Citrus Sinensis ID: 020609

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320---
MEGGGGGGRRISASPRPCSGRRVLAKKRRRNWAGFDGFVNSVKKLQRREISSKRDRAFTMTDAQERFRNIRLQEEYDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDESNSGCLELSRRACNVV
cccccccccEEEcccccccccccEEccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHccccccccccccccccccccHHccccccEEEEEEccHHHHHHHHcccHHHHHcccccEEEEEccccccEEEEEEEEccccEEEEEEEEEcccccEEEEEEEEHHHHHccccccccccEEccccccccEEEEcccccEEEEEEccccEEEEEEEcccEEEEEEccccEEEEEEcccEEEEEEEccccEEEEEEEEEEcccEEEEEEEccccccccHHHHHcccEEEEEEccccEEEEEcccccEEEEcccccccc
cccccccccEEEEccccccccEEEEEHcccccccccccHHHHHHHHHHHcccccccccccccHHHHHHHccHHHHHcccccccccccEHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHEEcccccEEEEEccccccEEEEEEEEccccEEEEEEEEEccccccEEEEEccHHHHHHcccccccccEcEEEEccccEEEEEccccEEEEEEccccEEEEEEccccEEEEEEccccEEEEEEcccEEEEEEEcccccEEEEEEEEccccEEEEEEEEcccccccHHHHHHHcEEEEEEccccEEEEEcccccEEEEcccccccc
meggggggrrisasprpcsgrrvLAKKrrrnwagfdgfVNSVKKLQRREISSKRDRAFTMTDAQERFRNIRlqeeydthdpkghcsmvlpflrKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYAsdnfsslrcRSTRIEYIrrgkpdagfalfeseslkwpgfvefddvngkvltysaqdsiykvfdlknyTMLYSISDknvqeikispgIMLLIFTkasghvplkilsiedgtVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENenlqildesnsgclELSRRACNVV
meggggggrrisasprpcsgrrvlakkrrrnwagfdgfvnsvkklqrreisskrdraftmtdaqeRFRNIRLqeeydthdpkghcSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSvyasdnfsslrcRSTRIEYIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENEnlqildesnsgclelsrracnvv
MEggggggRRISASPRPCSGRRVLAKKRRRNWAGFDGFVNSVKKLQRREISSKRDRAFTMTDAQERFRNIRLQEEYDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDESNSGCLELSRRACNVV
*****************************RNWAGFDGFVNSV***************************IRL***YDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQI*******************
*******************************************KLQRREI***********DAQERFRNIRLQEEYDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDESNSGCLELSRRACNV*
**********************VLAKKRRRNWAGFDGFVNSVKKLQRREISSKRDRAFTMTDAQERFRNIRLQEEYDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDESNSGCLEL********
*********RISASPRPCSGRRVLAKKRR**W*****FVN*********IS******FTMTDAQERFRNIRLQEEYDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDESNSGCLELSRRACNV*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGGGGGGRRISASPRPCSGRRVLAKKRRRNWAGFDGFVNSVKKLQRREISSKRDRAFTMTDAQERFRNIRLQEEYDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDESNSGCLELSRRACNVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
224127814 474 predicted protein [Populus trichocarpa] 0.969 0.660 0.904 1e-163
147825153 481 hypothetical protein VITISV_027347 [Viti 0.947 0.636 0.909 1e-161
225448335 482 PREDICTED: uncharacterized protein LOC10 0.947 0.634 0.909 1e-161
359486434 484 PREDICTED: uncharacterized protein LOC10 0.947 0.632 0.909 1e-161
297736651 464 unnamed protein product [Vitis vinifera] 0.947 0.659 0.909 1e-161
449449823 474 PREDICTED: uncharacterized protein LOC10 0.947 0.645 0.887 1e-158
449510979 477 PREDICTED: uncharacterized protein LOC10 0.947 0.641 0.887 1e-158
356500805 479 PREDICTED: uncharacterized protein LOC10 0.956 0.645 0.894 1e-157
255557887 470 conserved hypothetical protein [Ricinus 0.947 0.651 0.874 1e-157
357464341 484 hypothetical protein MTR_3g093520 [Medic 0.965 0.644 0.885 1e-156
>gi|224127814|ref|XP_002329184.1| predicted protein [Populus trichocarpa] gi|222870965|gb|EEF08096.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  580 bits (1495), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 283/313 (90%), Positives = 298/313 (95%)

