G28680 "AT2G28680" [Arabido | 0.88 | 0.803 | 0.4 | 4.9e-53 | |
| UNIPROTKB|Q9M4Q7 | 353 | Q9M4Q7 "Seed storage protein" | 0.48 | 0.441 | 0.333 | 8.8e-23 | |
| TAIR|locus:2024219 | 451 | AT1G03890 [Arabidopsis thalian | 0.630 | 0.454 | 0.294 | 6e-18 | |
| UNIPROTKB|Q9XHP0 | 459 | Q9XHP0 "11S globulin seed stor | 0.483 | 0.342 | 0.254 | 3.5e-16 | |
| TAIR|locus:2121308 | 524 | CRU3 "AT4G28520" [Arabidopsis | 0.452 | 0.280 | 0.306 | 1.4e-15 | |
| TAIR|locus:2024234 | 455 | CRU2 "AT1G03880" [Arabidopsis | 0.449 | 0.320 | 0.310 | 2.8e-15 | |
| TAIR|locus:2167654 | 472 | CRA1 "CRUCIFERINA" [Arabidopsi | 0.452 | 0.311 | 0.272 | 2.9e-12 | |
| TAIR|locus:2056568 | 511 | AT2G28490 [Arabidopsis thalian | 0.452 | 0.287 | 0.277 | 1.2e-08 |
| TAIR|locus:2026545 AT1G07750 "AT1G07750" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 561 (202.5 bits), Expect = 2.6e-54, P = 2.6e-54
Identities = 119/295 (40%), Positives = 174/295 (58%)
Query: 30 GVAGMVLPNDQKHSQEEIVLGLRKGDVIPVPLGSASWWYNNGSSDVVIVFVGETSRAYVP 89
G AG+VLP +EE V+ +++GD I +P G +WW+NN ++VI+F+GET + +
Sbjct: 68 GTAGIVLPE-----KEEKVIAIKQGDSIALPFGVVTWWFNNEDPELVILFLGETHKGHKA 122
Query: 90 GEFSYFLLTGAQGILGGFSSEFTGRAYNMNENEAKILAKSQTGVLIIKLGQDESEKIPLP 149
G+F+ F LTG GI GFS+EF GRA++++EN K L SQTG I+KL D K+P P
Sbjct: 123 GQFTEFYLTGTNGIFTGFSTEFVGRAWDLDENTVKKLVGSQTGNGIVKL--DAGFKMPQP 180
Query: 150 HQHGNANLMVNNFANFPADFCVKKAGMVTSFTGSNFPFLEQVGLSCTILKLDANAMLSPT 209
+ A ++N P D +K G V N P + +VG ++++DA++M SP
Sbjct: 181 KEENRAGFVLNCL-EAPLDVDIKDGGRVVVLNTKNLPLVGEVGFGADLVRIDAHSMCSPG 239
Query: 210 YTADS-VQVFYVVKGSGKAQIVGLNAKLVLDSEVEAGQLLVVPRCFVVAIIAGPEGIECF 268
++ DS +QV Y+V GSG+ Q+VG + K VL++ ++AG L +VPR FVV+ IA +G+ F
Sbjct: 240 FSCDSALQVTYIVGGSGRVQVVGGDGKRVLETHIKAGSLFIVPRFFVVSKIADADGMSWF 299
Query: 269 SITTSTRPALGKLGGKQSVMNGFSASVVQLALNVNEEFLKFFKENVATSEILIPP 323
SI T+ P L G SV S V+Q A V E K F+ +S I PP
Sbjct: 300 SIVTTPDPIFTHLAGNTSVWKSLSPEVLQAAFKVAPEVEKSFRSTRTSSAIFFPP 354
|
|
| TAIR|locus:2065516 AT2G28680 "AT2G28680" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9M4Q7 Q9M4Q7 "Seed storage protein" [Ricinus communis (taxid:3988)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024219 AT1G03890 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9XHP0 Q9XHP0 "11S globulin seed storage protein 2" [Sesamum indicum (taxid:4182)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2121308 CRU3 "AT4G28520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024234 CRU2 "AT1G03880" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167654 CRA1 "CRUCIFERINA" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2056568 AT2G28490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00026508001 | SubName- Full=Chromosome chr12 scaffold_38, whole genome shotgun sequence; (358 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 325 | |||
| PLN00212 | 493 | PLN00212, PLN00212, glutelin; Provisional | 2e-28 | |
| smart00835 | 146 | smart00835, Cupin_1, Cupin | 1e-21 | |
| pfam00190 | 139 | pfam00190, Cupin_1, Cupin | 5e-11 | |
| smart00835 | 146 | smart00835, Cupin_1, Cupin | 7e-11 | |
| pfam00190 | 139 | pfam00190, Cupin_1, Cupin | 8e-04 |
| >gnl|CDD|215106 PLN00212, PLN00212, glutelin; Provisional | Back alignment and domain information |
|---|
Score = 114 bits (287), Expect = 2e-28
Identities = 82/328 (25%), Positives = 132/328 (40%), Gaps = 54/328 (16%)
Query: 52 RKGDVIPVPLGSASWWYNNGSSDVVIVFVGETSRAYVPGEFSY--FLLTG---------- 99
R+GDV+ +P G A W+YN+G + VV ++V + + E FLL G
Sbjct: 153 RQGDVVALPAGVAHWFYNDGDAPVVALYVYDINNNANQLEPRQREFLLAGNNNRQQQVYG 212
Query: 100 -------AQGILGGFSSEFTGRAYNMNENEAKILA--KSQTGVLI------------IKL 138
Q I GFS+E A +N AK L Q G +I +
Sbjct: 213 RSIEQHSGQNIFSGFSTELLSEALGINAQVAKRLQSQNDQRGEIIRVKNGLQLLQPTLTQ 272
Query: 139 GQDESEKIPL-----------PHQHGNANLMVNNFANFP----------ADFCVKKAGMV 177
Q+++++ G N + NF AD +AG +
Sbjct: 273 QQEQAQQQQQRLYQQVQYQQSQQTSGRWNGLDENFCTIKVRLNIENPSRADTYNPRAGRI 332
Query: 178 TSFTGSNFPFLEQVGLSCTILKLDANAMLSPTYTADSVQVFYVVKGSGKAQIVGLNAKLV 237
T FP L + +S T + L NA+LSP + ++ V Y+ +G + Q+V N K V
Sbjct: 333 TRLNSQKFPILNLIQMSATRVNLYQNALLSPFWNVNAHSVVYITQGRARVQVVSNNGKTV 392
Query: 238 LDSEVEAGQLLVVPRCFVVAIIAGPEGIECFSITTSTRPALGKLGGKQSVMNGFSASVVQ 297
+ + GQLL++P+ + V A EG + + T+ + + GK S+ V+
Sbjct: 393 FNGVLRPGQLLIIPQHYAVLKKAEREGCQYIAFKTNANAMVSHIAGKNSIFRALPVDVIA 452
Query: 298 LALNVNEEFLKFFKENVATSEILIPPKF 325
A ++ E + K N P+F
Sbjct: 453 NAYRISREEARRLKNNRGDELGAFTPRF 480
|
Length = 493 |
| >gnl|CDD|214845 smart00835, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|215780 pfam00190, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|214845 smart00835, Cupin_1, Cupin | Back alignment and domain information |
|---|
| >gnl|CDD|215780 pfam00190, Cupin_1, Cupin | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 325 | |||
| PLN00212 | 493 | glutelin; Provisional | 100.0 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 100.0 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 99.94 | |
| PLN00212 | 493 | glutelin; Provisional | 99.94 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 99.9 | |
| TIGR03404 | 367 | bicupin_oxalic bicupin, oxalate decarboxylase fami | 99.88 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 99.82 | |
| PF00190 | 144 | Cupin_1: Cupin; InterPro: IPR006045 This family re | 99.76 | |
| smart00835 | 146 | Cupin_1 Cupin. This family represents the conserve | 99.65 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 99.4 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 99.36 | |
| COG2140 | 209 | Thermophilic glucose-6-phosphate isomerase and rel | 99.09 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 99.03 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 98.91 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 98.91 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 98.9 | |
| PF07883 | 71 | Cupin_2: Cupin domain; InterPro: IPR013096 This fa | 98.73 | |
| PRK04190 | 191 | glucose-6-phosphate isomerase; Provisional | 98.65 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 98.63 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 98.61 | |
| COG0662 | 127 | {ManC} Mannose-6-phosphate isomerase [Carbohydrate | 98.53 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 98.53 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 98.48 | |
| TIGR03214 | 260 | ura-cupin putative allantoin catabolism protein. T | 98.44 | |
| COG1917 | 131 | Uncharacterized conserved protein, contains double | 98.41 | |
| PRK13290 | 125 | ectC L-ectoine synthase; Reviewed | 98.39 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 98.33 | |
| COG3837 | 161 | Uncharacterized conserved protein, contains double | 98.27 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 98.25 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 98.23 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 98.23 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 98.21 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 98.19 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 98.19 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 98.18 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 98.14 | |
| PF06560 | 182 | GPI: Glucose-6-phosphate isomerase (GPI); InterPro | 98.13 | |
| TIGR01479 | 468 | GMP_PMI mannose-1-phosphate guanylyltransferase/ma | 98.12 | |
| PRK11171 | 266 | hypothetical protein; Provisional | 98.1 | |
| PRK09943 | 185 | DNA-binding transcriptional repressor PuuR; Provis | 98.01 | |
| PF03079 | 157 | ARD: ARD/ARD' family; InterPro: IPR004313 The two | 98.0 | |
| PRK15460 | 478 | cpsB mannose-1-phosphate guanyltransferase; Provis | 97.99 | |
| PF01050 | 151 | MannoseP_isomer: Mannose-6-phosphate isomerase; In | 97.89 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 97.82 | |
| COG4101 | 142 | Predicted mannose-6-phosphate isomerase [Carbohydr | 97.81 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 97.79 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 97.77 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 97.76 | |
| TIGR03037 | 159 | anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | 97.74 | |
| PRK13264 | 177 | 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | 97.73 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 97.66 | |
| PRK15457 | 233 | ethanolamine utilization protein EutQ; Provisional | 97.57 | |
| PF11699 | 85 | CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B. | 97.56 | |
| COG1791 | 181 | Uncharacterized conserved protein, contains double | 97.53 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 97.41 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 97.38 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 97.36 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 97.21 | |
| COG4297 | 163 | Uncharacterized protein containing double-stranded | 97.16 | |
| PF02311 | 136 | AraC_binding: AraC-like ligand binding domain; Int | 97.14 | |
| TIGR02272 | 335 | gentisate_1_2 gentisate 1,2-dioxygenase. This fami | 97.08 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 97.05 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 97.01 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 96.98 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 96.97 | |
| PF02041 | 167 | Auxin_BP: Auxin binding protein; InterPro: IPR0005 | 96.94 | |
| PF05899 | 74 | Cupin_3: Protein of unknown function (DUF861); Int | 96.85 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 96.77 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 96.76 | |
| PF06339 | 126 | Ectoine_synth: Ectoine synthase; InterPro: IPR0104 | 96.73 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 96.72 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 96.69 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 96.68 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 96.63 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 96.55 | |
| PRK10296 | 278 | DNA-binding transcriptional regulator ChbR; Provis | 96.53 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 96.53 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 96.51 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 96.48 | |
| PRK13500 | 312 | transcriptional activator RhaR; Provisional | 96.46 | |
| PRK13501 | 290 | transcriptional activator RhaR; Provisional | 96.42 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 96.4 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 96.39 | |
| PF06052 | 151 | 3-HAO: 3-hydroxyanthranilic acid dioxygenase; Inte | 96.36 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 96.27 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 96.25 | |
| KOG2107 | 179 | consensus Uncharacterized conserved protein, conta | 96.23 | |