Query: 5   GGGGRRISASPRPCSGRRVLAKKRRRNWAGFDGFVNSVKKLQRREISSKRDRAFTMTDAQ 64
           GGGGRRI+ SPRPC+G+RV+AKKR R++ G DGFVNSVKKLQRREI SKRDR+FTMTDAQ
Sbjct: 3   GGGGRRITVSPRPCNGKRVVAKKRGRSFGGGDGFVNSVKKLQRREICSKRDRSFTMTDAQ 62

Query: 65  ERFRNIRLQEEYDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRET 124
           ERFRNIRLQEEYDT+DPKGHC+MVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAF RET
Sbjct: 63  ERFRNIRLQEEYDTYDPKGHCTMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFSRET 122

Query: 125 NQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGF 184
           NQRICFLNVT DEVIRSLFYNKNNDSLITVSVYASDNFSSL+CRSTRIEYIRRG+PDAGF
Sbjct: 123 NQRICFLNVTPDEVIRSLFYNKNNDSLITVSVYASDNFSSLKCRSTRIEYIRRGQPDAGF 182

Query: 185 ALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPG 244
           ALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSI+DKNVQEIKISPG
Sbjct: 183 ALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSIADKNVQEIKISPG 242

Query: 245 IMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQI 304
           IMLLI TK+SG VPL+ILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQI
Sbjct: 243 IMLLILTKSSGCVPLEILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQI 302

Query: 305 LDESNSGCLELSR 317
           LD  N    E+SR
Sbjct: 303 LDVRNFDLTEVSR 315

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|147825153|emb|CAN75497.1| hypothetical protein VITISV_027347 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225448335|ref|XP_002266566.1| PREDICTED: uncharacterized protein LOC100263968 isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359486434|ref|XP_002266694.2| PREDICTED: uncharacterized protein LOC100263968 isoform 3 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297736651|emb|CBI25522.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449449823|ref|XP_004142664.1| PREDICTED: uncharacterized protein LOC101207987 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449510979|ref|XP_004163828.1| PREDICTED: uncharacterized protein LOC101230142 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356500805|ref|XP_003519221.1| PREDICTED: uncharacterized protein LOC100777719 [Glycine max] Back     alignment and taxonomy information
>gi|255557887|ref|XP_002519972.1| conserved hypothetical protein [Ricinus communis] gi|223540736|gb|EEF42296.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357464341|ref|XP_003602452.1| hypothetical protein MTR_3g093520 [Medicago truncatula] gi|355491500|gb|AES72703.1| hypothetical protein MTR_3g093520 [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query323
TAIR|locus:2080305 467 AT3G54190 "AT3G54190" [Arabido 0.944 0.653 0.854 1.5e-138
TAIR|locus:2064201 467 AT2G38630 "AT2G38630" [Arabido 0.944 0.653 0.816 6.4e-131
TAIR|locus:2080305 AT3G54190 "AT3G54190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1356 (482.4 bits), Expect = 1.5e-138, P = 1.5e-138
 Identities = 264/309 (85%), Positives = 288/309 (93%)

Query:     9 RRISASPRPCSGRRVLAKKRRRNWAGFDGFVNSVKKLQRREISSKRDRAFTMTDAQERFR 68
             RRI+ASPRPCSGRR++AKKR R     DGFVNSVKKLQRREISS++DRAF+++ AQERFR
Sbjct:     4 RRITASPRPCSGRRIVAKKRSRP----DGFVNSVKKLQRREISSRKDRAFSISTAQERFR 59

Query:    69 NIRLQEEYDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRI 128
             N+RL E+YDTHDPKGHC + LPFL KR+K+IEIVAARDIVFALA SGVCAAF RE+N+RI
Sbjct:    60 NMRLVEQYDTHDPKGHCLVALPFLMKRTKVIEIVAARDIVFALAHSGVCAAFSRESNKRI 119

Query:   129 CFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFE 188
             CFLNV+ DEVIRSLFYNKNNDSLITVSVYASDNFSSL+CRSTRIEYI RG+PDAGFALFE
Sbjct:   120 CFLNVSPDEVIRSLFYNKNNDSLITVSVYASDNFSSLKCRSTRIEYILRGQPDAGFALFE 179

Query:   189 SESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLL 248
             SESLKWPGFVEFDDVNGKVLTYSAQDS+YKVFDLKNYTMLYSISDKNVQEIKISPGIMLL
Sbjct:   180 SESLKWPGFVEFDDVNGKVLTYSAQDSVYKVFDLKNYTMLYSISDKNVQEIKISPGIMLL 239

Query:   249 IFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDES 308
             IF +A+ HVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILD  
Sbjct:   240 IFKRAASHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDVR 299

Query:   309 NSGCLELSR 317
             N+  +E+SR
Sbjct:   300 NAELMEVSR 308
GO:0003674 "molecular_function" evidence=ND
GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0010413 "glucuronoxylan metabolic process" evidence=RCA
GO:0045492 "xylan biosynthetic process" evidence=RCA
TAIR|locus:2064201 AT2G38630 "AT2G38630" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 323
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 98.03
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.67
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.53
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 97.42
PLN00181 793 protein SPA1-RELATED; Provisional 97.08
PTZ00420 568 coronin; Provisional 95.98
PTZ00421 493 coronin; Provisional 95.82
PLN00181793 protein SPA1-RELATED; Provisional 95.75
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 95.74
KOG0266456 consensus WD40 repeat-containing protein [General 95.62
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 95.31
PTZ00420 568 coronin; Provisional 94.89
PTZ00421 493 coronin; Provisional 94.84
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 94.37
KOG0289506 consensus mRNA splicing factor [General function p 94.06
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 93.28
KOG1446 311 consensus Histone H3 (Lys4) methyltransferase comp 93.06
KOG0295406 consensus WD40 repeat-containing protein [Function 92.17
KOG0279315 consensus G protein beta subunit-like protein [Sig 91.06
KOG0266 456 consensus WD40 repeat-containing protein [General 91.04
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 89.71
KOG0316307 consensus Conserved WD40 repeat-containing protein 88.51
KOG0295406 consensus WD40 repeat-containing protein [Function 86.56
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 85.82
KOG1036 323 consensus Mitotic spindle checkpoint protein BUB3, 84.87
KOG0281 499 consensus Beta-TrCP (transducin repeats containing 83.75
PF15065 350 NCU-G1: Lysosomal transcription factor, NCU-G1 82.83
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 82.46
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 82.35
COG2319466 FOG: WD40 repeat [General function prediction only 81.6
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information 
Probab=98.03  E-value=0.0016  Score=52.60  Aligned_cols=196  Identities=18%  Similarity=0.306  Sum_probs=120.8

Q ss_pred             cceeEEeecc--chhhhhhccccceeeecccccEEEEEeCCCCceEEEEEeecCCCeEEEEEeEecCCCceeeeeeeehh
Q 020609           96 SKIIEIVAAR--DIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIE  173 (323)
Q Consensus        96 S~V~EIv~a~--diI~aL~~sG~c~af~r~tn~~iC~LN~s~dEvIrSiFyNk~NdSlItvSvy~sd~fS~LkCr~~~i~  173 (323)
                      .+|..+-...  +++++-...|....|+..+++.+..+... ...|.++-+...++.+++.+.   |.  .++...    
T Consensus        10 ~~i~~~~~~~~~~~l~~~~~~g~i~i~~~~~~~~~~~~~~~-~~~i~~~~~~~~~~~l~~~~~---~~--~i~i~~----   79 (289)
T cd00200          10 GGVTCVAFSPDGKLLATGSGDGTIKVWDLETGELLRTLKGH-TGPVRDVAASADGTYLASGSS---DK--TIRLWD----   79 (289)
T ss_pred             CCEEEEEEcCCCCEEEEeecCcEEEEEEeeCCCcEEEEecC-CcceeEEEECCCCCEEEEEcC---CC--eEEEEE----
Confidence            4454444443  56666667899999999988876666543 444566666666666666442   21  222222    