| COG3450 | 116 | Predicted enzyme of the cupin superfamily [General | 96.21 | |
| TIGR01221 | 176 | rmlC dTDP-4-dehydrorhamnose 3,5-epimerase. This en | 96.19 | |
| TIGR00218 | 302 | manA mannose-6-phosphate isomerase, class I. The n | 96.15 | |
| PF06249 | 152 | EutQ: Ethanolamine utilisation protein EutQ; Inter | 96.14 | |
| TIGR02297 | 287 | HpaA 4-hydroxyphenylacetate catabolism regulatory | 96.14 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 96.08 | |
| PRK13502 | 282 | transcriptional activator RhaR; Provisional | 95.98 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 95.88 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 95.87 | |
| PRK10371 | 302 | DNA-binding transcriptional regulator MelR; Provis | 95.86 | |
| COG3435 | 351 | Gentisate 1,2-dioxygenase [Secondary metabolites b | 95.83 | |
| PRK13503 | 278 | transcriptional activator RhaS; Provisional | 95.64 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 95.59 | |
| COG1898 | 173 | RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and rela | 95.44 | |
| PF05523 | 131 | FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 | 95.03 | |
| PF14499 | 251 | DUF4437: Domain of unknown function (DUF4437); PDB | 94.83 | |
| COG3508 | 427 | HmgA Homogentisate 1,2-dioxygenase [Secondary meta | 94.8 | |
| PF12852 | 186 | Cupin_6: Cupin | 94.68 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 94.58 | |
| TIGR02451 | 215 | anti_sig_ChrR anti-sigma factor, putative, ChrR fa | 94.43 | |
| COG4766 | 176 | EutQ Ethanolamine utilization protein [Amino acid | 94.29 | |
| PF12973 | 91 | Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ | 94.08 | |
| PF04209 | 424 | HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR | 93.9 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 93.42 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 93.13 | |
| PF13621 | 251 | Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XU | 93.1 | |
| PRK05341 | 438 | homogentisate 1,2-dioxygenase; Provisional | 92.71 | |
| PLN02658 | 435 | homogentisate 1,2-dioxygenase | 92.33 | |
| KOG3706 | 629 | consensus Uncharacterized conserved protein [Funct | 91.91 | |
| PF12852 | 186 | Cupin_6: Cupin | 91.87 | |
| PF02373 | 114 | JmjC: JmjC domain, hydroxylase; InterPro: IPR01312 | 91.78 | |
| PF08007 | 319 | Cupin_4: Cupin superfamily protein; InterPro: IPR0 | 91.75 | |
| PF13759 | 101 | 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB | 91.64 | |
| PF05726 | 104 | Pirin_C: Pirin C-terminal cupin domain; InterPro: | 90.44 | |
| TIGR01015 | 429 | hmgA homogentisate 1,2-dioxygenase. Missing in hum | 89.87 | |
| COG3257 | 264 | GlxB Uncharacterized protein, possibly involved in | 89.39 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 89.08 | |
| TIGR02466 | 201 | conserved hypothetical protein. This family consis | 88.17 | |
| KOG3706 | 629 | consensus Uncharacterized conserved protein [Funct | 87.33 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 84.67 | |
| PRK15131 | 389 | mannose-6-phosphate isomerase; Provisional | 83.84 | |
| PF02678 | 107 | Pirin: Pirin; InterPro: IPR003829 This entry repre | 83.32 | |
| PF00027 | 91 | cNMP_binding: Cyclic nucleotide-binding domain; In | 83.19 | |
| PF00908 | 176 | dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimer | 82.42 | |
| PF05995 | 175 | CDO_I: Cysteine dioxygenase type I; InterPro: IPR0 | 81.98 | |
| COG2850 | 383 | Uncharacterized conserved protein [Function unknow | 80.97 | |
| KOG2757 | 411 | consensus Mannose-6-phosphate isomerase [Carbohydr | 80.62 | |
| PRK10572 | 290 | DNA-binding transcriptional regulator AraC; Provis | 80.46 |
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.8e-70 Score=537.79 Aligned_cols=315 Identities=26% Similarity=0.431 Sum_probs=284.5
Q ss_pred cccceeeccccCCCCeEEEEEeCCeEEEEEEcCCCCC--------------------CCcceEEEEeeCCcEEEeCCCCe
Q 020545 5 LYVHIIVCLTENDLHVIPIIIPCELGVAGMVLPNDQK--------------------HSQEEIVLGLRKGDVIPVPLGSA 64 (325)
Q Consensus 5 ~~~~~~~~p~h~~a~ei~yV~~G~~g~~~~v~~~~~~--------------------~~~~~~~~~l~~GDv~~vP~G~~ 64 (325)
+.+++|++|||++|++++||++|+ |++|+|.|+|++ .|.++++++|++||||+||+|++
T Consensus 87 i~p~gL~lP~y~na~~liyV~qG~-G~~G~v~pGcpeT~~~~~~~~~~~~~~~~~~~~d~hqkv~~lr~GDViaiPaG~~ 165 (493)
T PLN00212 87 IEPQGLLLPRYSNTPGLVYIIQGR-GSMGLTFPGCPATYQQQFQQFLTEGQSQSQKFRDEHQKIHQFRQGDVVALPAGVA 165 (493)
T ss_pred ecCCcccCccccCCCeEEEEEeCe-EEEEEEeCCCcchhhhhcccccccccccccccccccccceEeccCCEEEECCCCe
Confidence 467899999999999999999999 999999998843 24577889999999999999999
Q ss_pred EEEEecCCCCEEEEEEeecCCCCC--CCcceeeeecccc-----------------ccccCCChhHHhhhcCCCHHHHHH
Q 020545 65 SWWYNNGSSDVVIVFVGETSRAYV--PGEFSYFLLTGAQ-----------------GILGGFSSEFTGRAYNMNENEAKI 125 (325)
Q Consensus 65 ~~~~N~g~~~l~~~~~~~~~~~~~--p~~~~~f~laG~~-----------------s~l~~f~~~vLa~af~v~~~~~~~ 125 (325)
||+||+|++++++++++|+++..| +..++.|||||+. |+|+||++++|++||||+.++++|
T Consensus 166 hw~yN~Gd~~~v~v~~~d~~n~~Nqld~~~r~F~LaG~~~~~~~~~~~~~~~~~~~nifsGF~~e~La~Afnv~~e~~~k 245 (493)
T PLN00212 166 HWFYNDGDAPVVALYVYDINNNANQLEPRQREFLLAGNNNRQQQVYGRSIEQHSGQNIFSGFSTELLSEALGINAQVAKR 245 (493)
T ss_pred EEEEeCCCCcEEEEEEEeccccccccCCCcceeeccCCCccccccccccccccccCchhhcCCHHHHHHHHCCCHHHHHH
Confidence 999999999999999999988776 2346899999973 599999999999999999999999
Q ss_pred HhcccCc-eeEEEecCCcCCCCcccCCC-------------------------C-----C-------CCceeeeecC-CC
Q 020545 126 LAKSQTG-VLIIKLGQDESEKIPLPHQH-------------------------G-----N-------ANLMVNNFAN-FP 166 (325)
Q Consensus 126 l~~~q~~-~~Iv~~~~~~~~~~~~~~p~-------------------------~-----~-------~~~~~~nl~~-~~ 166 (325)
|++++++ +.|||++. ++.++.|. . . ..+.++|+++ .+
T Consensus 246 lq~~~d~rG~IVrv~~----~l~~~~P~~~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~ngleEt~c~~rlr~Ni~~p~~ 321 (493)
T PLN00212 246 LQSQNDQRGEIIRVKN----GLQLLQPTLTQQQEQAQQQQQRLYQQVQYQQSQQTSGRWNGLDENFCTIKVRLNIENPSR 321 (493)
T ss_pred HhccccCCccEEEECC----CcccCCCchhhhhHHHHhhhhcccccchhhhccccccCCCCccccccccccccccCCccc
Confidence 9988755 79999986 22222220 0 0 2256788877 56
Q ss_pred CCeeccCCeEEEEEcCCCCcccccccceEEEEEecCCCccCCeecCCCCEEEEEEeCcEEEEEEeCCCceEEeEEecCcc
Q 020545 167 ADFCVKKAGMVTSFTGSNFPFLEQVGLSCTILKLDANAMLSPTYTADSVQVFYVVKGSGKAQIVGLNAKLVLDSEVEAGQ 246 (325)
Q Consensus 167 p~~~~~~gG~~~~~~~~~~p~L~~~gis~~~v~l~pg~~~~Ph~h~~A~ei~yV~~G~~~~~vv~p~g~~~~~~~l~~Gd 246 (325)
+|++++.+|+++.+++.+||+|+++|||+.+++|.+|||+.||||+||++|+||++|+++++||+++|+++|+.+|++||
T Consensus 322 ad~y~~~~G~it~v~~~~~P~L~~L~LSa~rv~L~~gam~~PHwn~nA~eI~yV~rG~g~vqvV~~~g~~vf~~~L~~Gd 401 (493)
T PLN00212 322 ADTYNPRAGRITRLNSQKFPILNLIQMSATRVNLYQNALLSPFWNVNAHSVVYITQGRARVQVVSNNGKTVFNGVLRPGQ 401 (493)
T ss_pred cCccCCCceEEEEechhhCccccccCeeEEEEEEcCCcccCCeecCCCCEEEEEeecceEEEEEcCCCCEEEEEEEcCCC
Confidence 88888999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred EEEECCccEEEEEcCCCCEEEEEEeCCCCCceeeecCccccccCCCHHHHHHHcCCCHHHHHHhhhccCCceEecCCC
Q 020545 247 LLVVPRCFVVAIIAGPEGIECFSITTSTRPALGKLGGKQSVMNGFSASVVQLALNVNEEFLKFFKENVATSEILIPPK 324 (325)
Q Consensus 247 v~vvP~G~~h~~~~g~~~~~~~~~~~s~~p~~~~laG~~svl~~~~~evla~af~v~~~~v~~l~~~~~~~~i~~~p~ 324 (325)
|||||+||+|.+.|++++++|++|.+++++..++|||++|+|++||.+||++||+++++++++|+.++.++.++++|+
T Consensus 402 vfVVPqg~~v~~~A~~egfe~v~F~tna~~~~s~laG~~Sv~~alp~eVla~Af~is~eea~~lk~n~~~e~~~~~p~ 479 (493)
T PLN00212 402 LLIIPQHYAVLKKAEREGCQYIAFKTNANAMVSHIAGKNSIFRALPVDVIANAYRISREEARRLKNNRGDELGAFTPR 479 (493)
T ss_pred EEEECCCCeEEEeecCCceEEEEeecCCCccccccccHHHHHHhCCHHHHHHHcCCCHHHHHHHHhcccCceeecCCC
Confidence 999999999999999999999999999998889999999999999999999999999999999999988889999986
|
|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PLN00212 glutelin; Provisional | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >smart00835 Cupin_1 Cupin | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) | Back alignment and domain information |
|---|
| >PRK04190 glucose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03214 ura-cupin putative allantoin catabolism protein | Back alignment and domain information |
|---|
| >COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK13290 ectC L-ectoine synthase; Reviewed | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >COG3837 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PF06560 GPI: Glucose-6-phosphate isomerase (GPI); InterPro: IPR010551 This entry consists of several bacterial and archaeal glucose-6-phosphate isomerase (GPI) proteins (5 | Back alignment and domain information |
|---|
| >TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase | Back alignment and domain information |
|---|
| >PRK11171 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09943 DNA-binding transcriptional repressor PuuR; Provisional | Back alignment and domain information |
|---|
| >PF03079 ARD: ARD/ARD' family; InterPro: IPR004313 The two acireductone dioxygenase enzymes (ARD and ARD', previously known as E-2 and E-2') from Klebsiella pneumoniae share the same amino acid sequence Q9ZFE7 from SWISSPROT, but bind different metal ions: ARD binds Ni2+, ARD' binds Fe2+ [] | Back alignment and domain information |
|---|
| >PRK15460 cpsB mannose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01050 MannoseP_isomer: Mannose-6-phosphate isomerase; InterPro: IPR001538 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase | Back alignment and domain information |
|---|
| >PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >PRK15457 ethanolamine utilization protein EutQ; Provisional | Back alignment and domain information |
|---|
| >PF11699 CENP-C_C: Mif2/CENP-C like; PDB: 2VPV_B | Back alignment and domain information |
|---|
| >COG1791 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >COG4297 Uncharacterized protein containing double-stranded beta helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PF02311 AraC_binding: AraC-like ligand binding domain; InterPro: IPR003313 This entry defines the arabinose-binding and dimerisation domain of the bacterial gene regulatory protein AraC | Back alignment and domain information |
|---|
| >TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >PF02041 Auxin_BP: Auxin binding protein; InterPro: IPR000526 Auxin binding protein is located in the lumen of the endoplasmic reticulum (ER) | Back alignment and domain information |
|---|
| >PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >PF06339 Ectoine_synth: Ectoine synthase; InterPro: IPR010462 This family consists of several bacterial ectoine synthase proteins | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK10296 DNA-binding transcriptional regulator ChbR; Provisional | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >PRK13500 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK13501 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >PF06052 3-HAO: 3-hydroxyanthranilic acid dioxygenase; InterPro: IPR010329 Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase (1 | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2107 consensus Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] | Back alignment and domain information |