Q ss_pred             hhhhCCCCCCCcceeecccCCCCeEEecCCCceEEEEecCCCeEEEEeccCcEEEEEecc--cceeeEEEcC-CEEEEEE
Q 020609          174 YIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISD--KNVQEIKISP-GIMLLIF  250 (323)
Q Consensus       174 ~i~~Gk~~~g~~LFe~~~L~~PgFVEFDdvN~kilty~aq~~~YrVfdlknYs~LYsIsd--e~VqEIkIS~-Gimll~~  250 (323)
                       +..++.-   .-|.. .-..+-.+.|+.. +++++....++..++||+.+...++.+..  ..+..+.++| +.+++..
T Consensus        80 -~~~~~~~---~~~~~-~~~~i~~~~~~~~-~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~l~~~  153 (289)
T cd00200          80 -LETGECV---RTLTG-HTSYVSSVAFSPD-GRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASS  153 (289)
T ss_pred             -cCcccce---EEEec-cCCcEEEEEEcCC-CCEEEEecCCCeEEEEECCCcEEEEEeccCCCcEEEEEEcCcCCEEEEE
Confidence             2222110   01110 0012233556554 56666666799999999999998888873  3589999998 5554443


Q ss_pred             ecCCCeeeEEEEEeecCceeeeeeeccccCCcchhhhhccc--eeEEEecCCceeEEecccccee
Q 020609          251 TKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNE--KLLVKQENENLQILDESNSGCL  313 (323)
Q Consensus       251 q~~~~~iPlkIlsIedG~~l~~~~~~L~~sk~iqFiE~f~E--kLLIKQE~~~LqI~Dl~~~~l~  313 (323)
                      . ..+  -+.++++.+++.+..+..  | ...+.-+.....  .|++--.+..+.+||+.+.+..
T Consensus       154 ~-~~~--~i~i~d~~~~~~~~~~~~--~-~~~i~~~~~~~~~~~l~~~~~~~~i~i~d~~~~~~~  212 (289)
T cd00200         154 S-QDG--TIKLWDLRTGKCVATLTG--H-TGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCL  212 (289)
T ss_pred             c-CCC--cEEEEEccccccceeEec--C-ccccceEEECCCcCEEEEecCCCcEEEEECCCCcee
Confidence            3 233  367899999998887762  2 334443443333  7888888999999999875544

>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>PF15065 NCU-G1: Lysosomal transcription factor, NCU-G1 Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query323
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 41.4 bits (96), Expect = 3e-04
 Identities = 50/301 (16%), Positives = 89/301 (29%), Gaps = 73/301 (24%)

Query: 38  FVNSVKKLQRREISS------KRDRAFTMTDAQERFRNIRLQEEYD-----THDPKGHCS 86
           F     + Q ++I S        +  F   D Q+  ++I  +EE D          G   
Sbjct: 9   FETGEHQYQYKDILSVFEDAFVDN--FDCKDVQDMPKSILSKEEIDHIIMSKDAVSGTLR 66

Query: 87  MVLPFLRKRSKI----IEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSL 142
           +    L K+ ++    +E V   +  F      + +    E  Q           ++  +
Sbjct: 67  LFWTLLSKQEEMVQKFVEEVLRINYKF------LMSPIKTEQRQP---------SMMTRM 111

Query: 143 FYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKW------PG 196
           +  + +       V+A  N      R      +R+       AL E    K        G
Sbjct: 112 YIEQRDRLYNDNQVFAKYN----VSRLQPYLKLRQ-------ALLELRPAKNVLIDGVLG 160

Query: 197 FVEFDDVNGK-VLTYSA-QDSIYKVFDLKNYTMLYSISDKNVQEIKISPGIMLLIFTKAS 254
                   GK  +         YKV    ++ + + ++ KN      SP  +L +  K  
Sbjct: 161 S-------GKTWVALDVCLS--YKVQCKMDFKIFW-LNLKNCN----SPETVLEMLQKLL 206

Query: 255 GHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDE-SNSGCL 313
             +     S  D     S N  L  +       +    L  K     L +L    N+   
Sbjct: 207 YQIDPNWTSRSDH----SSNIKLRIH---SIQAELRRLLKSKPYENCLLVLLNVQNAKAW 259