|---|
| >COG3450 Predicted enzyme of the cupin superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase | Back alignment and domain information |
|---|
| >TIGR00218 manA mannose-6-phosphate isomerase, class I | Back alignment and domain information |
|---|
| >PF06249 EutQ: Ethanolamine utilisation protein EutQ; InterPro: IPR010424 The eut operon of Salmonella typhimurium encodes proteins involved in the cobalamin-dependent degradation of ethanolamine | Back alignment and domain information |
|---|
| >TIGR02297 HpaA 4-hydroxyphenylacetate catabolism regulatory protein HpaA | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >PRK13502 transcriptional activator RhaR; Provisional | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10371 DNA-binding transcriptional regulator MelR; Provisional | Back alignment and domain information |
|---|
| >COG3435 Gentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK13503 transcriptional activator RhaS; Provisional | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PF05523 FdtA: WxcM-like, C-terminal ; InterPro: IPR008894 This entry includes FdtA (Q6T1W8 from SWISSPROT) from Aneurinibacillus thermoaerophilus, which has been characterised as a dTDP-6-deoxy-3,4-keto-hexulose isomerase [] | Back alignment and domain information |
|---|
| >PF14499 DUF4437: Domain of unknown function (DUF4437); PDB: 2QDR_A | Back alignment and domain information |
|---|
| >COG3508 HmgA Homogentisate 1,2-dioxygenase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family | Back alignment and domain information |
|---|
| >COG4766 EutQ Ethanolamine utilization protein [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A | Back alignment and domain information |
|---|
| >PF04209 HgmA: homogentisate 1,2-dioxygenase; InterPro: IPR005708 Alkaptonuria (AKU), a rare hereditary disorder, was the first disease to be interpreted as an inborn error of metabolism | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >PF13621 Cupin_8: Cupin-like domain; PDB: 3AL6_C 3AL5_C 2XUM_A 2Y0I_A 1MZE_A 3KCY_A 1MZF_A 1YCI_A 2ILM_A 1H2L_A | Back alignment and domain information |
|---|
| >PRK05341 homogentisate 1,2-dioxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN02658 homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >KOG3706 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12852 Cupin_6: Cupin | Back alignment and domain information |
|---|
| >PF02373 JmjC: JmjC domain, hydroxylase; InterPro: IPR013129 Jumonji protein is required for neural tube formation in mice [] | Back alignment and domain information |
|---|
| >PF08007 Cupin_4: Cupin superfamily protein; InterPro: IPR022777 This signature represents primarily the cupin fold found in JmjC transcription factors | Back alignment and domain information |
|---|
| >PF13759 2OG-FeII_Oxy_5: Putative 2OG-Fe(II) oxygenase; PDB: 3BVC_B 2RG4_A | Back alignment and domain information |
|---|
| >PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >TIGR01015 hmgA homogentisate 1,2-dioxygenase | Back alignment and domain information |
|---|
| >COG3257 GlxB Uncharacterized protein, possibly involved in glyoxylate utilization [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02466 conserved hypothetical protein | Back alignment and domain information |
|---|
| >KOG3706 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK15131 mannose-6-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF02678 Pirin: Pirin; InterPro: IPR003829 This entry represents N-terminal domain of Pirin proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] | Back alignment and domain information |
|---|
| >PF00908 dTDP_sugar_isom: dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 | Back alignment and domain information |
|---|
| >PF05995 CDO_I: Cysteine dioxygenase type I; InterPro: IPR010300 Cysteine dioxygenase type I (1 | Back alignment and domain information |
|---|
| >COG2850 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2757 consensus Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10572 DNA-binding transcriptional regulator AraC; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 325 | ||||
| 3qac_A | 465 | Structure Of Amaranth 11s Proglobulin Seed Storage | 3e-22 | ||
| 1fxz_A | 476 | Crystal Structure Of Soybean Proglycinin A1ab1b Hom | 4e-21 | ||
| 1ud1_A | 476 | Crystal Structure Of Proglycinin Mutant C88s Length | 4e-21 | ||
| 1ucx_A | 476 | Crystal Structure Of Proglycinin C12g Mutant Length | 4e-21 | ||
| 2evx_A | 459 | Crystal Structure Of Pumpkin Seed Globulin Length = | 9e-20 | ||
| 3kgl_A | 466 | Crystal Structure Of Procruciferin, 11s Globulin Fr | 2e-16 | ||
| 3ehk_A | 531 | Crystal Structure Of Pru Du Amandin, An Allergenic | 2e-15 | ||
| 2d5f_A | 493 | Crystal Structure Of Recombinant Soybean Proglycini | 5e-15 | ||
| 1od5_A | 492 | Crystal Structure Of Glycinin A3b4 Subunit Homohexa | 5e-15 | ||
| 3ksc_A | 496 | Crystal Structure Of Pea Prolegumin, An 11s Seed Gl | 6e-15 | ||
| 3c3v_A | 510 | Crystal Structure Of Peanut Major Allergen Ara H 3 | 2e-14 |
| >pdb|3QAC|A Chain A, Structure Of Amaranth 11s Proglobulin Seed Storage Protein From Amaranthus Hypochondriacus L Length = 465 | Back alignment and structure |
|
| >pdb|1FXZ|A Chain A, Crystal Structure Of Soybean Proglycinin A1ab1b Homotrimer Length = 476 | Back alignment and structure |
| >pdb|1UD1|A Chain A, Crystal Structure Of Proglycinin Mutant C88s Length = 476 | Back alignment and structure |
| >pdb|1UCX|A Chain A, Crystal Structure Of Proglycinin C12g Mutant Length = 476 | Back alignment and structure |
| >pdb|2EVX|A Chain A, Crystal Structure Of Pumpkin Seed Globulin Length = 459 | Back alignment and structure |
| >pdb|3KGL|A Chain A, Crystal Structure Of Procruciferin, 11s Globulin From Brassica Napus Length = 466 | Back alignment and structure |
| >pdb|3EHK|A Chain A, Crystal Structure Of Pru Du Amandin, An Allergenic Protein From Prunus Dulcis Length = 531 | Back alignment and structure |
| >pdb|2D5F|A Chain A, Crystal Structure Of Recombinant Soybean Proglycinin A3b4 Subunit, Its Comparison With Mature Glycinin A3b4 Subunit, Responsible For Hexamer Assembly Length = 493 | Back alignment and structure |
| >pdb|1OD5|A Chain A, Crystal Structure Of Glycinin A3b4 Subunit Homohexamer Length = 492 | Back alignment and structure |
| >pdb|3KSC|A Chain A, Crystal Structure Of Pea Prolegumin, An 11s Seed Globulin From Pisum Sativum L. Length = 496 | Back alignment and structure |
| >pdb|3C3V|A Chain A, Crystal Structure Of Peanut Major Allergen Ara H 3 Length = 510 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 325 | |||
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 5e-63 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 2e-56 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 4e-56 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 2e-53 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 2e-49 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 8e-41 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 5e-11 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 2e-39 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 6e-06 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 8e-39 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 1e-06 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 1e-35 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 7e-35 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 3e-06 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 2e-33 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 3e-05 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 6e-33 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 3e-15 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 4e-28 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 9e-15 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 4e-26 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 6e-11 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 4e-23 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 2e-12 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 2e-17 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 7e-09 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 3e-09 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 3e-06 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 5e-04 |
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Length = 531 | Back alignment and structure |
|---|
Score = 207 bits (528), Expect = 5e-63
Identities = 73/362 (20%), Positives = 131/362 (36%), Gaps = 76/362 (20%)
Query: 39 DQKHSQEEIVLGLRKGDVIPVPLGSASWWYNNGSSDVVIVFVGETSRAYVPGEFSY--FL 96
++ + + +R+GDV+ +P G A W YN+G ++V V + S + + + F
Sbjct: 164 FRQLDRHQKTRRIREGDVVAIPAGVAYWSYNDGDQELVAVNLFHVSSDHNQLDQNPRKFY 223
Query: 97 LTG-----------------------------------------AQGILGGFSSEFTGRA 115
L G + GF+++ +A
Sbjct: 224 LAGNPENEFNQQGQSQPRQQGEQGRPGQHQQPFGRPRQQEQQGNGNNVFSGFNTQLLAQA 283
Query: 116 YNMNENEA-KILAKSQTGVLIIKLGQDESEKIPLPHQHG--------------------- 153
N+NE A + ++ II++ + P +
Sbjct: 284 LNVNEETARNLQGQNDNRNQIIQVRGNLDFVQPPRGRQEREHEERQQEQLQQERQQQGEQ 343
Query: 154 -----------NANLMVNNFANFPADFCVKKAGMVTSFTGSNFPFLEQVGLSCTILKLDA 202
+ L N AD +AG +++ N P L + LS
Sbjct: 344 LMANGLEETFCSLRLKENIGNPERADIFSPRAGRISTLNSHNLPILRFLRLSAERGFFYR 403
Query: 203 NAMLSPTYTADSVQVFYVVKGSGKAQIVGLNAKLVLDSEVEAGQLLVVPRCFVVAIIAGP 262
N + SP + ++ V YV++G+ + Q+V N +LD EV+ GQL +VP+ V AG
Sbjct: 404 NGIYSPHWNVNAHSVVYVIRGNARVQVVNENGDAILDQEVQQGQLFIVPQNHGVIQQAGN 463
Query: 263 EGIECFSITTSTRPALGKLGGKQSVMNGFSASVVQLALNVNEEFLKFFKENVATSEILIP 322
+G E F+ T + L G+ S + V+ A ++ E + K N + L
Sbjct: 464 QGFEYFAFKTEENAFINTLAGRTSFLRALPDEVLANAYQISREQARQLKYNRQETIALSS 523
Query: 323 PK 324
+
Sbjct: 524 SQ 525
|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Length = 466 | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Length = 465 | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Length = 459 | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Length = 476 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Length = 510 | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Length = 418 | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Length = 434 | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Length = 445 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Length = 397 | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Length = 416 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Length = 496 | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Length = 493 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Length = 361 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Length = 385 | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Length = 178 | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Length = 201 | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X Length = 79 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Length = 394 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 325 | |||
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 100.0 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 100.0 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 100.0 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 100.0 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 100.0 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 100.0 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 100.0 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 100.0 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 100.0 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 100.0 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 100.0 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 100.0 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 100.0 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 100.0 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 100.0 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.96 | |
| 3ksc_A | 496 | LEGA class, prolegumin; PEA prolegumin, 11S SEED s | 99.96 | |
| 3qac_A | 465 | 11S globulin SEED storage protein; 11S SEED storag | 99.96 | |
| 2e9q_A | 459 | 11S globulin subunit beta; cucubitin, pumpkin SEED | 99.95 | |
| 1dgw_A | 178 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.95 | |
| 3kgl_A | 466 | Cruciferin; 11S SEED globulin, rapeseed, SEED stor | 99.95 | |
| 1fxz_A | 476 | Glycinin G1; proglycinin, legumin, SEED storage pr | 99.94 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 99.94 | |
| 2d5f_A | 493 | Glycinin A3B4 subunit; soybean, globulin, 11S,SEED | 99.94 | |
| 3fz3_A | 531 | Prunin; TREE NUT allergen, allergy, amandin, almon | 99.94 | |
| 3c3v_A | 510 | Arachin ARAH3 isoform; peanut allergen, allergy, g | 99.93 | |
| 2phl_A | 397 | Phaseolin; plant SEED storage protein(vicilin); HE | 99.93 | |
| 2ea7_A | 434 | 7S globulin-1; beta barrel, cupin superfamily, pla | 99.92 | |
| 3s7i_A | 418 | Allergen ARA H 1, clone P41B; bicupin, vicilin, st | 99.91 | |
| 2cav_A | 445 | Protein (canavalin); vicilin, 7S SEED protein, dom | 99.91 | |
| 1uij_A | 416 | Beta subunit of beta conglycinin; double-stranded | 99.91 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.88 | |
| 2vqa_A | 361 | SLL1358 protein, MNCA; periplasmic binding protein | 99.86 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 99.85 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.77 | |
| 1j58_A | 385 | YVRK protein; cupin, decarboxyklase, oxalate, mang | 99.77 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 99.74 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 99.72 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 99.69 | |
| 1fi2_A | 201 | Oxalate oxidase, germin; beta-jellyroll, oxidoredu | 99.67 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 99.63 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 99.61 | |
| 1dgw_Y | 93 | Canavalin; duplicated swiss-roll beta barrels, loo | 99.59 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 99.51 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 99.48 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 99.47 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 99.47 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 99.41 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 99.31 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 99.11 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 99.02 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 99.01 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 98.95 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 98.94 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 98.93 | |
| 1lr5_A | 163 | Auxin binding protein 1; beta jellyroll, double st | 98.87 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 98.86 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 98.86 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 98.81 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 98.78 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 98.77 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 98.76 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 98.76 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 98.75 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 98.74 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 98.74 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 98.73 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 98.72 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 98.72 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 98.71 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 98.7 | |
| 1x82_A | 190 | Glucose-6-phosphate isomerase; cupin superfamily, | 98.7 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 98.68 | |
| 3h8u_A | 125 | Uncharacterized conserved protein with double-STR | 98.68 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 98.68 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 98.68 | |
| 1v70_A | 105 | Probable antibiotics synthesis protein; structural | 98.67 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 98.67 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 98.67 | |
| 2d40_A | 354 | Z3393, putative gentisate 1,2-dioxygenase; gentisi | 98.67 | |
| 3ibm_A | 167 | Cupin 2, conserved barrel domain protein; cupin 2 | 98.65 | |
| 2gu9_A | 113 | Tetracenomycin polyketide synthesis protein; X-RAY | 98.64 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 98.64 | |
| 3l2h_A | 162 | Putative sugar phosphate isomerase; AFE_0303, stru | 98.62 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 98.61 | |
| 3jzv_A | 166 | Uncharacterized protein RRU_A2000; structural geno | 98.59 | |
| 3kgz_A | 156 | Cupin 2 conserved barrel domain protein; metallopr | 98.58 | |
| 2oa2_A | 148 | BH2720 protein; 10175341, structural genomics, joi | 98.57 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 98.56 | |
| 3ht1_A | 145 | REMF protein; cupin fold, Zn-binding, antibiotic b | 98.56 | |
| 1y3t_A | 337 | Hypothetical protein YXAG; BI cupin, dioxygenase, | 98.54 | |
| 4i4a_A | 128 | Similar to unknown protein; structural genomics, P | 98.54 | |
| 2fqp_A | 97 | Hypothetical protein BP2299; double-stranded beta- | 98.54 | |
| 2b8m_A | 117 | Hypothetical protein MJ0764; structural genomics, | 98.53 | |
| 2bnm_A | 198 | Epoxidase; oxidoreductase, cupin, HTH, cation-depe | 98.52 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 98.51 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 98.51 | |
| 2f4p_A | 147 | Hypothetical protein TM1010; double-stranded beta- | 98.51 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 98.5 | |
| 3fjs_A | 114 | Uncharacterized protein with RMLC-like cupin fold; | 98.49 | |
| 2o8q_A | 134 | Hypothetical protein; cpuin-like fold, structural | 98.49 | |
| 1o4t_A | 133 | Putative oxalate decarboxylase; double-stranded be | 98.49 | |
| 2xlg_A | 239 | SLL1785 protein, CUCA; metal binding protein, cupi | 98.47 | |
| 1vj2_A | 126 | Novel manganese-containing cupin TM1459; structura | 98.46 | |
| 3lwc_A | 119 | Uncharacterized protein; structural genomics, unkn | 98.45 | |
| 4e2g_A | 126 | Cupin 2 conserved barrel domain protein; MCSG, PSI | 98.45 | |
| 3i7d_A | 163 | Sugar phosphate isomerase; YP_168127.1, structural | 98.45 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.44 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.43 | |
| 1vr3_A | 191 | Acireductone dioxygenase; 13543033, structural gen | 98.42 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 98.41 | |
| 1y9q_A | 192 | Transcriptional regulator, HTH_3 family; transcrip | 98.38 | |
| 1sef_A | 274 | Conserved hypothetical protein; structural genomic | 98.37 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 98.37 | |
| 3lag_A | 98 | Uncharacterized protein RPA4178; functionally unkn | 98.36 | |
| 2vpv_A | 166 | Protein MIF2, MIF2P; nucleus, mitosis, centromere, | 98.36 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 98.36 | |
| 2pfw_A | 116 | Cupin 2, conserved barrel domain protein; cupin do | 98.35 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 98.34 | |
| 1yhf_A | 115 | Hypothetical protein SPY1581; structural genomics, | 98.34 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 98.33 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 98.33 | |
| 1rc6_A | 261 | Hypothetical protein YLBA; structural genomics, NY | 98.32 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 98.32 | |
| 3cew_A | 125 | Uncharacterized cupin protein; all beta-protein, j | 98.31 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 98.3 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 98.3 | |
| 1juh_A | 350 | Quercetin 2,3-dioxygenase; cupin, glycoprotein, be | 98.3 | |
| 3bu7_A | 394 | Gentisate 1,2-dioxygenase; cupin domain, oxidoredu | 98.29 | |
| 3es1_A | 172 | Cupin 2, conserved barrel domain protein; YP_00116 | 98.27 | |
| 2ozi_A | 98 | Hypothetical protein RPA4178; APC6210, putative pr | 98.27 | |
| 3h7j_A | 243 | Bacilysin biosynthesis protein BACB; YWFC, bacilys | 98.27 | |
| 1sfn_A | 246 | Conserved hypothetical protein; structural genomic | 98.24 | |
| 4e2q_A | 266 | Ureidoglycine aminohydrolase; BI-cupin, manganese | 98.23 | |
| 2opk_A | 112 | Hypothetical protein; putative mannose-6-phosphate | 98.23 | |
| 3nw4_A | 368 | Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc | 98.22 | |
| 2ozj_A | 114 | Cupin 2, conserved barrel; cupin superfamily prote | 98.22 | |
| 1zrr_A | 179 | E-2/E-2' protein; nickel, cupin, beta helix, methi | 98.21 | |
| 2pyt_A | 133 | Ethanolamine utilization protein EUTQ; structural | 98.2 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 98.19 | |
| 2i45_A | 107 | Hypothetical protein; neisseria meningitidis cupin | 98.18 | |
| 1sq4_A | 278 | GLXB, glyoxylate-induced protein; structural genom | 98.15 | |
| 4axo_A | 151 | EUTQ, ethanolamine utilization protein; structural | 98.15 | |