Query: 314 E 314
            
Sbjct: 260 N 260

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 98.13
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.99
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.94
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 97.91
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.87
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.86
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.86
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.82
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.81
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.76
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 97.74
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 97.7
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.69
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.66
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.65
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 97.62
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.58
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.57
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 97.56
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.55
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 97.54
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.53
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 97.53
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.49
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.47
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.45
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 97.4
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.39
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.39
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.37
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.37
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.37
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.36
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.35
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.35
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.34
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.34
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.34
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.33
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.33
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.31
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.3
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.29
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.28
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.27
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.24
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 97.24
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 97.21
3jrp_A379 Fusion protein of protein transport protein SEC13 97.16
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.15
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.11
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.11
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.09
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.08
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.05
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.04
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.01
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 97.01
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.98
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.98
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.98
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 96.96
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.95
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 96.92
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 96.89
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.89
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.83
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.74
3jrp_A 379 Fusion protein of protein transport protein SEC13 96.67
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.63
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.62
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.61
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.59
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.49
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.39
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.38
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 96.36
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.34
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.33
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 96.3
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 96.29
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 96.28
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 96.25
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 96.25
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 96.06
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.05
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.03
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 96.01
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 96.01
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 95.81
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.81
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.77
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.75
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 95.73
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.57
3jro_A 753 Fusion protein of protein transport protein SEC13 95.53
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 95.48
3vgz_A 353 Uncharacterized protein YNCE; beta-propeller, prot 95.48
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.46
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.3
3jro_A 753 Fusion protein of protein transport protein SEC13 95.3
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 95.27
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 95.18
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 95.06
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 95.03
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 94.94
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 94.86
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.82
2xyi_A430 Probable histone-binding protein CAF1; transcripti 94.82
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 94.73
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 94.7
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.65
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 94.61
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 94.6
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 94.54
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.36
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 94.26
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 93.9
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 93.8
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 93.33
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 93.1
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 93.07
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 93.03
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 92.9
2pm7_B 297 Protein transport protein SEC13, protein transport 92.82
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 92.25
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 92.13
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 91.79
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 91.49
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 90.62
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 90.36
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 90.14
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 90.13
2ymu_A577 WD-40 repeat protein; unknown function, two domain 89.52
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 88.84
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 88.54
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 88.42
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 88.15
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 87.79
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 86.06
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 85.26
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 84.76
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 84.4
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 81.99
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 80.87
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 80.72
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 80.15
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=98.13  E-value=0.00061  Score=56.00  Aligned_cols=218  Identities=13%  Similarity=0.168  Sum_probs=132.4

Q ss_pred             eeeeccCCCCcccccccccccccceeEEeeccchhhhhhccccceeeecccccEEEEEeCCCCceEEEEEeecCCCeEEE
Q 020609           74 EEYDTHDPKGHCSMVLPFLRKRSKIIEIVAARDIVFALAQSGVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLIT  153 (323)
Q Consensus        74 ~~fD~~d~k~~~~~~lpfl~kRS~V~EIv~a~diI~aL~~sG~c~af~r~tn~~iC~LN~s~dEvIrSiFyNk~NdSlIt  153 (323)
                      ..+|..+......+ ..+-.....|..+-...+.+++-...|....||  +++.+..+......+....|.....+.+++
T Consensus        84 ~~~~~~~~~~~~~~-~~~~~~~~~i~~~~~~~~~l~~~~~d~~i~~~d--~~~~~~~~~~~~~~v~~~~~~~~~~~~l~~  160 (313)
T 3odt_A           84 NGVPLFATSGEDPL-YTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWK--EGSLVYNLQAHNASVWDAKVVSFSENKFLT  160 (313)
T ss_dssp             EEEETTCCTTSCC--CEECCCSSCEEEEEEETTEEEEEETTSEEEEEE--TTEEEEEEECCSSCEEEEEEEETTTTEEEE
T ss_pred             EEEEeeecCCCCcc-cchhhcccCEEEEEecCCEEEEEeCCCCEEEEc--CCcEEEecccCCCceeEEEEccCCCCEEEE
Confidence            45666665433222 122234567777777788888888999999999  788888887766665555555545565555