| 4h7l_A | 157 | Uncharacterized protein; structural genomics, PSI- | 98.13 | |
| 3d82_A | 102 | Cupin 2, conserved barrel domain protein; structur | 98.13 | |
| 2q30_A | 110 | Uncharacterized protein; double-stranded beta-heli | 98.06 | |
| 3rns_A | 227 | Cupin 2 conserved barrel domain protein; structura | 98.06 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 98.01 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 97.88 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 97.87 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 97.86 | |
| 1dgw_X | 79 | Canavalin; duplicated swiss-roll beta barrels, loo | 97.85 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 97.84 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 97.82 | |
| 1o5u_A | 101 | Novel thermotoga maritima enzyme TM1112; cupin, st | 97.81 | |
| 4b29_A | 217 | Dimethylsulfoniopropionate lyase; hydrolase, dimet | 97.81 | |
| 3bcw_A | 123 | Uncharacterized protein; structural genomics, join | 97.76 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 97.73 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 97.71 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 97.68 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 97.63 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 97.61 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 97.61 | |
| 1yfu_A | 174 | 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid | 97.56 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 97.54 | |
| 1zvf_A | 176 | 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b | 97.43 | |
| 3d0j_A | 140 | Uncharacterized protein CA_C3497; beta-barrel, str | 97.38 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 97.35 | |
| 3myx_A | 238 | Uncharacterized protein pspto_0244; protein of unk | 97.31 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 97.21 | |
| 2qnk_A | 286 | 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol | 97.19 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 97.14 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 97.13 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 97.12 | |
| 3o14_A | 223 | Anti-ecfsigma factor, CHRR; cupin, structural geno | 97.03 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 97.02 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 96.98 | |
| 3es4_A | 116 | Uncharacterized protein DUF861 with A RMLC-like C; | 96.96 | |
| 2arc_A | 164 | ARAC, arabinose operon regulatory protein; transcr | 96.95 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 96.8 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 96.73 | |
| 1yud_A | 170 | Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, p | 96.68 | |
| 3ebr_A | 159 | Uncharacterized RMLC-like cupin; structural genomi | 96.56 | |
| 2q1z_B | 195 | Anti-sigma factor CHRR, transcriptional activator; | 96.52 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 96.35 | |
| 3eqe_A | 171 | Putative cystein deoxygenase; YUBC, SR112, NESG, s | 96.26 | |
| 2o1q_A | 145 | Putative acetyl/propionyl-COA carboxylase, alpha; | 96.22 | |
| 2y0o_A | 175 | Probable D-lyxose ketol-isomerase; carbohydrate me | 96.19 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 95.91 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 95.87 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 95.86 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 95.76 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 95.76 | |
| 1qwr_A | 319 | Mannose-6-phosphate isomerase; structural genomics | 95.73 | |
| 3gbg_A | 276 | TCP pilus virulence regulatory protein; cupin, hel | 95.69 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 95.68 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 95.64 | |
| 2p17_A | 277 | Pirin-like protein; GK1651, structural genomics, s | 95.58 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 95.55 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 95.48 | |
| 1zx5_A | 300 | Mannosephosphate isomerase, putative; STRU genomic | 95.47 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 95.4 | |
| 3cjx_A | 165 | Protein of unknown function with A cupin-like FOL; | 95.32 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 95.28 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 95.22 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 95.03 | |
| 4hn1_A | 201 | Putative 3-epimerase in D-allose pathway; 3'-monoe | 94.96 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 94.9 | |
| 4gjz_A | 235 | Lysine-specific demethylase 8; JMJC, beta barrel, | 94.83 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 94.62 | |
| 2gm6_A | 208 | Cysteine dioxygenase type I; structural genomics, | 94.49 | |
| 3eln_A | 200 | Cysteine dioxygenase type 1; peroxysulfenate, non- | 94.4 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 94.39 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 94.2 | |
| 3ejk_A | 174 | DTDP sugar isomerase; YP_390184.1, structural geno | 94.18 | |
| 1vrb_A | 342 | Putative asparaginyl hydroxylase; 2636534, structu | 93.91 | |
| 3bb6_A | 127 | Uncharacterized protein YEAR; structural genomics, | 93.06 | |
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 93.06 | |
| 2pa7_A | 141 | DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug | 93.01 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 92.76 | |
| 3loi_A | 172 | Putative uncharacterized protein; beta barrel, unk | 92.58 | |
| 4diq_A | 489 | Lysine-specific demethylase NO66; structural genom | 92.0 | |
| 2xdv_A | 442 | MYC-induced nuclear antigen; ribosome biogenesis, | 91.87 | |
| 1eyb_A | 471 | Homogentisate 1,2-dioxygenase; jelly roll, beta sa | 91.71 | |
| 3bal_A | 153 | Acetylacetone-cleaving enzyme; jelly roll, tetrame | 91.12 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 91.08 | |
| 3d8c_A | 349 | Hypoxia-inducible factor 1 alpha inhibitor; FIH, H | 90.69 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 90.29 | |
| 3m3i_A | 225 | Putative uncharacterized protein; PFAM:PF06172, st | 90.23 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 89.71 | |
| 3k3o_A | 371 | PHF8, PHD finger protein 8; histone demethylase, c | 89.24 | |
| 3al5_A | 338 | HTYW5, JMJC domain-containing protein C2ORF60; tRN | 89.16 | |
| 3kv9_A | 397 | JMJC domain-containing histone demethylation prote | 88.21 | |
| 1nxm_A | 197 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell | 87.79 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 87.76 | |
| 2qjv_A | 270 | Uncharacterized IOLB-like protein; structural geno | 87.11 | |
| 1znp_A | 154 | Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, | 86.56 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 86.51 | |
| 2vec_A | 256 | YHAK, pirin-like protein YHAK; ROS, bicupin, sulfe | 86.31 | |
| 2ixk_A | 184 | DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l | 85.63 | |
| 1j1l_A | 290 | Pirin; beta sandwich, cupin, iron, metatl binding | 85.57 | |
| 3uss_A | 211 | Putative uncharacterized protein; cupin, three his | 85.35 | |
| 1ep0_A | 185 | DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race | 85.34 | |
| 1xru_A | 282 | 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; | 85.04 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 84.96 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 83.8 | |
| 1dzr_A | 183 | DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, | 83.78 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 83.51 | |
| 1oi6_A | 205 | PCZA361.16; epimerase, vancomycin group antibiotic | 83.08 | |
| 3kmh_A | 246 | D-lyxose isomerase; cupin beta-barrel, structural | 83.0 | |
| 3pua_A | 392 | GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe | 82.95 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 82.75 | |
| 1upi_A | 225 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 82.4 | |
| 2c0z_A | 216 | NOVW; isomerase, epimerase, antibiotic biosynthesi | 82.3 | |
| 3k2o_A | 336 | Bifunctional arginine demethylase and lysyl-hydro | 82.27 | |
| 2yu1_A | 451 | JMJC domain-containing histone demethylation PROT; | 81.82 | |
| 1tq5_A | 242 | Protein YHHW; bicupin, pirin, montreal-kingston ba | 81.79 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 81.63 | |
| 3ryk_A | 205 | DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat | 81.3 | |
| 1wlt_A | 196 | 176AA long hypothetical DTDP-4-dehydrorhamnose 3, | 80.97 | |
| 1pmi_A | 440 | PMI, phosphomannose isomerase; aldose-ketose isome | 80.64 | |
| 2pqq_A | 149 | Putative transcriptional regulator; APC7345, strep | 80.57 |
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.2e-74 Score=567.61 Aligned_cols=314 Identities=24% Similarity=0.367 Sum_probs=286.9
Q ss_pred cccceeeccccCCCCeEEEEEeCCeEEEEEEcCCCCCC------------------------------------------
Q 020545 5 LYVHIIVCLTENDLHVIPIIIPCELGVAGMVLPNDQKH------------------------------------------ 42 (325)
Q Consensus 5 ~~~~~~~~p~h~~a~ei~yV~~G~~g~~~~v~~~~~~~------------------------------------------ 42 (325)
+.++.+++|||++|++++||++|+ |++|+|+|+|++.
T Consensus 50 i~p~Gl~lPh~~~a~e~~~V~~G~-g~~G~v~pgc~et~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 128 (466)
T 3kgl_A 50 IESKGLYLPSFFSTAKLSFVAKGE-GLMGRVVPGCAETFQDSSVFQPGGGSPFGEGQGQGQQGQGQGHQGQGQGQQGQQG 128 (466)
T ss_dssp ECTTEEEEEEEESSCEEEEEEECE-EEEEEECTTCCCCEEECCSSCCCC-------------------------------
T ss_pred ECCCCEeCCeeCCCCeEEEEEeCe-EEEEEecCCCcchhhcccccccccccccccccccccccccccccccccccccccc
Confidence 567899999999999999999999 9999999988541
Q ss_pred ------------CcceEEEEeeCCcEEEeCCCCeEEEEecCCCCEEEEEEeecCCCCC--CCcceeeeecccc-------
Q 020545 43 ------------SQEEIVLGLRKGDVIPVPLGSASWWYNNGSSDVVIVFVGETSRAYV--PGEFSYFLLTGAQ------- 101 (325)
Q Consensus 43 ------------~~~~~~~~l~~GDv~~vP~G~~~~~~N~g~~~l~~~~~~~~~~~~~--p~~~~~f~laG~~------- 101 (325)
|.++++++|++||||+||+|++||++|+|+++|+++|++|++|..| ++.++.|||||+.
T Consensus 129 ~~~~~~~~~~~~d~hqkv~~l~~GDvi~iPaG~~~~~~N~g~e~L~~l~~~d~~n~~nQld~~~~~F~LaG~~~~~~~~~ 208 (466)
T 3kgl_A 129 QQGQQSQGQGFRDMHQKVEHIRTGDTIATHPGVAQWFYNDGNQPLVIVSVLDLASHQNQLDRNPRPFYLAGNNPQGQVWI 208 (466)
T ss_dssp ----------CCEEESCEEEEETTEEEEECTTCEEEEECCSSSCEEEEEEEESSSTTCCSCSSCCEEESSCCBTTCCTTS
T ss_pred ccccccccccccccceeeccccCCCEEEECCCCcEEEEeCCCCcEEEEEEEcCCCcccccCCceeeeEecCCCccccccc
Confidence 3466778999999999999999999999999999999999988765 6779999999986
Q ss_pred ---------ccccCCChhHHhhhcCCCHHHHHHHhcccC-ceeEEEecCCcCCCCcccCCCCC----------------C
Q 020545 102 ---------GILGGFSSEFTGRAYNMNENEAKILAKSQT-GVLIIKLGQDESEKIPLPHQHGN----------------A 155 (325)
Q Consensus 102 ---------s~l~~f~~~vLa~af~v~~~~~~~l~~~q~-~~~Iv~~~~~~~~~~~~~~p~~~----------------~ 155 (325)
|+|++|++++|++||++++++++||+++|+ .+.||+++. ++.+++|... .
T Consensus 209 ~~~~~~~~~ni~sGF~~e~La~Af~v~~e~~~kL~~~q~~~G~Iv~v~~----~l~~~~p~~~~~~~~~~~~glee~~c~ 284 (466)
T 3kgl_A 209 EGREQQPQKNILNGFTPEVLAKAFKIDVRTAQQLQNQQDNRGNIIRVQG----PFSVIRPPLRSQRPQEEVNGLEETICS 284 (466)
T ss_dssp TTCTTCCBCCGGGGSCHHHHHHHHTSCHHHHHHHTCTTCCSCSEEECCS----CCCCCCCCC--------------CCSS
T ss_pred cccccccCCCccccCCHHHHHHHhCCCHHHHHHHhccccCceeEEEecC----cccccCCcccccccccccCCccccccc
Confidence 999999999999999999999999999987 568999985 5555554321 2
Q ss_pred CceeeeecC-CCCCeeccCCeEEEEEcCCCCcccccccceEEEEEecCCCccCCeecCCCCEEEEEEeCcEEEEEEeCCC
Q 020545 156 NLMVNNFAN-FPADFCVKKAGMVTSFTGSNFPFLEQVGLSCTILKLDANAMLSPTYTADSVQVFYVVKGSGKAQIVGLNA 234 (325)
Q Consensus 156 ~~~~~nl~~-~~p~~~~~~gG~~~~~~~~~~p~L~~~gis~~~v~l~pg~~~~Ph~h~~A~ei~yV~~G~~~~~vv~p~g 234 (325)
.+.+|||.+ .++|++++.||+++.+++.+||+|+++|||+++++|+||||++|||||+|+||+||++|+++++||+++|
T Consensus 285 ~r~~~Ni~~p~~~d~~~~~gG~v~~v~~~~fP~L~~lgiS~a~v~L~pGgm~~PHwHp~A~Ei~yVl~G~~rv~~V~~~g 364 (466)
T 3kgl_A 285 ARCTDNLDDPSNADVYKPQLGYISTLNSYDLPILRFLRLSALRGSIRQNAMVLPQWNANANAVLYVTDGEAHVQVVNDNG 364 (466)
T ss_dssp CCCEEETTCGGGEEEEETTTEEEEEECTTTCTTHHHHTCEEEEEEEETTEEEEEEEESSCCEEEEEEESEEEEEEECTTS
T ss_pred eeccccccCcccCCcccCCCceEEEechhhCcccccCceeeEEEEeecCcEeeeeECCCCCEEEEEEeceEEEEEEeCCC
Confidence 246899987 6778778889999999999999999999999999999999999999999999999999999999999999
Q ss_pred ceEEeEEecCccEEEECCccEEEEEcCCCCEEEEEEeCCCCCceeeecCccccccCCCHHHHHHHcCCCHHHHHHhhhcc
Q 020545 235 KLVLDSEVEAGQLLVVPRCFVVAIIAGPEGIECFSITTSTRPALGKLGGKQSVMNGFSASVVQLALNVNEEFLKFFKENV 314 (325)
Q Consensus 235 ~~~~~~~l~~Gdv~vvP~G~~h~~~~g~~~~~~~~~~~s~~p~~~~laG~~svl~~~~~evla~af~v~~~~v~~l~~~~ 314 (325)
+++|+.+|++|||||||+|++|++++++++++|++++++++|..++|+|++++|+++|++||+++|+++++++++|++++
T Consensus 365 ~~~f~~~l~~GDV~v~P~G~~H~~~ag~e~~~~l~~f~s~np~~~~LaG~~s~~~~lP~eVla~aF~v~~~~v~~Lk~~q 444 (466)
T 3kgl_A 365 DRVFDGQVSQGQLLSIPQGFSVVKRATSEQFRWIEFKTNANAQINTLAGRTSVLRGLPLEVISNGYQISLEEARRVKFNT 444 (466)
T ss_dssp CEEEEEEEETTCEEEECTTCEEEEEECSSEEEEEEEESSSSCCEEESSSTTCTGGGSCHHHHHHHHTCCHHHHHHHHHSC
T ss_pred cEEEEeEecCCcEEEECCCCeEEEEcCCCCEEEEEEECCCCCccccccchhhhhhhCCHHHHHHHhCcCHHHHHHHHhcc
Confidence 99999999999999999999999988989999999999999999999999999999999999999999999999999999
Q ss_pred CCceEecCC
Q 020545 315 ATSEILIPP 323 (325)
Q Consensus 315 ~~~~i~~~p 323 (325)
++..|+.|+
T Consensus 445 ~e~~i~~~~ 453 (466)
T 3kgl_A 445 IETTLTHSS 453 (466)
T ss_dssp CCSSEEECC
T ss_pred CccEEECCC
Confidence 998777654
|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} | Back alignment and structure |
|---|
| >3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} | Back alignment and structure |
|---|
| >2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A | Back alignment and structure |
|---|
| >1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A | Back alignment and structure |
|---|
| >3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} | Back alignment and structure |
|---|
| >1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A | Back alignment and structure |
|---|
| >3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A | Back alignment and structure |
|---|
| >3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} | Back alignment and structure |
|---|
| >2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* | Back alignment and structure |
|---|
| >2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A | Back alignment and structure |
|---|
| >3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A | Back alignment and structure |
|---|
| >2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B | Back alignment and structure |
|---|
| >1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y | Back alignment and structure |
|---|
| >1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >1dgw_Y Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_Y | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} | Back alignment and structure |
|---|
| >2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A | Back alignment and structure |
|---|
| >1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* | Back alignment and structure |
|---|
| >4i4a_A Similar to unknown protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.35A {Photorhabdus luminescens subsp} | Back alignment and structure |
|---|
| >2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} | Back alignment and structure |
|---|
| >2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 | Back alignment and structure |
|---|
| >2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A | Back alignment and structure |
|---|
| >1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 | Back alignment and structure |
|---|
| >3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} | Back alignment and structure |
|---|
| >4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >1vr3_A Acireductone dioxygenase; 13543033, structural genomics, JOI for structural genomics, JCSG, protein structure initiative oxidoreductase; 2.06A {Mus musculus} SCOP: b.82.1.6 | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 | Back alignment and structure |
|---|
| >1sef_A Conserved hypothetical protein; structural genomics, nysgxrc target T1582, PSI, protein STRU initiative; 2.05A {Enterococcus faecalis} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3lag_A Uncharacterized protein RPA4178; functionally unknown protein, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.15A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >1rc6_A Hypothetical protein YLBA; structural genomics, NYSGXRC, SGX clone NAME 3174C1TCT3B1, T T1521, PSI, protein initiative; 2.60A {Escherichia coli} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* | Back alignment and structure |
|---|
| >3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 | Back alignment and structure |
|---|
| >3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* | Back alignment and structure |
|---|
| >1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A | Back alignment and structure |
|---|
| >2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A | Back alignment and structure |
|---|
| >2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} | Back alignment and structure |
|---|
| >1zrr_A E-2/E-2' protein; nickel, cupin, beta helix, methionine salvage, oxidoreductase; NMR {Klebsiella oxytoca} SCOP: b.82.1.6 PDB: 2hji_A | Back alignment and structure |
|---|
| >2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 | Back alignment and structure |
|---|
| >4axo_A EUTQ, ethanolamine utilization protein; structural protein, bacterial microcompartment, BMC; 1.00A {Clostridium difficile} | Back alignment and structure |
|---|
| >4h7l_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, cupin, unknown function; 2.45A {Planctomyces limnophilus} | Back alignment and structure |
|---|
| >3d82_A Cupin 2, conserved barrel domain protein; structural genomics, joint center for structural genomics; 2.05A {Shewanella frigidimarina ncimb 400} | Back alignment and structure |
|---|
| >2q30_A Uncharacterized protein; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >1dgw_X Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_X | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A | Back alignment and structure |
|---|
| >4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} | Back alignment and structure |
|---|
| >3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 | Back alignment and structure |
|---|
| >3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3o14_A Anti-ecfsigma factor, CHRR; cupin, structural genomics, joint center for structura genomics, JCSG, protein structure initiative; HET: MSE; 1.70A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2arc_A ARAC, arabinose operon regulatory protein; transcription factor, carbohydrate binding, coiled-coil, jelly roll; HET: ARA; 1.50A {Escherichia coli} SCOP: b.82.4.1 PDB: 2aac_A* 1xja_A 2ara_A | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >1yud_A Hypothetical protein SO0799; SOR12, Q8E1N8, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Shewanella oneidensis} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >3ebr_A Uncharacterized RMLC-like cupin; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.60A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3eqe_A Putative cystein deoxygenase; YUBC, SR112, NESG, structural genomics, PSI-2, protein structure initiative; 2.82A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 | Back alignment and structure |
|---|
| >2y0o_A Probable D-lyxose ketol-isomerase; carbohydrate metabolism, metal-binding, sugar ISO stress response; HET: MSE; 1.23A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >1qwr_A Mannose-6-phosphate isomerase; structural genomics, D-mannose 6-phosphate, PSI, protein structure initiative; 1.80A {Bacillus subtilis} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3gbg_A TCP pilus virulence regulatory protein; cupin, helix-turn-helix, ARAC family, activator, DNA-binding transcription, transcription regulation; HET: PAM; 1.90A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >2p17_A Pirin-like protein; GK1651, structural genomics, south collaboratory for structural genomics, protein structure in secsg; 1.52A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >1zx5_A Mannosephosphate isomerase, putative; STRU genomics, PSI, protein structure initiative, midwest center structural genomics, MCSG; HET: LFR; 2.30A {Archaeoglobus fulgidus} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3cjx_A Protein of unknown function with A cupin-like FOL; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.60A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >4hn1_A Putative 3-epimerase in D-allose pathway; 3'-monoepimerase, natural product, deoxysugar, chalcomycin, mycinose, cupin fold; HET: TYD THM; 1.60A {Streptomyces bikiniensis} PDB: 4hmz_A* 4hn0_A | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >4gjz_A Lysine-specific demethylase 8; JMJC, beta barrel, Fe(II) and 2-oxoglutarate binding, oxidor; HET: AKG BME; 1.05A {Homo sapiens} PDB: 4gjy_A* 4aap_A* 3uyj_A* | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >2gm6_A Cysteine dioxygenase type I; structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, oxidoreductase; 1.84A {Ralstonia eutropha} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3eln_A Cysteine dioxygenase type 1; peroxysulfenate, non-heme dioxygenases, Fe2+ metalloenzyme, taurine, thioether, iron, metal- binding; 1.42A {Rattus norvegicus} SCOP: b.82.1.19 PDB: 2gh2_A 2b5h_A 2atf_A* 2q4s_A 2ic1_A | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, JOIN for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >1vrb_A Putative asparaginyl hydroxylase; 2636534, structural genomi center for structural genomics, JCSG, protein structure INI PSI, oxidoreductase; 2.60A {Bacillus subtilis} SCOP: b.82.2.11 | Back alignment and structure |
|---|
| >3bb6_A Uncharacterized protein YEAR; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Escherichia coli} SCOP: b.82.2.13 | Back alignment and structure |
|---|
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
| >2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >3loi_A Putative uncharacterized protein; beta barrel, unknown function; 2.10A {Branchiostoma belcheri tsingtauense} SCOP: b.82.1.0 PDB: 3lzz_A* | Back alignment and structure |
|---|
| >4diq_A Lysine-specific demethylase NO66; structural genomics, structural genomics consortium, SGC, HI demethylase, oxidoreductase; HET: PD2; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2xdv_A MYC-induced nuclear antigen; ribosome biogenesis, nuclear protein; HET: OGA; 2.57A {Homo sapiens} | Back alignment and structure |
|---|
| >1eyb_A Homogentisate 1,2-dioxygenase; jelly roll, beta sandwich, oxidoreductase; 1.90A {Homo sapiens} SCOP: b.82.1.4 PDB: 1ey2_A | Back alignment and structure |
|---|
| >3bal_A Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >3d8c_A Hypoxia-inducible factor 1 alpha inhibitor; FIH, HIF, DSBH, oxygenase, transcription, inhibitor oxoglutarate, asparaginyl hydroxylase; HET: AKG; 2.10A {Homo sapiens} PDB: 2ilm_A* 2w0x_A* 1h2l_A* 1h2m_A* 1h2n_A* 1yci_A* 2cgn_A 2cgo_A* 1h2k_A* 2wa3_A* 2wa4_A* 3od4_A* 3p3n_A* 3p3p_A* 2yc0_A* 2y0i_A* 2yde_A* 1mze_A* 1mzf_A* 2xum_A* ... | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3m3i_A Putative uncharacterized protein; PFAM:PF06172, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP; 2.35A {Leishmania major} | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3k3o_A PHF8, PHD finger protein 8; histone demethylase, chromatin modification, methylated H3K9, mental retardation, metal-BI phosphoprotein, zinc-finger; HET: AKG; 2.10A {Homo sapiens} PDB: 3k3n_A* 4do0_A* 2wwu_A* | Back alignment and structure |
|---|
| >3al5_A HTYW5, JMJC domain-containing protein C2ORF60; tRNA modification enzyme, unknown function; 2.50A {Homo sapiens} PDB: 3al6_A* | Back alignment and structure |
|---|
| >3kv9_A JMJC domain-containing histone demethylation protein 1D; jumonji domain lysine demethylase, metal-binding, zinc, zinc-finger; 2.29A {Homo sapiens} PDB: 3kva_A* 3kvb_A* 3u78_A* | Back alignment and structure |
|---|
| >1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >1znp_A Hypothetical protein ATU3615; NESG, ATR55, Q8U9W0, structural genomics, PSI, protein struc initiative; 2.50A {Agrobacterium tumefaciens str} SCOP: b.82.1.16 | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2vec_A YHAK, pirin-like protein YHAK; ROS, bicupin, sulfenic acid, reactive cysteine, cytosolic protein; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* | Back alignment and structure |
|---|
| >1j1l_A Pirin; beta sandwich, cupin, iron, metatl binding protein; 2.10A {Homo sapiens} SCOP: b.82.1.12 PDB: 3acl_A* | Back alignment and structure |
|---|
| >3uss_A Putative uncharacterized protein; cupin, three histidine, non-heme iron, cysteine catabolism, oxidoreductase; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.19 | Back alignment and structure |
|---|
| >1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* | Back alignment and structure |
|---|
| >1xru_A 4-deoxy-L-threo-5-hexosulose-uronate ketol-isomer; beta barrel, cupin, isomerase; HET: 1PE; 1.94A {Escherichia coli} SCOP: b.82.1.13 PDB: 1x8m_A | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >1dzr_A DTDP-4-dehydrorhamnose 3\,5-epimerase; isomerase, 3\,5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A | Back alignment and structure |
|---|
| >3kmh_A D-lyxose isomerase; cupin beta-barrel, structural genomics, montreal-kingston BA structural genomics initiative, BSGI; 1.58A {Escherichia coli O157} PDB: 3mpb_A* | Back alignment and structure |
|---|
| >3pua_A GRC5, PHD finger protein 2; alpha-ketoglutarate-Fe2+ dependent dioxygenases, histone TAI protein, protein binding; HET: OGA; 1.89A {Homo sapiens} PDB: 3pu3_A* 3ptr_B* 3pu8_B* 3pus_A* | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* | Back alignment and structure |
|---|
| >2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 | Back alignment and structure |
|---|
| >3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* | Back alignment and structure |
|---|
| >2yu1_A JMJC domain-containing histone demethylation PROT; JMJC-domain-containing histone demethylases, oxidoreductase; HET: AKG; 2.70A {Homo sapiens} PDB: 2yu2_A | Back alignment and structure |
|---|
| >1tq5_A Protein YHHW; bicupin, pirin, montreal-kingston bacterial structural genomics initiative, BSGI, structural genomics, unknown function; 1.76A {Escherichia coli} SCOP: b.82.1.12 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >3ryk_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, STRU genomics, infectious diseases; HET: TYD; 1.63A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A | Back alignment and structure |
|---|
| >1pmi_A PMI, phosphomannose isomerase; aldose-ketose isomerase; 1.70A {Candida albicans} SCOP: b.82.1.3 | Back alignment and structure |
|---|
| >2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 325 | ||||
| d1fxza2 | 174 | b.82.1.2 (A:297-470) Seed storage 7S protein {Soyb | 1e-26 | |
| d1od5a2 | 173 | b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb | 2e-26 | |
| d1od5a2 | 173 | b.82.1.2 (A:321-493) Seed storage 7S protein {Soyb | 0.002 | |
| d1j58a_ | 372 | b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B | 5e-24 | |
| d1j58a_ | 372 | b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {B | 2e-16 | |
| g1dgw.1 | 168 | b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea | 5e-22 | |
| g1dgw.1 | 168 | b.82.1.2 (X:,Y:) Seed storage 7S protein {Jack bea | 1e-06 | |
| d1uika2 | 185 | b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb | 8e-19 | |
| d1uika2 | 185 | b.82.1.2 (A:351-535) Seed storage 7S protein {Soyb | 1e-09 | |
| d2phla1 | 200 | b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc | 2e-17 | |
| d2phla1 | 200 | b.82.1.2 (A:11-210) Seed storage 7S protein {Frenc | 2e-09 | |
| d2et1a1 | 201 | b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare | 1e-15 | |
| d2et1a1 | 201 | b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare | 2e-06 | |
| d1od5a1 | 245 | b.82.1.2 (A:7-251) Seed storage 7S protein {Soybea | 2e-15 | |
| d1fxza1 | 239 | b.82.1.2 (A:10-248) Seed storage 7S protein {Soybe | 2e-14 | |
| d1uika1 | 203 | b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb | 6e-14 | |
| d1uika1 | 203 | b.82.1.2 (A:148-350) Seed storage 7S protein {Soyb | 2e-11 | |
| d1dgwa_ | 178 | b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( | 7e-12 | |
| d1dgwa_ | 178 | b.82.1.2 (A:) Seed storage 7S protein {Jack bean ( | 5e-11 | |
| d2phla2 | 162 | b.82.1.2 (A:220-381) Seed storage 7S protein {Fren | 9e-12 | |
| d2phla2 | 162 | b.82.1.2 (A:220-381) Seed storage 7S protein {Fren | 1e-07 | |
| d1uija1 | 170 | b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea | 4e-11 | |
| d1uija1 | 170 | b.82.1.2 (A:6-175) Seed storage 7S protein {Soybea | 5e-10 | |
| d1y3ta1 | 330 | b.82.1.5 (A:5-334) Hypothetical protein YxaG {Baci | 2e-05 | |
| d3bu7a1 | 355 | b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Si | 6e-05 | |
| d1juha_ | 348 | b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergill | 7e-04 | |
| d2phda1 | 351 | b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Ps | 0.001 |
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 174 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Germin/Seed storage 7S protein domain: Seed storage 7S protein species: Soybean (Glycine max), proglycinin [TaxId: 3847]
Score = 101 bits (253), Expect = 1e-26
Identities = 50/158 (31%), Positives = 79/158 (50%), Gaps = 1/158 (0%)
Query: 167 ADFCVKKAGMVTSFTGSNFPFLEQVGLSCTILKLDANAMLSPTYTADSVQVFYVVKGSGK 226
D +AG VT+ T +FP L + LS L NAM P Y ++ + Y + G
Sbjct: 16 PDIYNPQAGSVTTATSLDFPALSWLRLSAEFGSLRKNAMFVPHYNLNANSIIYALNGRAL 75
Query: 227 AQIVGLNAKLVLDSEVEAGQLLVVPRCFVVAIIAGPEGIECFSITTSTRPALGKLGGKQS 286
Q+V N + V D E++ G++L+VP+ FVVA + + E S T+ P +G L G S
Sbjct: 76 IQVVNCNGERVFDGELQEGRVLIVPQNFVVAARSQSDNFEYVSFKTNDTPMIGTLAGANS 135
Query: 287 VMNGFSASVVQLALNVNEEFLKFFKENVATSEILIPPK 324
++N V+Q N+ + + K N + L+PP+
Sbjct: 136 LLNALPEEVIQHTFNLKSQQARQIKNN-NPFKFLVPPQ 172
|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 173 | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Length = 372 | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 185 | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 200 | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Length = 201 | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Length = 245 | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Length = 239 | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Length = 178 | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Length = 162 | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Length = 170 | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Length = 330 | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} Length = 355 | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Length = 348 | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Length = 351 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 325 | |||
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 100.0 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 100.0 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 100.0 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 100.0 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 100.0 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 100.0 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 99.98 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 99.98 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 99.97 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.97 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 99.97 | |
| d2phla1 | 200 | Seed storage 7S protein {French bean (Phaseolus vu | 99.96 | |
| d1od5a1 | 245 | Seed storage 7S protein {Soybean (Glycine max), gl | 99.96 | |
| d1fxza1 | 239 | Seed storage 7S protein {Soybean (Glycine max), pr | 99.96 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 99.96 | |
| d1dgwa_ | 178 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.95 | |
| d1uika1 | 203 | Seed storage 7S protein {Soybean (Glycine max), be | 99.95 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 99.95 | |
| d1j58a_ | 372 | Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil | 99.94 | |
| d1uija1 | 170 | Seed storage 7S protein {Soybean (Glycine max), be | 99.94 | |
| d1uika2 | 185 | Seed storage 7S protein {Soybean (Glycine max), be | 99.94 | |
| d2phla2 | 162 | Seed storage 7S protein {French bean (Phaseolus vu | 99.93 | |
| d1fxza2 | 174 | Seed storage 7S protein {Soybean (Glycine max), pr | 99.93 | |
| g1dgw.1 | 168 | Seed storage 7S protein {Jack bean (Canavalia ensi | 99.92 | |
| d1od5a2 | 173 | Seed storage 7S protein {Soybean (Glycine max), gl | 99.9 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 99.89 | |
| d2et1a1 | 201 | Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | 99.86 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 99.77 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 99.75 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 99.72 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 99.7 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 99.69 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 99.69 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 99.6 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 99.57 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 99.19 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 99.1 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 99.1 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 99.08 | |
| d1o4ta_ | 115 | Hypothetical protein TM1287 {Thermotoga maritima [ | 98.98 | |
| d2b8ma1 | 108 | Hypothetical protein MJ0764 {Archaeon Methanococcu | 98.98 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 98.94 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 98.92 | |
| d1lr5a_ | 160 | Auxin binding protein {Maize (Zea mays) [TaxId: 45 | 98.92 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 98.92 | |
| d1x82a_ | 190 | Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc | 98.92 | |
| d1vj2a_ | 114 | Hypothetical protein TM1459 {Thermotoga maritima [ | 98.88 | |
| d1v70a_ | 105 | Hypothetical protein TTHA0104 {Thermus thermophilu | 98.85 | |
| d1juha_ | 348 | Quercetin 2,3-dioxygenase {Aspergillus japonicus [ | 98.85 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 98.82 | |
| d1y9qa2 | 99 | Probable transcriptional regulator VC1968, C-termi | 98.8 | |
| d2d40a1 | 308 | Gentisate 1,2-dioxygenase {Escherichia coli [TaxId | 98.7 | |
| d1sfna_ | 245 | Hypothetical protein DR1152 {Deinococcus radiodura | 98.61 | |
| d1sq4a_ | 273 | Glyoxylate-induced protein PA1140 {Pseudomonas aer | 98.58 | |
| d2phda1 | 351 | Gentisate 1,2-dioxygenase {Pseudaminobacter salicy | 98.57 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 98.57 | |
| d2f4pa1 | 134 | Hypothetical protein TM1010 {Thermotoga maritima [ | 98.57 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 98.56 | |
| d1sefa_ | 250 | Hypothetical protein EF2996 {Enterococcus faecalis | 98.53 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 98.51 | |
| d1y3ta1 | 330 | Hypothetical protein YxaG {Bacillus subtilis [TaxI | 98.5 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 98.47 | |
| d1rc6a_ | 253 | Hypothetical protein YlbA {Escherichia coli [TaxId | 98.4 | |
| d2pyta1 | 128 | Ethanolamine utilization protein EutQ {Salmonella | 98.37 | |
| d1yhfa1 | 112 | Hypothetical protein SPy1581 {Streptococcus pyogen | 98.36 | |
| d3bu7a1 | 355 | Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [ | 98.32 | |
| d2bnma2 | 122 | Hydroxypropylphosphonic acid epoxidase Fom4, C-ter | 98.29 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 98.29 | |
| d1zrra1 | 179 | Acireductone dioxygenase {Klebsiella pneumoniae [T | 98.19 | |
| d1vr3a1 | 179 | Acireductone dioxygenase {Mouse (Mus musculus) [Ta | 98.14 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 97.72 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 97.62 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 97.51 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 97.33 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 97.1 | |
| d1o5ua_ | 88 | Hypothetical protein TM1112 {Thermotoga maritima [ | 96.86 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 96.8 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 96.23 | |
| d2pa7a1 | 135 | dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Ane | 96.11 | |
| d2arca_ | 161 | Regulatory protein AraC {Escherichia coli [TaxId: | 96.1 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 96.09 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 96.01 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 95.88 | |
| d1oi6a_ | 202 | dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc | 95.86 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 95.85 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 95.77 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 95.75 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 95.71 | |
| d1yfua1 | 174 | 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m | 95.67 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 95.55 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 95.52 | |
| d1j1la_ | 288 | Pirin {Human (Homo sapiens) [TaxId: 9606]} | 95.51 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 95.39 | |
| d1vrba1 | 319 | Putative asparaginyl hydroxylase YxbC {Bacillus su | 95.35 | |
| d1zvfa1 | 175 | 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yea | 95.32 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 95.27 | |
| d1eyba_ | 439 | Homogentisate dioxygenase {Human (Homo sapiens) [T | 94.42 | |
| d2o1qa1 | 144 | Putative acetyl/propionyl-CoA carboxylase subunit | 92.17 | |
| d1h2ka_ | 335 | Hypoxia-inducible factor HIF ihhibitor (FIH1) {Hum | 91.89 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 90.83 | |
| d1pmia_ | 440 | Phosphomannose isomerase {Yeast (Candida albicans) | 89.81 | |
| d1dzra_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmone | 88.8 | |
| d1oi6a_ | 202 | dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amyc | 87.26 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 87.19 | |
| d1znpa1 | 140 | Hypothetical protein Atu3615 {Agrobacterium tumefa | 86.99 | |
| d2ixca1 | 198 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobac | 86.66 | |
| d2gm6a1 | 192 | Cysteine dioxygenase type I {Ralstonia eutropha [T | 86.54 | |
| d1yuda1 | 158 | Hypothetical protein SO0799 {Shewanella oneidensis | 86.39 | |
| d1wlta1 | 176 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 85.06 | |
| d1ep0a_ | 183 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeo | 84.39 | |
| d2c0za1 | 190 | Novobiocin biosynthesis protein NovW {Streptomyces | 83.93 | |
| d2ixha1 | 184 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudom | 83.7 | |
| d1nxma_ | 194 | dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Strepto | 82.16 | |
| d2oz6a2 | 134 | Cyclic AMP receptor-like protein Vfr {Pseudomonas | 81.95 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 81.88 | |
| d3elna1 | 186 | Cysteine dioxygenase type I {Rattus norvegicus [Ta | 81.66 | |
| d1qwra_ | 315 | Mannose-6-phosphate isomerase ManA {Bacillus subti | 81.54 | |
| d1i5za2 | 132 | Catabolite gene activator protein, N-terminal doma | 80.21 | |
| d2zcwa2 | 112 | Transcriptional regulator TTHA1359, N-terminal dom | 80.16 |
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Double-stranded beta-helix superfamily: RmlC-like cupins family: Germin/Seed storage 7S protein domain: Oxalate decarboxylase OxdC (YvrK) species: Bacillus subtilis [TaxId: 1423]
Probab=100.00 E-value=7.9e-53 Score=404.29 Aligned_cols=288 Identities=15% Similarity=0.145 Sum_probs=243.2
Q ss_pred cccceeeccccCCCCeEEEEEeCCeEEEEEEcCCCCCCCcceEEEEeeCCcEEEeCCCCeEEEEecCCCCEEEEEEeecC
Q 020545 5 LYVHIIVCLTENDLHVIPIIIPCELGVAGMVLPNDQKHSQEEIVLGLRKGDVIPVPLGSASWWYNNGSSDVVIVFVGETS 84 (325)
Q Consensus 5 ~~~~~~~~p~h~~a~ei~yV~~G~~g~~~~v~~~~~~~~~~~~~~~l~~GDv~~vP~G~~~~~~N~g~~~l~~~~~~~~~ 84 (325)
|++.++..|||+.+.||.||++|+ |++++|++++ +.++.+|++||+|+||+|++||++|. +++++++.+++..
T Consensus 79 L~pga~~~pH~H~~ae~~yVl~G~-~~vt~Vd~~G-----~~~~~~l~~GDv~~~P~G~~H~i~n~-~dg~e~l~vf~~~ 151 (372)
T d1j58a_ 79 LKPGAIRELHWHKEAEWAYMIYGS-ARVTIVDEKG-----RSFIDDVGEGDLWYFPSGLPHSIQAL-EEGAEFLLVFDDG 151 (372)
T ss_dssp ECTTCEEEEEEESSCEEEEEEEEE-EEEEEECTTS-----CEEEEEEETTEEEEECTTCCEEEEEE-EEEEEEEEEESCT
T ss_pred ECCCcCcCCcccCcccEEEEEeCE-EEEEEEeCCC-----cEEEEEeccCCEEEECCCCEEEEEeC-CCCcEEEEEECCC
Confidence 789999999987778999999999 9999999986 66678999999999999999999996 4578888888644
Q ss_pred CCCCCCcceeeeeccccccccCCChhHHhhhcCCCHHHHHHHhcccCceeEEEecCCcC-CCCcccCCCC-CCCceeeee
Q 020545 85 RAYVPGEFSYFLLTGAQGILGGFSSEFTGRAYNMNENEAKILAKSQTGVLIIKLGQDES-EKIPLPHQHG-NANLMVNNF 162 (325)
Q Consensus 85 ~~~~p~~~~~f~laG~~s~l~~f~~~vLa~af~v~~~~~~~l~~~q~~~~Iv~~~~~~~-~~~~~~~p~~-~~~~~~~nl 162 (325)
++.....|.+ .++|++||.|||++||+++++++++|++.|. +|+....++. .......+.+ ....+.||+
T Consensus 152 ---~~~~~~~f~~---~~~~~~~p~evLa~af~v~~~~~~~i~~~e~--~i~~~~~p~~~~~~~~~~~~g~~~~~~~~~l 223 (372)
T d1j58a_ 152 ---SFSENSTFQL---TDWLAHTPKEVIAANFGVTKEEISNLPGKEK--YIFENQLPGSLKDDIVEGPNGEVPYPFTYRL 223 (372)
T ss_dssp ---TCCGGGEEEH---HHHHHTSCHHHHHHHHTCCTGGGTTSCSSCC--SEECCCCCCCHHHHCCCCTTCCCSSCSEEEG
T ss_pred ---Ccccccceee---ccccccCCHHHHHHhhCCCHHHHhhcccccc--ccccccCCCcchhhhccCCCCCCCCcceeec
Confidence 3444445543 4999999999999999999999999998874 4665433211 0000111211 245789999
Q ss_pred cCCCCCeeccCCeEEEEEcCCCCcccccccceEEEEEecCCCccCCeecCCCCEEEEEEeCcEEEEEEeCCCceEEeEEe
Q 020545 163 ANFPADFCVKKAGMVTSFTGSNFPFLEQVGLSCTILKLDANAMLSPTYTADSVQVFYVVKGSGKAQIVGLNAKLVLDSEV 242 (325)
Q Consensus 163 ~~~~p~~~~~~gG~~~~~~~~~~p~L~~~gis~~~v~l~pg~~~~Ph~h~~A~ei~yV~~G~~~~~vv~p~g~~~~~~~l 242 (325)
.+++| +.+ .||+++++++.+||+++ +|++++++|+||+|++|||||+|+||.||++|+++++|++++|+ ..+.++
T Consensus 224 ~~q~P-~~~-~gG~~~~~d~~~fp~~~--~is~~~~~l~PG~~~~~H~Hp~a~E~~yvl~G~g~v~v~~~~g~-~~t~~l 298 (372)
T d1j58a_ 224 LEQEP-IES-EGGKVYIADSTNFKVSK--TIASALVTVEPGAMRELHWHPNTHEWQYYISGKARMTVFASDGH-ARTFNY 298 (372)
T ss_dssp GGSCC-EEC-SSEEEEEESTTTSTTCC--SCEEEEEEECTTCEEEEEECSSSCEEEEEEESEEEEEEEEETTE-EEEEEE
T ss_pred cccCC-ccc-CCccEEEeccccCCccC--ceeEEEEEECCCcccCCCCCCCCcEEEEEEECeEEEEEEcCCCc-eEEEEe
Confidence 99888 544 68999999999999998 57999999999999999999999999999999999999999875 556789
Q ss_pred cCccEEEECCccEEEEEc-CCCCEEEEEEeCCCCCceeeecCccccccCCCHHHHHHHcCCCHHHHHHhhhccC
Q 020545 243 EAGQLLVVPRCFVVAIIA-GPEGIECFSITTSTRPALGKLGGKQSVMNGFSASVVQLALNVNEEFLKFFKENVA 315 (325)
Q Consensus 243 ~~Gdv~vvP~G~~h~~~~-g~~~~~~~~~~~s~~p~~~~laG~~svl~~~~~evla~af~v~~~~v~~l~~~~~ 315 (325)
++||+++||+|++|++.| |+++++++.++++++++...+ +++|..+|++||+++|+++++++++|+++++
T Consensus 299 ~~GDv~~iP~g~~H~i~N~g~e~l~~l~vf~s~~~~~i~~---~~~l~~~P~~vv~~~~~~~~e~~~~l~~~k~ 369 (372)
T d1j58a_ 299 QAGDVGYVPFAMGHYVENIGDEPLVFLEIFKDDHYADVSL---NQWLAMLPETFVQAHLDLGKDFTDVLSKEKH 369 (372)
T ss_dssp ESSCEEEECTTCBEEEEECSSSCEEEEEEESSSSCCCEEH---HHHHHTSCHHHHHHHHTCCHHHHTTCCSSCC
T ss_pred cCCcEEEECCCCeEEEEECCCCCEEEEEEECCCCcceeeH---HHHhhhCCHHHHHHHhCcCHHHHHHHHhcCC
Confidence 999999999999999665 889999999999999887666 5899999999999999999999999987664
|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1od5a1 b.82.1.2 (A:7-251) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1fxza1 b.82.1.2 (A:10-248) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pyta1 b.82.1.24 (A:100-227) Ethanolamine utilization protein EutQ {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d3bu7a1 b.82.1.23 (A:19-373) Gentisate 1,2-dioxygenase {Silicibacter pomeroyi [TaxId: 89184]} | Back information, alignment and structure |
|---|
| >d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zrra1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1vr3a1 b.82.1.6 (A:1-179) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} | Back information, alignment and structure |
|---|
| >d2arca_ b.82.4.1 (A:) Regulatory protein AraC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d1j1la_ b.82.1.12 (A:) Pirin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1vrba1 b.82.2.11 (A:8-326) Putative asparaginyl hydroxylase YxbC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eyba_ b.82.1.4 (A:) Homogentisate dioxygenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o1qa1 b.82.1.21 (A:1-144) Putative acetyl/propionyl-CoA carboxylase subunit alpha Mpe_A3659 {Rubrivivax gelatinosus [TaxId: 28068]} | Back information, alignment and structure |
|---|
| >d1h2ka_ b.82.2.6 (A:) Hypoxia-inducible factor HIF ihhibitor (FIH1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pmia_ b.82.1.3 (A:) Phosphomannose isomerase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1znpa1 b.82.1.16 (A:4-143) Hypothetical protein Atu3615 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gm6a1 b.82.1.19 (A:11-202) Cysteine dioxygenase type I {Ralstonia eutropha [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1yuda1 b.82.1.16 (A:1-158) Hypothetical protein SO0799 {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} | Back information, alignment and structure |
|---|
| >d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3elna1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qwra_ b.82.1.3 (A:) Mannose-6-phosphate isomerase ManA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|