Q ss_pred             EEeEecCCCceeeeeeeehhhhhhCCCCCCCcceeecccCCCCeEEecCCCceEEEEecCCCeEEEEeccCcEEEEEec-
Q 020609          154 VSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKWPGFVEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSIS-  232 (323)
Q Consensus       154 vSvy~sd~fS~LkCr~~~i~~i~~Gk~~~g~~LFe~~~L~~PgFVEFDdvN~kilty~aq~~~YrVfdlknYs~LYsIs-  232 (323)
                      .|   .|.  .++...  ..        .....|....-...--+.|.+. ++ ++....++..++||+++-+.+.++. 
T Consensus       161 ~~---~d~--~i~i~d--~~--------~~~~~~~~~~~~~i~~~~~~~~-~~-~~~~~~dg~i~i~d~~~~~~~~~~~~  223 (313)
T 3odt_A          161 AS---ADK--TIKLWQ--ND--------KVIKTFSGIHNDVVRHLAVVDD-GH-FISCSNDGLIKLVDMHTGDVLRTYEG  223 (313)
T ss_dssp             EE---TTS--CEEEEE--TT--------EEEEEECSSCSSCEEEEEEEET-TE-EEEEETTSEEEEEETTTCCEEEEEEC
T ss_pred             EE---CCC--CEEEEe--cC--------ceEEEEeccCcccEEEEEEcCC-Ce-EEEccCCCeEEEEECCchhhhhhhhc
Confidence            33   222  232221  00        0011111111122233455544 44 5556789999999999999888775 


Q ss_pred             -ccceeeEEEcCCEEEEEEecCCCeeeEEEEEeecCceeeeeeeccccCCcchhhhhccceeEEEecCCceeEEeccccc
Q 020609          233 -DKNVQEIKISPGIMLLIFTKASGHVPLKILSIEDGTVLKSFNHLLHRNKKVDFIEQFNEKLLVKQENENLQILDESNSG  311 (323)
Q Consensus       233 -de~VqEIkIS~Gimll~~q~~~~~iPlkIlsIedG~~l~~~~~~L~~sk~iqFiE~f~EkLLIKQE~~~LqI~Dl~~~~  311 (323)
                       ...+..+.++|.-.++ .-...+.  ++|+++.+|+.+..+...-..-..+.|..  +.+++.=-.+..+++||+.+.+
T Consensus       224 ~~~~i~~~~~~~~~~l~-~~~~dg~--v~iwd~~~~~~~~~~~~~~~~i~~~~~~~--~~~~~~~~~dg~i~iw~~~~~~  298 (313)
T 3odt_A          224 HESFVYCIKLLPNGDIV-SCGEDRT--VRIWSKENGSLKQVITLPAISIWSVDCMS--NGDIIVGSSDNLVRIFSQEKSR  298 (313)
T ss_dssp             CSSCEEEEEECTTSCEE-EEETTSE--EEEECTTTCCEEEEEECSSSCEEEEEECT--TSCEEEEETTSCEEEEESCGGG
T ss_pred             CCceEEEEEEecCCCEE-EEecCCE--EEEEECCCCceeEEEeccCceEEEEEEcc--CCCEEEEeCCCcEEEEeCCCCc
Confidence             5668889998553322 3333443  68999999999988763211122334433  2347787889999999999987


Q ss_pred             eeeec
Q 020609          312 CLELS  316 (323)
Q Consensus       312 l~ev~  316 (323)
                      +....
T Consensus       299 ~~~~~  303 (313)
T 3odt_A          299 WASED  303 (313)
T ss_dssp             CCC--
T ss_pred             eeehh
Confidence            76543
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query323
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.66
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.55
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.48
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.32
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.26
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.22
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 97.22
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.13
d1tbga_340 beta1-subunit of the signal-transducing G protein 97.12
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.05
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.95
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 96.71
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 96.52
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 96.1
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.05
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 95.94
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 95.87
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 95.8
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 95.65
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.42
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 94.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 94.77
d1tbga_340 beta1-subunit of the signal-transducing G protein 94.65
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 94.3
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.16
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 94.1
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 93.26
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 93.12
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 92.9
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 92.82
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 92.04
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 90.46
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 89.11
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 89.06
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 88.99
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 88.67
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 87.64
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 87.37
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 80.29
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Actin interacting protein 1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.66  E-value=0.00077  Score=56.12  Aligned_cols=175  Identities=13%  Similarity=0.089  Sum_probs=104.2

Q ss_pred             ccceeeecccccEEEEEeCCCCceEEEEEeecCCCeEEEEEeEecCCCceeeeeeeehhhhhhCCCCCCCcceeecccCC
Q 020609          115 GVCAAFCRETNQRICFLNVTADEVIRSLFYNKNNDSLITVSVYASDNFSSLRCRSTRIEYIRRGKPDAGFALFESESLKW  194 (323)
Q Consensus       115 G~c~af~r~tn~~iC~LN~s~dEvIrSiFyNk~NdSlItvSvy~sd~fS~LkCr~~~i~~i~~Gk~~~g~~LFe~~~L~~  194 (323)
                      +...+|+..+++.+..+.. +..-|.++-++..++.+++  +...|.  .++.  .   ++..++......    ..-.+
T Consensus       139 ~~~~~~~~~~~~~~~~~~~-h~~~v~~~~~~~~~~~~~~--~~~~d~--~v~~--~---d~~~~~~~~~~~----~~~~~  204 (325)
T d1pgua1         139 NFGVFISWDSGNSLGEVSG-HSQRINACHLKQSRPMRSM--TVGDDG--SVVF--Y---QGPPFKFSASDR----THHKQ  204 (325)
T ss_dssp             CSEEEEETTTCCEEEECCS-CSSCEEEEEECSSSSCEEE--EEETTT--EEEE--E---ETTTBEEEEEEC----SSSCT
T ss_pred             ceEEEEeecccccceeeee-cccccccccccccccceEE--Eeeccc--cccc--c---cccccccceecc----cccCC
Confidence            4566788888998888764 5566788877776655443  222333  2221  1   222222111111    11133


Q ss_pred             CCe---EEecCCCceEEEEecCCCeEEEEeccCcEEEEEecc--cceeeEEE----cCCEEEEEEecCCCeeeEEEEEee
Q 020609          195 PGF---VEFDDVNGKVLTYSAQDSIYKVFDLKNYTMLYSISD--KNVQEIKI----SPGIMLLIFTKASGHVPLKILSIE  265 (323)
Q Consensus       195 PgF---VEFDdvN~kilty~aq~~~YrVfdlknYs~LYsIsd--e~VqEIkI----S~Gimll~~q~~~~~iPlkIlsIe  265 (323)
                      +++   +.|+...++.++-...|+..++||+++-+++.++..  ..+..+..    .||-+|+.-- ..+.  ++|.+++
T Consensus       205 ~~~v~~v~~~pd~~~~l~s~~~d~~i~iwd~~~~~~~~~l~~~~~~v~~~~~s~~~~dg~~l~s~s-~D~~--i~iwd~~  281 (325)
T d1pgua1         205 GSFVRDVEFSPDSGEFVITVGSDRKISCFDGKSGEFLKYIEDDQEPVQGGIFALSWLDSQKFATVG-ADAT--IRVWDVT  281 (325)
T ss_dssp             TCCEEEEEECSTTCCEEEEEETTCCEEEEETTTCCEEEECCBTTBCCCSCEEEEEESSSSEEEEEE-TTSE--EEEEETT
T ss_pred             CCccEEeeeccccceeccccccccceeeeeeccccccccccccccccccceeeeeccCCCEEEEEe-CCCe--EEEEECC
Confidence            443   678877788887778899999999999999999873  23333333    4676655543 3333  7899999


Q ss_pred             cCceeeeeeeccccCCcchhhhh--c-cceeEEEecCCceeEEec
Q 020609          266 DGTVLKSFNHLLHRNKKVDFIEQ--F-NEKLLVKQENENLQILDE  307 (323)
Q Consensus       266 dG~~l~~~~~~L~~sk~iqFiE~--f-~EkLLIKQE~~~LqI~Dl  307 (323)
                      +|+.+..+... .......-+..  - +..|+-==++..|+||||
T Consensus       282 ~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~l~s~s~dg~i~vwdl  325 (325)
T d1pgua1         282 TSKCVQKWTLD-KQQLGNQQVGVVATGNGRIISLSLDGTLNFYEL  325 (325)
T ss_dssp             TTEEEEEEECC-TTCGGGCEEEEEEEETTEEEEEETTSCEEEEET
T ss_pred             CCCEEEEEEec-CCcccCeEEEEEECCCCEEEEEECCCEEEEEEC
Confidence            99999988731 11222221221  1 234443457899999997
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure