Citrus Sinensis ID: 021103


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------
MGIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGEGFEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVVCYISF
ccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEEEccEEEEEEccccccHHHHHHHHHcccccccccccccccEEcEEEEEccEEEEEEEccccccccccccccccEEEEEEEcccEEEEEEEcccccHHHHHHHHHHHHcccccccccccEEEEEccccccEEEcccccccccHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHccccEEEEEEEEccccccccccccccccccEEEEEccccccHHHHHHHHHHHcccEEEEEccccccccccccEEEccccEEcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEcccEEEEEEccccccHHHHHHHHccccHHHHHHHHcEEcccccEEEEcccEEEEEccccEEEccccccccccEEEEEEccccEEEEEEcccccHHHHHHHHHHHHHcccEEccccccEEEEEccccEEEEEcccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccEEEcEEEEEEccccccHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHccEEEEEccccccccccccEEEEccEEEEc
MGIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTqlleppkgssgagegfevtkfghgrvaligfpsvgksTLLTLLtgthseaasyefttltcipgiihyndtkiqlldlpgiiegasegkgrgrqVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGlrlnkrppqiyfkkkktggisfnstlplthvdEKLCYQILHEYKIHnaevlfredatvdDLIDVIEGNRKYMKCVYVYNKidvigiddvdklarqpnsvvISCNLKLNLDRLLARMWEEMGLVRvytkpqgqqpdftepvVLSVVCYISF
MGIIEKIKEIEAEMARTqknkateyhLGQLKAKIAKLRTQLLeppkgssgagEGFEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGasegkgrgrqviavskssdIVLMVLDaskseghrqILTKEleavglrlnkrppqiyfkkkktggisfnstlpltHVDEKLCYQILHEYKIHNaevlfredatvdDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTkpqgqqpdftepvVLSVVCYISF
MGiiekikeieaeMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGEGFEVTKFGHGRVALIGFPSVGKStlltlltgtHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKidvigiddvdKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVVCYISF
**************************L**LKAKIA******************GFEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASE**GRGRQVIAVSKSSDIVLMVLDAS***GHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVVCYI**
*GIIEKIKEIEAEMARTQKNKATEYHLGQLKAKI*************************FGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVVCYI**
MGIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGEGFEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVVCYISF
*GIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKG****GEGFEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVVCYISF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGEGFEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVVCYISF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query317 2.2.26 [Sep-21-2011]
Q9LQK0399 Developmentally regulated yes no 0.977 0.776 0.925 1e-172
Q9CAI1399 Developmentally regulated yes no 0.981 0.779 0.919 1e-172
P55039364 Developmentally-regulated yes no 0.974 0.848 0.686 1e-124
Q9QXB9364 Developmentally-regulated yes no 0.974 0.848 0.686 1e-124
Q58D56364 Developmentally-regulated yes no 0.974 0.848 0.689 1e-121
P34280366 Uncharacterized GTP-bindi yes no 0.955 0.827 0.663 1e-120
Q54WT4364 Developmentally-regulated yes no 0.974 0.848 0.634 1e-117
P32235364 GTP-binding protein 1 OS= yes no 0.971 0.846 0.611 1e-114
Q54HP3370 Developmentally-regulated no no 0.974 0.835 0.600 2e-99
P32233367 Developmentally-regulated no no 0.971 0.839 0.572 4e-99
>sp|Q9LQK0|DRG1_ARATH Developmentally regulated G-protein 1 OS=Arabidopsis thaliana GN=DRG1 PE=1 SV=1 Back     alignment and function desciption
 Score =  605 bits (1559), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 287/310 (92%), Positives = 304/310 (98%)

Query: 1   MGIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGEGFEVTKF 60
           MGIIE+IKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKG+SG GEGFEVTK+
Sbjct: 1   MGIIERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGASGGGEGFEVTKY 60

Query: 61  GHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGII 120
           GHGRVALIGFPSVGKSTLLT+LTGTHSEAASYEFTTLTCIPG+IHYNDTKIQLLDLPGII
Sbjct: 61  GHGRVALIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGII 120

Query: 121 EGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFK 180
           EGASEGKGRGRQVIAV+KSSD+VLMVLDASKSEGHRQILTKELEAVGLRLNK PPQIYFK
Sbjct: 121 EGASEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQILTKELEAVGLRLNKTPPQIYFK 180

Query: 181 KKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMK 240
           KKKTGGISFN+T PLTH+DEKLCYQILHEYKIHNAEVLFRE+ATVDD IDVIEGNRKY+K
Sbjct: 181 KKKTGGISFNTTAPLTHIDEKLCYQILHEYKIHNAEVLFRENATVDDFIDVIEGNRKYIK 240

Query: 241 CVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQ 300
           CVYVYNKIDV+GIDDVD+L+RQPNS+VISCNLKLNLDRLLARMW+EMGLVRVY+KPQGQQ
Sbjct: 241 CVYVYNKIDVVGIDDVDRLSRQPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQGQQ 300

Query: 301 PDFTEPVVLS 310
           PDF EP VLS
Sbjct: 301 PDFDEPFVLS 310




Binds GDP and GTP, and has low GTPase activity. May interact with phosphatidic acid (PA).
Arabidopsis thaliana (taxid: 3702)
>sp|Q9CAI1|DRG2_ARATH Developmentally regulated G-protein 2 OS=Arabidopsis thaliana GN=DRG2 PE=2 SV=1 Back     alignment and function description
>sp|P55039|DRG2_HUMAN Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens GN=DRG2 PE=1 SV=1 Back     alignment and function description
>sp|Q9QXB9|DRG2_MOUSE Developmentally-regulated GTP-binding protein 2 OS=Mus musculus GN=Drg2 PE=1 SV=1 Back     alignment and function description
>sp|Q58D56|DRG2_BOVIN Developmentally-regulated GTP-binding protein 2 OS=Bos taurus GN=DRG2 PE=2 SV=1 Back     alignment and function description
>sp|P34280|YKK3_CAEEL Uncharacterized GTP-binding protein C02F5.3 OS=Caenorhabditis elegans GN=C02F5.3 PE=3 SV=2 Back     alignment and function description
>sp|Q54WT4|DRG2_DICDI Developmentally-regulated GTP-binding protein 2 homolog OS=Dictyostelium discoideum GN=drg2 PE=3 SV=1 Back     alignment and function description
>sp|P32235|GTP1_SCHPO GTP-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gtp1 PE=3 SV=2 Back     alignment and function description
>sp|Q54HP3|DRG1_DICDI Developmentally-regulated GTP-binding protein 1 homolog OS=Dictyostelium discoideum GN=drg1 PE=3 SV=1 Back     alignment and function description
>sp|P32233|DRG1_MOUSE Developmentally-regulated GTP-binding protein 1 OS=Mus musculus GN=Drg1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
224054118399 predicted protein [Populus trichocarpa] 0.981 0.779 0.964 1e-176
224070823400 predicted protein [Populus trichocarpa] 0.981 0.777 0.964 1e-175
242042553399 hypothetical protein SORBIDRAFT_01g05002 0.977 0.776 0.941 1e-173
226530349399 developmentally-regulated GTP-binding pr 0.977 0.776 0.938 1e-173
115463395399 Os05g0357600 [Oryza sativa Japonica Grou 0.977 0.776 0.941 1e-172
357135278399 PREDICTED: developmentally regulated G-p 0.977 0.776 0.935 1e-171
255560657396 developmentally regulated GTP-binding pr 0.971 0.777 0.948 1e-171
15220113399 developmentally regulated G-protein 1 [A 0.977 0.776 0.925 1e-170
15218561399 P-loop containing nucleoside triphosphat 0.981 0.779 0.919 1e-170
297839127399 hypothetical protein ARALYDRAFT_476401 [ 0.981 0.779 0.919 1e-170
>gi|224054118|ref|XP_002298101.1| predicted protein [Populus trichocarpa] gi|222845359|gb|EEE82906.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  622 bits (1605), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 300/311 (96%), Positives = 309/311 (99%)

Query: 1   MGIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGEGFEVTKF 60
           MGIIE+IKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAG+GFEVTKF
Sbjct: 1   MGIIERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGDGFEVTKF 60

Query: 61  GHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGII 120
           GHGRVALIGFPSVGKSTLLT+LTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGII
Sbjct: 61  GHGRVALIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGII 120

Query: 121 EGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFK 180
           EGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELE+VGLRLNK+PP+IYFK
Sbjct: 121 EGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELESVGLRLNKKPPRIYFK 180

Query: 181 KKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMK 240
           KKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMK
Sbjct: 181 KKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMK 240

Query: 241 CVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQ 300
           C+YVYNKIDVIGIDDVDKLARQPNSVVISCNLKLN DRLLA+MWEEMGLVRVYTKPQGQQ
Sbjct: 241 CIYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNFDRLLAKMWEEMGLVRVYTKPQGQQ 300

Query: 301 PDFTEPVVLSV 311
           PDFT+PVVLS 
Sbjct: 301 PDFTDPVVLST 311




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224070823|ref|XP_002303251.1| predicted protein [Populus trichocarpa] gi|222840683|gb|EEE78230.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|242042553|ref|XP_002468671.1| hypothetical protein SORBIDRAFT_01g050020 [Sorghum bicolor] gi|241922525|gb|EER95669.1| hypothetical protein SORBIDRAFT_01g050020 [Sorghum bicolor] Back     alignment and taxonomy information
>gi|226530349|ref|NP_001149923.1| developmentally-regulated GTP-binding protein 2 [Zea mays] gi|195635479|gb|ACG37208.1| developmentally-regulated GTP-binding protein 2 [Zea mays] Back     alignment and taxonomy information
>gi|115463395|ref|NP_001055297.1| Os05g0357600 [Oryza sativa Japonica Group] gi|55167981|gb|AAV43849.1| putative GTP binding protein [Oryza sativa Japonica Group] gi|113578848|dbj|BAF17211.1| Os05g0357600 [Oryza sativa Japonica Group] gi|215740529|dbj|BAG97185.1| unnamed protein product [Oryza sativa Japonica Group] gi|215767068|dbj|BAG99296.1| unnamed protein product [Oryza sativa Japonica Group] gi|218196625|gb|EEC79052.1| hypothetical protein OsI_19615 [Oryza sativa Indica Group] gi|222631265|gb|EEE63397.1| hypothetical protein OsJ_18209 [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|357135278|ref|XP_003569237.1| PREDICTED: developmentally regulated G-protein 1-like [Brachypodium distachyon] Back     alignment and taxonomy information
>gi|255560657|ref|XP_002521342.1| developmentally regulated GTP-binding protein, putative [Ricinus communis] gi|223539420|gb|EEF41010.1| developmentally regulated GTP-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|15220113|ref|NP_173190.1| developmentally regulated G-protein 1 [Arabidopsis thaliana] gi|145323932|ref|NP_001077555.1| developmentally regulated G-protein 1 [Arabidopsis thaliana] gi|75335333|sp|Q9LQK0.1|DRG1_ARATH RecName: Full=Developmentally regulated G-protein 1; Short=AtDRG1 gi|9665129|gb|AAF97313.1|AC007843_16 GTP binding protein [Arabidopsis thaliana] gi|59958304|gb|AAX12862.1| At1g17470 [Arabidopsis thaliana] gi|332191474|gb|AEE29595.1| developmentally regulated G-protein 1 [Arabidopsis thaliana] gi|332191475|gb|AEE29596.1| developmentally regulated G-protein 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15218561|ref|NP_177410.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|79321186|ref|NP_001031270.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|79321194|ref|NP_001031271.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|75333649|sp|Q9CAI1.1|DRG2_ARATH RecName: Full=Developmentally regulated G-protein 2; Short=AtDRG2 gi|12323776|gb|AAG51856.1|AC010926_19 putative GTP-binding protein; 56356-53974 [Arabidopsis thaliana] gi|26452818|dbj|BAC43489.1| putative GTP-binding protein [Arabidopsis thaliana] gi|29824115|gb|AAP04018.1| putative GTP-binding protein [Arabidopsis thaliana] gi|332197235|gb|AEE35356.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|332197236|gb|AEE35357.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] gi|332197237|gb|AEE35358.1| P-loop containing nucleoside triphosphate hydrolase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297839127|ref|XP_002887445.1| hypothetical protein ARALYDRAFT_476401 [Arabidopsis lyrata subsp. lyrata] gi|297333286|gb|EFH63704.1| hypothetical protein ARALYDRAFT_476401 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query317
TAIR|locus:2018826399 DRG1 "developmentally regulate 0.977 0.776 0.838 1.3e-137
TAIR|locus:2030240399 AT1G72660 [Arabidopsis thalian 0.977 0.776 0.838 1.7e-137
UNIPROTKB|E2RJ29364 DRG2 "Uncharacterized protein" 0.974 0.848 0.631 1.2e-99
UNIPROTKB|A8MZF9343 DRG2 "Developmentally-regulate 0.974 0.900 0.627 1.5e-99
UNIPROTKB|P55039364 DRG2 "Developmentally-regulate 0.974 0.848 0.627 1.5e-99
UNIPROTKB|Q58D56364 DRG2 "Developmentally-regulate 0.974 0.848 0.631 1.9e-99
MGI|MGI:1342307364 Drg2 "developmentally regulate 0.974 0.848 0.627 2.4e-99
UNIPROTKB|F1NIK3364 DRG2 "Uncharacterized protein" 0.974 0.848 0.627 3.1e-99
ZFIN|ZDB-GENE-040808-29364 drg2 "developmentally regulate 0.930 0.810 0.630 1.7e-98
WB|WBGene00015346366 C02F5.3 [Caenorhabditis elegan 0.949 0.822 0.617 5.8e-98
TAIR|locus:2018826 DRG1 "developmentally regulated G-protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1347 (479.2 bits), Expect = 1.3e-137, P = 1.3e-137
 Identities = 260/310 (83%), Positives = 274/310 (88%)

Query:     1 MGXXXXXXXXXXXMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGEGFEVTKF 60
             MG           MARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKG+SG GEGFEVTK+
Sbjct:     1 MGIIERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGASGGGEGFEVTKY 60

Query:    61 GHGRVALIGFPSVGKSXXXXXXXXXHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGII 120
             GHGRVALIGFPSVGKS         HSEAASYEFTTLTCIPG+IHYNDTKIQLLDLPGII
Sbjct:    61 GHGRVALIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGII 120

Query:   121 EGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFK 180
             EGASEGKGRGRQVIAV+KSSD+VLMVLDASKSEGHRQILTKELEAVGLRLNK PPQIYFK
Sbjct:   121 EGASEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQILTKELEAVGLRLNKTPPQIYFK 180

Query:   181 KKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMK 240
             KKKTGGISFN+T PLTH+DEKLCYQILHEYKIHNAEVLFRE+ATVDD IDVIEGNRKY+K
Sbjct:   181 KKKTGGISFNTTAPLTHIDEKLCYQILHEYKIHNAEVLFRENATVDDFIDVIEGNRKYIK 240

Query:   241 CVYVYNKXXXXXXXXXXKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQ 300
             CVYVYNK          +L+RQPNS+VISCNLKLNLDRLLARMW+EMGLVRVY+KPQGQQ
Sbjct:   241 CVYVYNKIDVVGIDDVDRLSRQPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQGQQ 300

Query:   301 PDFTEPVVLS 310
             PDF EP VLS
Sbjct:   301 PDFDEPFVLS 310




GO:0005525 "GTP binding" evidence=IEA;ISS;IDA
GO:0005737 "cytoplasm" evidence=ISM
GO:0003924 "GTPase activity" evidence=ISS;IDA
GO:0016023 "cytoplasmic membrane-bounded vesicle" evidence=IDA
GO:0070300 "phosphatidic acid binding" evidence=IDA
GO:0019003 "GDP binding" evidence=IDA
TAIR|locus:2030240 AT1G72660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJ29 DRG2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A8MZF9 DRG2 "Developmentally-regulated GTP-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P55039 DRG2 "Developmentally-regulated GTP-binding protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q58D56 DRG2 "Developmentally-regulated GTP-binding protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1342307 Drg2 "developmentally regulated GTP binding protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIK3 DRG2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040808-29 drg2 "developmentally regulated GTP binding protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00015346 C02F5.3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q54WT4DRG2_DICDINo assigned EC number0.63430.97470.8489yesno
P32235GTP1_SCHPONo assigned EC number0.61160.97160.8461yesno
Q58D56DRG2_BOVINNo assigned EC number0.68930.97470.8489yesno
P43690DRG1_XENLANo assigned EC number0.56630.97160.8392N/Ano
P55039DRG2_HUMANNo assigned EC number0.68600.97470.8489yesno
Q9LQK0DRG1_ARATHNo assigned EC number0.92580.97790.7769yesno
P34280YKK3_CAEELNo assigned EC number0.66330.95580.8278yesno
Q9CAI1DRG2_ARATHNo assigned EC number0.91960.98100.7794yesno
Q9QXB9DRG2_MOUSENo assigned EC number0.68600.97470.8489yesno
P39729RBG1_YEASTNo assigned EC number0.57920.96520.8292yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
COG1163365 COG1163, DRG, Predicted GTPase [General function p 1e-162
cd01896233 cd01896, DRG, Developmentally Regulated GTP-bindin 1e-154
cd01881167 cd01881, Obg_like, Obg-like family of GTPases cons 1e-33
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 7e-22
cd01898170 cd01898, Obg, Obg GTPase 2e-21
PRK12297424 PRK12297, obgE, GTPase CgtA; Reviewed 9e-21
COG0536369 COG0536, Obg, Predicted GTPase [General function p 2e-19
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 1e-18
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 1e-16
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 5e-15
PRK12296500 PRK12296, obgE, GTPase CgtA; Reviewed 2e-13
COG0012372 COG0012, COG0012, Predicted GTPase, probable trans 1e-12
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 3e-12
cd00880161 cd00880, Era_like, E 3e-12
cd01899318 cd01899, Ygr210, Ygr210 GTPase 5e-11
cd01879159 cd01879, FeoB, Ferrous iron transport protein B (F 3e-10
PRK09602 396 PRK09602, PRK09602, translation-associated GTPase; 4e-10
pfam02421190 pfam02421, FeoB_N, Ferrous iron transport protein 5e-10
cd01897167 cd01897, NOG, Nucleolar GTP-binding protein (NOG) 6e-10
COG1084346 COG1084, COG1084, Predicted GTPase [General functi 3e-09
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 2e-08
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [In 2e-08
cd04163168 cd04163, Era, E 3e-08
PRK09601364 PRK09601, PRK09601, GTP-binding protein YchF; Revi 8e-08
cd01894157 cd01894, EngA1, EngA1 GTPase contains the first do 2e-07
cd0166675 cd01666, TGS_DRG_C, TGS_DRG_C: DRG (developmentall 3e-07
COG1160 444 COG1160, COG1160, Predicted GTPases [General funct 4e-07
PRK15494339 PRK15494, era, GTPase Era; Provisional 6e-07
PRK00089292 PRK00089, era, GTPase Era; Reviewed 2e-06
cd01895174 cd01895, EngA2, EngA2 GTPase contains the second d 2e-06
COG1159298 COG1159, Era, GTPase [General function prediction 2e-06
COG2262411 COG2262, HflX, GTPases [General function predictio 3e-06
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 4e-06
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 6e-06
cd04164159 cd04164, trmE, trmE is a tRNA modification GTPase 7e-06
COG1160444 COG1160, COG1160, Predicted GTPases [General funct 1e-05
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPas 1e-05
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 2e-05
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Rev 2e-05
COG0486454 COG0486, ThdF, Predicted GTPase [General function 3e-05
PTZ00258390 PTZ00258, PTZ00258, GTP-binding protein; Provision 8e-05
PRK09554 772 PRK09554, feoB, ferrous iron transport protein B; 1e-04
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 1e-04
cd01900274 cd01900, YchF, YchF GTPase 2e-04
TIGR00436270 TIGR00436, era, GTP-binding protein Era 2e-04
cd01856171 cd01856, YlqF, Circularly permuted YlqF GTPase 2e-04
cd01878204 cd01878, HflX, HflX GTPase family 3e-04
cd01859157 cd01859, MJ1464, An uncharacterized, circularly pe 3e-04
COG1161322 COG1161, COG1161, Predicted GTPases [General funct 5e-04
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Revie 5e-04
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Revie 0.003
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase 0.003
>gnl|CDD|224085 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
 Score =  456 bits (1176), Expect = e-162
 Identities = 180/309 (58%), Positives = 233/309 (75%)

Query: 1   MGIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGEGFEVTKF 60
           M I EKIK IE E+ART KNKATE+H+G LKAK+A+LR +L +    S G G GF V K 
Sbjct: 2   MTIEEKIKAIEEEIARTPKNKATEHHIGLLKAKLAELREELEKRKSKSGGGGSGFAVKKS 61

Query: 61  GHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGII 120
           G   VAL+GFPSVGKSTLL  LT T SE A Y FTTL  +PG++ Y   +IQLLDLPGII
Sbjct: 62  GDATVALVGFPSVGKSTLLNKLTNTKSEVADYPFTTLEPVPGMLEYKGAQIQLLDLPGII 121

Query: 121 EGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFK 180
           EGAS G+GRGRQV++V++++D++++VLD  +   HR I+ +ELE VG+RLNKRPP +  K
Sbjct: 122 EGASSGRGRGRQVLSVARNADLIIIVLDVFEDPHHRDIIERELEDVGIRLNKRPPDVTIK 181

Query: 181 KKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMK 240
           KK++GGI  N T PLTH+DE     IL EY+IHNA+VL RED T+DDLID +EGNR Y  
Sbjct: 182 KKESGGIRINGTGPLTHLDEDTVRAILREYRIHNADVLIREDVTLDDLIDALEGNRVYKP 241

Query: 241 CVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQ 300
            +YV NKID+ G++++++LAR+PNSV IS    +NLD L  R+W+ +GL+RVYTKP G++
Sbjct: 242 ALYVVNKIDLPGLEELERLARKPNSVPISAKKGINLDELKERIWDVLGLIRVYTKPPGEE 301

Query: 301 PDFTEPVVL 309
           PDF EP++L
Sbjct: 302 PDFDEPLIL 310


Length = 365

>gnl|CDD|206683 cd01896, DRG, Developmentally Regulated GTP-binding protein (DRG) Back     alignment and domain information
>gnl|CDD|206668 cd01881, Obg_like, Obg-like family of GTPases consist of five subfamilies: Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206685 cd01898, Obg, Obg GTPase Back     alignment and domain information
>gnl|CDD|237046 PRK12297, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|223610 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|237045 PRK12296, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|223091 COG0012, COG0012, Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237047 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206686 cd01899, Ygr210, Ygr210 GTPase Back     alignment and domain information
>gnl|CDD|206667 cd01879, FeoB, Ferrous iron transport protein B (FeoB) family Back     alignment and domain information
>gnl|CDD|236584 PRK09602, PRK09602, translation-associated GTPase; Reviewed Back     alignment and domain information
>gnl|CDD|217025 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|206684 cd01897, NOG, Nucleolar GTP-binding protein (NOG) Back     alignment and domain information
>gnl|CDD|224009 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|223447 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|206726 cd04163, Era, E Back     alignment and domain information
>gnl|CDD|236583 PRK09601, PRK09601, GTP-binding protein YchF; Reviewed Back     alignment and domain information
>gnl|CDD|206681 cd01894, EngA1, EngA1 GTPase contains the first domain of EngA Back     alignment and domain information
>gnl|CDD|133436 cd01666, TGS_DRG_C, TGS_DRG_C: DRG (developmentally regulated GTP-binding protein) represents a family of GTP-binding proteins that includes two members, DRG1 and DRG2 Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|234624 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|206682 cd01895, EngA2, EngA2 GTPase contains the second domain of EngA Back     alignment and domain information
>gnl|CDD|224081 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|225171 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234125 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|206727 cd04164, trmE, trmE is a tRNA modification GTPase Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|232980 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|235392 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|223561 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|240334 PTZ00258, PTZ00258, GTP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|236563 PRK09554, feoB, ferrous iron transport protein B; Reviewed Back     alignment and domain information
>gnl|CDD|232975 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|206687 cd01900, YchF, YchF GTPase Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|206749 cd01856, YlqF, Circularly permuted YlqF GTPase Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|206752 cd01859, MJ1464, An uncharacterized, circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|224083 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|234628 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|236546 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 317
COG1163365 DRG Predicted GTPase [General function prediction 100.0
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 100.0
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 100.0
cd01896233 DRG The developmentally regulated GTP-binding prot 100.0
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.97
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.96
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.96
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.96
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.95
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.95
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.95
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.95
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.95
COG0488530 Uup ATPase components of ABC transporters with dup 99.95
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.95
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.95
COG4181228 Predicted ABC-type transport system involved in ly 99.94
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.94
PRK09602396 translation-associated GTPase; Reviewed 99.94
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.93
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.93
COG1127263 Ttg2A ABC-type transport system involved in resist 99.93
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.93
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.93
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.93
COG0411250 LivG ABC-type branched-chain amino acid transport 99.92
COG4619223 ABC-type uncharacterized transport system, ATPase 99.92
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.92
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.92
PRK13537306 nodulation ABC transporter NodI; Provisional 99.92
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.92
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.92
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.92
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.92
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.92
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.92
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.92
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.92
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.92
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.92
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.92
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.92
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.92
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.92
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.92
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.92
PTZ00258390 GTP-binding protein; Provisional 99.92
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.92
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.92
COG4152300 ABC-type uncharacterized transport system, ATPase 99.91
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.91
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.91
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.91
COG4559259 ABC-type hemin transport system, ATPase component 99.91
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.91
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.91
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.91
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.91
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.91
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.91
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.91
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.91
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.91
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.91
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.91
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.91
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.91
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.91
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.91
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.91
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.91
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.91
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.91
COG2262411 HflX GTPases [General function prediction only] 99.91
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.91
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.91
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.91
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.91
PRK10908222 cell division protein FtsE; Provisional 99.91
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.91
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.91
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.91
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.91
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.9
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.9
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.9
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.9
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.9
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.9
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.9
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.9
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.9
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.9
PRK11147635 ABC transporter ATPase component; Reviewed 99.9
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.9
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.9
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.9
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.9
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.9
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.9
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.9
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.9
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.9
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.9
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.9
COG1159298 Era GTPase [General function prediction only] 99.9
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.9
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.9
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.9
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.9
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.9
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.9
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.9
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.9
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.9
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.89
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.89
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.89
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.89
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.89
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.89
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.89
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.89
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.89
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.89
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.89
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.89
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.89
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.89
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.89
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.89
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 99.89
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.89
COG4988559 CydD ABC-type transport system involved in cytochr 99.89
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.89
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.89
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.89
COG1123539 ATPase components of various ABC-type transport sy 99.89
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.89
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.89
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.89
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.89
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 99.89
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.89
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.89
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.89
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.89
COG1123 539 ATPase components of various ABC-type transport sy 99.89
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.89
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.89
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.88
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.88
COG0486454 ThdF Predicted GTPase [General function prediction 99.88
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.88
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.88
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
COG1160 444 Predicted GTPases [General function prediction onl 99.88
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.88
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.88
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 99.88
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.88
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.88
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.88
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.88
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.88
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.88
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.88
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.88
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 99.88
PRK09984262 phosphonate/organophosphate ester transporter subu 99.88
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.88
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.88
PRK12298390 obgE GTPase CgtA; Reviewed 99.88
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.88
PLN03073718 ABC transporter F family; Provisional 99.88
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 99.88
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.88
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.88
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.88
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.88
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 99.88
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.88
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.88
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.88
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.88
COG0536369 Obg Predicted GTPase [General function prediction 99.88
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.88
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.88
PRK12299335 obgE GTPase CgtA; Reviewed 99.87
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.87
PRK12296 500 obgE GTPase CgtA; Reviewed 99.87
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.87
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.87
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.87
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.87
PRK10938 490 putative molybdenum transport ATP-binding protein 99.87
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.87
PRK10261 623 glutathione transporter ATP-binding protein; Provi 99.87
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.87
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.87
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.87
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.87
COG0488 530 Uup ATPase components of ABC transporters with dup 99.87
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.87
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.87
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.87
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.87
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.87
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 99.87
cd03234226 ABCG_White The White subfamily represents ABC tran 99.87
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.87
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.87
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.87
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.87
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.87
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.87
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.87
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.87
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.87
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.87
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.87
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.87
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.87
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.87
COG4586325 ABC-type uncharacterized transport system, ATPase 99.87
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.87
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.87
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.87
PRK09601364 GTP-binding protein YchF; Reviewed 99.86
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.86
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.86
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 99.86
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.86
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.86
COG0410237 LivF ABC-type branched-chain amino acid transport 99.86
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.86
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.86
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.86
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.86
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.86
KOG0927614 consensus Predicted transporter (ABC superfamily) 99.86
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.86
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.86
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.86
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.86
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.86
PRK12297424 obgE GTPase CgtA; Reviewed 99.86
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.86
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.86
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.86
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.86
PRK11147 635 ABC transporter ATPase component; Reviewed 99.86
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.86
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.86
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.86
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.86
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.86
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.86
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.85
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.85
PRK13409590 putative ATPase RIL; Provisional 99.85
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.85
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.85
COG4987573 CydC ABC-type transport system involved in cytochr 99.85
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.85
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.85
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.85
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.85
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.85
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.85
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.85
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.85
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.85
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.85
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.85
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.85
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.85
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.85
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.85
cd03246173 ABCC_Protease_Secretion This family represents the 99.85
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.85
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.85
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.85
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.85
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.85
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.85
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.84
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.84
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 99.84
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.84
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.84
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.84
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.84
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.84
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.84
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.84
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.84
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.84
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.84
KOG0058716 consensus Peptide exporter, ABC superfamily [Intra 99.84
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.84
PRK11058426 GTPase HflX; Provisional 99.84
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.84
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.84
PLN03211 659 ABC transporter G-25; Provisional 99.84
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.83
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.83
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.83
PRK10938490 putative molybdenum transport ATP-binding protein 99.83
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.83
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.83
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.83
COG1160444 Predicted GTPases [General function prediction onl 99.83
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.83
COG4133209 CcmA ABC-type transport system involved in cytochr 99.83
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.83
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.83
COG4172534 ABC-type uncharacterized transport system, duplica 99.83
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.83
COG1084346 Predicted GTPase [General function prediction only 99.83
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.83
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.83
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.83
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.83
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.82
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.82
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.82
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.82
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.82
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.82
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.82
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.82
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.82
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 99.82
COG4172 534 ABC-type uncharacterized transport system, duplica 99.82
KOG0055 1228 consensus Multidrug/pheromone exporter, ABC superf 99.82
PRK13409 590 putative ATPase RIL; Provisional 99.82
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.81
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.81
COG0012372 Predicted GTPase, probable translation factor [Tra 99.81
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.81
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.8
COG4136213 ABC-type uncharacterized transport system, ATPase 99.8
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.8
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.79
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.79
PLN03073 718 ABC transporter F family; Provisional 99.79
PLN032321495 ABC transporter C family member; Provisional 99.79
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.79
PLN03130 1622 ABC transporter C family member; Provisional 99.78
PRK15494339 era GTPase Era; Provisional 99.78
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.78
PTZ002431560 ABC transporter; Provisional 99.78
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.78
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.78
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.77
KOG00551228 consensus Multidrug/pheromone exporter, ABC superf 99.77
PLN03140 1470 ABC transporter G family member; Provisional 99.76
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.76
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.76
PRK00089292 era GTPase Era; Reviewed 99.76
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.76
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.76
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.75
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 99.75
PLN03140 1470 ABC transporter G family member; Provisional 99.75
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.75
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 99.75
KOG0059885 consensus Lipid exporter ABCA1 and related protein 99.75
KOG0062582 consensus ATPase component of ABC transporters wit 99.75
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.75
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.74
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain 99.74
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.74
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.74
PF00005137 ABC_tran: ABC transporter This structure is on hol 99.73
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-asso 99.73
KOG0056790 consensus Heavy metal exporter HMT1, ABC superfami 99.73
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.72
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.72
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.72
PRK03003472 GTP-binding protein Der; Reviewed 99.71
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.71
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.71
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.7
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.7
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.7
KOG1491391 consensus Predicted GTP-binding protein (ODN super 99.69
PRK03003 472 GTP-binding protein Der; Reviewed 99.69
PRK00093435 GTP-binding protein Der; Reviewed 99.69
PLN03232 1495 ABC transporter C family member; Provisional 99.69
PRK00093 435 GTP-binding protein Der; Reviewed 99.68
PLN03130 1622 ABC transporter C family member; Provisional 99.68
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.68
KOG0062 582 consensus ATPase component of ABC transporters wit 99.68
KOG0061 613 consensus Transporter, ABC superfamily (Breast can 99.68
PTZ00243 1560 ABC transporter; Provisional 99.68
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.68
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.67
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.66
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.66
COG0218200 Predicted GTPase [General function prediction only 99.65
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.64
TIGR00092368 GTP-binding protein YchF. This predicted GTP-bindi 99.64
PRK04213201 GTP-binding protein; Provisional 99.63
KOG0410410 consensus Predicted GTP binding protein [General f 99.63
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.63
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.63
cd03273251 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein 99.62
KOG00541381 consensus Multidrug resistance-associated protein/ 99.62
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.61
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.61
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.61
KOG0054 1381 consensus Multidrug resistance-associated protein/ 99.6
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.6
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.6
KOG0927 614 consensus Predicted transporter (ABC superfamily) 99.6
COG4615546 PvdE ABC-type siderophore export system, fused ATP 99.6
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.59
COG4178604 ABC-type uncharacterized transport system, permeas 99.59
cd03272243 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein 99.59
cd03279213 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex 99.58
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.58
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.57
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are simil 99.57
cd03274212 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein 99.57
cd00881189 GTP_translation_factor GTP translation factor fami 99.57
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.57
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.56
COG1245591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.56
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.56
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.55
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.55
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.55
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.55
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.55
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.55
cd03275247 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein 99.54
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.54
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.54
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.54
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.54
PRK09866 741 hypothetical protein; Provisional 99.52
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.52
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.52
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.52
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.51
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.51
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.51
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.51
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.51
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.51
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.51
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.51
KOG0065 1391 consensus Pleiotropic drug resistance proteins (PD 99.5
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.5
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.5
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.5
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 99.5
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.5
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.5
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.5
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.49
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.49
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.49
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.49
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.49
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.49
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.48
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.48
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.47
cd03276198 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein 99.47
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.47
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.47
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.47
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.46
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.46
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=2.3e-63  Score=436.61  Aligned_cols=316  Identities=57%  Similarity=0.931  Sum_probs=300.6

Q ss_pred             CCHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhhhcCCCCCCCCCCCCcEEEEeCCcEEEEEcCCCCcHHHHHH
Q 021103            1 MGIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGEGFEVTKFGHGRVALIGFPSVGKSTLLT   80 (317)
Q Consensus         1 ~~~~~~i~~~~~~i~~~~~~k~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~valiG~ngaGKSTLln   80 (317)
                      ||++|||+++|||++++|+||||++++.+|++|++++++|++.......+++.+|++.+++..+++|||+|++|||||||
T Consensus         2 ~tieEkIk~iEeeia~tpknKaTe~hig~lKaklA~Lr~El~~~~~~~gggg~gf~V~KsGda~v~lVGfPsvGKStLL~   81 (365)
T COG1163           2 MTIEEKIKAIEEEIARTPKNKATEHHIGLLKAKLAELREELEKRKSKSGGGGSGFAVKKSGDATVALVGFPSVGKSTLLN   81 (365)
T ss_pred             CCHHHHHHHHHHHHHhcccchhhHHHHHHHHHHHHHHHHHHhhhhhcCCCCCCcceEeccCCeEEEEEcCCCccHHHHHH
Confidence            89999999999999999999999999999999999999998775333333347999999999999999999999999999


Q ss_pred             HHhccCCCCCccccceeeeeeEEEEECCeeEEEecCCCccccccCCchhHHHHHhhhccCcEEEEEecCCCchhhHHHHH
Q 021103           81 LLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQILT  160 (317)
Q Consensus        81 ~L~g~~~~v~~~p~tT~~~~~G~i~~~g~~i~~~d~~g~~~~~~~~~~~~~~~~~~~~~~d~i~~v~~~~~~~~~~~~~~  160 (317)
                      +|+|....+++|||||+.|.+|.+.++|.+|+++|+||++..+..+.+++.+.+...+.||++++++|........+.+.
T Consensus        82 ~LTnt~seva~y~FTTl~~VPG~l~Y~ga~IQild~Pgii~gas~g~grG~~vlsv~R~ADlIiiVld~~~~~~~~~~i~  161 (365)
T COG1163          82 KLTNTKSEVADYPFTTLEPVPGMLEYKGAQIQLLDLPGIIEGASSGRGRGRQVLSVARNADLIIIVLDVFEDPHHRDIIE  161 (365)
T ss_pred             HHhCCCccccccCceecccccceEeecCceEEEEcCcccccCcccCCCCcceeeeeeccCCEEEEEEecCCChhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999887665577899


Q ss_pred             HHHHHccccccccCCcccccceeeeeeEeeecCCCCCCCHHHHHHHHHHhcccCcEEEecCCCChhhHHHHHhcccceee
Q 021103          161 KELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMK  240 (317)
Q Consensus       161 ~~L~~~~l~~~~~~~~LS~g~~qr~~ialilDEPt~~LD~~~~~~~l~~l~~~~~~i~~shd~~~~~~~~~~~~~~~~~p  240 (317)
                      +.|+..|+.+++.++......+.+.+|-+....|..++|++.++.+|++++..++.+.+..|.++++++|.+.+++.|+|
T Consensus       162 ~ELe~~GIrlnk~~p~V~I~kk~~gGI~i~~t~~l~~~d~~~ir~iL~Ey~I~nA~V~Ir~dvTlDd~id~l~~nrvY~p  241 (365)
T COG1163         162 RELEDVGIRLNKRPPDVTIKKKESGGIRINGTGPLTHLDEDTVRAILREYRIHNADVLIREDVTLDDLIDALEGNRVYKP  241 (365)
T ss_pred             HHHHhcCeEecCCCCceEEEEeccCCEEEecccccccCCHHHHHHHHHHhCcccceEEEecCCcHHHHHHHHhhcceeee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeEEEecccCCChhhHHHHhcCCCeEEEeccccccHHHHHHHHHHHhCeeEEEecCCCCCCCCCCCEEEeccceee
Q 021103          241 CVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVVCYIS  316 (317)
Q Consensus       241 ~i~v~NK~D~~~~~~~~~l~~~~~~v~iSa~~~~~i~~l~~~i~~~l~~~~~~~~~~~~~~~~~~p~~~~~~~~v~  316 (317)
                      +++|+||+|+.+.++++.+.+.++.+++||..++|+++|.+.||+.|+.+|||||+||..|++++|+|+++||||.
T Consensus       242 ~l~v~NKiD~~~~e~~~~l~~~~~~v~isa~~~~nld~L~e~i~~~L~liRVYtK~~g~~pd~~~PlIlr~GsTV~  317 (365)
T COG1163         242 ALYVVNKIDLPGLEELERLARKPNSVPISAKKGINLDELKERIWDVLGLIRVYTKPPGEEPDFDEPLILRRGSTVG  317 (365)
T ss_pred             eEEEEecccccCHHHHHHHHhccceEEEecccCCCHHHHHHHHHHhhCeEEEEecCCCCCCCCCCCeEEeCCCcHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999984



>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>KOG0055 consensus Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function Back     alignment and domain information
>KOG0056 consensus Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>KOG0062 consensus ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b [Amino acid transport and metabolism; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0061 consensus Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>KOG0054 consensus Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>KOG0927 consensus Predicted transporter (ABC superfamily) [General function prediction only] Back     alignment and domain information
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains Back     alignment and domain information
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0065 consensus Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
4a9a_A376 Structure Of Rbg1 In Complex With Tma46 Dfrp Domain 1e-87
1udx_A416 Crystal Structure Of The Conserved Protein Tt1381 F 3e-12
1lnz_A342 Structure Of The Obg Gtp-Binding Protein Length = 3 5e-12
1jal_A363 Ychf Protein (Hi0393) Length = 363 5e-05
2qu8_A228 Crystal Structure Of Putative Nucleolar Gtp-Binding 2e-04
2dwq_A368 Thermus Thermophilus Ychf Gtp-Binding Protein Lengt 3e-04
2dby_A368 Crystal Structure Of The Gtp-Binding Protein Ychf I 3e-04
>pdb|4A9A|A Chain A, Structure Of Rbg1 In Complex With Tma46 Dfrp Domain Length = 376 Back     alignment and structure

Iteration: 1

Score = 319 bits (818), Expect = 1e-87, Method: Compositional matrix adjust. Identities = 162/299 (54%), Positives = 207/299 (69%), Gaps = 3/299 (1%) Query: 14 MARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSSGAGE--GFEVTKFGHGRVALIGFP 71 MARTQKNKAT +HLGQLKAK+AKLR +LL SG G GF+V + G V +GFP Sbjct: 22 MARTQKNKATSFHLGQLKAKLAKLRRELLTSASSGSGGGAGIGFDVARTGVASVGFVGFP 81 Query: 72 SVGKSXXXXXXXXXHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGR 131 SVGKS SEAA YEFTTL +PG+I Y KIQ+LDLPGII+GA +G+GRG+ Sbjct: 82 SVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGAKDGRGRGK 141 Query: 132 QVIAVSKSSDIVLMVLDASKSEGHRQILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNS 191 QVIAV+++ +++ ++LD +K H+QI+ KELE VG+RLNK PP I KKK+ GGIS + Sbjct: 142 QVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITN 201 Query: 192 TLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEG-NRKYMKCVYVYNKXXX 250 T+PLTH+ ++ EY+I++AE+ FR DATVDDLIDV+E +R+YM +YV NK Sbjct: 202 TVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEASSRRYMPAIYVLNKIDS 261 Query: 251 XXXXXXXKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVL 309 L R PN+V IS NLD LL MW+ + LVR+YTKP+GQ PDFT+PVVL Sbjct: 262 LSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVL 320
>pdb|1UDX|A Chain A, Crystal Structure Of The Conserved Protein Tt1381 From Thermus Thermophilus Hb8 Length = 416 Back     alignment and structure
>pdb|1LNZ|A Chain A, Structure Of The Obg Gtp-Binding Protein Length = 342 Back     alignment and structure
>pdb|1JAL|A Chain A, Ychf Protein (Hi0393) Length = 363 Back     alignment and structure
>pdb|2QU8|A Chain A, Crystal Structure Of Putative Nucleolar Gtp-Binding Protein 1 Pff0625w From Plasmodium Falciparum Length = 228 Back     alignment and structure
>pdb|2DWQ|A Chain A, Thermus Thermophilus Ychf Gtp-Binding Protein Length = 368 Back     alignment and structure
>pdb|2DBY|A Chain A, Crystal Structure Of The Gtp-Binding Protein Ychf In Complexed With Gdp Length = 368 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query317
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 2e-23
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 6e-19
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 6e-17
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 2e-16
1wxq_A 397 GTP-binding protein; structural genomics, riken st 7e-15
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 6e-10
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 5e-09
2wji_A165 Ferrous iron transport protein B homolog; membrane 5e-09
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 2e-08
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 2e-08
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 4e-08
3iby_A256 Ferrous iron transport protein B; G protein, G dom 1e-07
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 1e-07
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 3e-07
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 5e-07
2eki_A93 DRG 1, developmentally-regulated GTP-binding prote 5e-07
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 8e-07
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 9e-06
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 1e-05
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 1e-05
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 2e-05
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 4e-05
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 4e-05
1jal_A363 YCHF protein; nucleotide-binding fold, structural 6e-05
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 8e-05
3lxx_A239 GTPase IMAP family member 4; structural genomics c 2e-04
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 5e-04
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 7e-04
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
 Score = 95.2 bits (237), Expect = 2e-23
 Identities = 25/113 (22%), Positives = 55/113 (48%), Gaps = 3/113 (2%)

Query: 65  VALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGAS 124
           + L G P+VGKS+ + +++  + +  SY FTT     G   +   K Q++D PG+++ A 
Sbjct: 32  IILSGAPNVGKSSFMNIVSRANVDVQSYSFTTKNLYVGHFDHKLNKYQIIDTPGLLDRAF 91

Query: 125 EGKGRGRQ--VIAVSKSSDIVLMVLDASKSEGHR-QILTKELEAVGLRLNKRP 174
           E +       + A++  + ++L ++D S+  G   +       ++    + + 
Sbjct: 92  ENRNTIEMTTITALAHINGVILFIIDISEQCGLTIKEQINLFYSIKSVFSNKS 144


>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Length = 342 Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Length = 416 Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Length = 397 Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Length = 423 Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Length = 188 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Length = 165 Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Length = 274 Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Length = 258 Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Length = 271 Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Length = 256 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Length = 308 Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Length = 262 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Length = 301 Back     alignment and structure
>2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Length = 301 Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Length = 272 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Length = 270 Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Length = 368 Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Length = 363 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Length = 239 Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Length = 190 Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Length = 436 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
4a9a_A376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 100.0
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.95
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.95
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.95
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.94
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.94
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.94
1g6h_A257 High-affinity branched-chain amino acid transport 99.94
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.94
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.94
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.94
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 99.94
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 99.94
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 99.94
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 99.94
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.94
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 99.93
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.93
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.93
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.93
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.93
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.93
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.93
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.93
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.92
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.92
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.91
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.91
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.91
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.91
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.91
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.91
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.91
1wxq_A397 GTP-binding protein; structural genomics, riken st 99.9
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 99.9
2ghi_A260 Transport protein; multidrug resistance protein, M 99.9
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.9
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 99.89
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.89
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.88
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.88
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.87
1jal_A363 YCHF protein; nucleotide-binding fold, structural 99.87
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.87
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.86
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.86
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.86
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.86
2dby_A368 GTP-binding protein; GDP, structural genomics, NPP 99.85
2ohf_A396 Protein OLA1, GTP-binding protein 9; ATPase, GTPas 99.85
2qtf_A364 Protein HFLX, GTP-binding protein; beta-alpha-barr 99.85
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.84
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.84
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.82
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.82
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.81
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 99.81
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.81
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.81
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.81
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.81
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.81
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.8
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 99.8
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.79
1lnz_A342 SPO0B-associated GTP-binding protein; GTPase, OBG, 99.79
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.79
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 99.78
3iby_A256 Ferrous iron transport protein B; G protein, G dom 99.78
3i8s_A274 Ferrous iron transport protein B; GTPase, GPCR, ir 99.78
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 99.78
2wji_A165 Ferrous iron transport protein B homolog; membrane 99.78
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 99.77
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 99.77
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.76
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 99.76
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.76
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 99.76
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.75
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 99.75
3b1v_A272 Ferrous iron uptake transporter protein B; G prote 99.75
3a1s_A258 Iron(II) transport protein B; FEOB, iron transport 99.75
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 99.74
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 99.74
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 99.74
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 99.72
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 99.71
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.69
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.68
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.68
4dcu_A456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.66
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 99.66
2hjg_A436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 99.66
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 99.66
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.66
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 99.65
3lxw_A247 GTPase IMAP family member 1; immunity, structural 99.65
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 99.65
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 99.65
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 99.65
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 99.64
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.64
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 99.64
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.64
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 99.63
3lxx_A239 GTPase IMAP family member 4; structural genomics c 99.63
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 99.63
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 99.63
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 99.62
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 99.61
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.61
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.61
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 99.61
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 99.61
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 99.6
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 99.59
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 99.59
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 99.59
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 99.59
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 99.59
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 99.59
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 99.59
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 99.59
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 99.58
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 99.58
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 99.58
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 99.58
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 99.58
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 99.58
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 99.58
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 99.58
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 99.58
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 99.58
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 99.58
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 99.58
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 99.58
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 99.58
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 99.58
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 99.58
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 99.58
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 99.58
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 99.57
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 99.57
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.57
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 99.57
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 99.57
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 99.57
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.57
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 99.57
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 99.57
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 99.57
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 99.57
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 99.56
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 99.56
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 99.56
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 99.56
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 99.56
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 99.56
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 99.56
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 99.56
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 99.56
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 99.55
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 99.55
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 99.55
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 99.55
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 99.55
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 99.55
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 99.54
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 99.54
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 99.54
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 99.54
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 99.54
2www_A349 Methylmalonic aciduria type A protein, mitochondri 99.54
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 99.54
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 99.54
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 99.54
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 99.54
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 99.54
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 99.53
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 99.53
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 99.53
1e69_A322 Chromosome segregation SMC protein; structural mai 99.53
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 99.53
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 99.53
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 99.53
1wb1_A 482 Translation elongation factor SELB; selenocysteine 99.53
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 99.53
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 99.53
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 99.52
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 99.52
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 99.52
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 99.52
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 99.51
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 99.51
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 99.51
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 99.51
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 99.51
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 99.51
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 99.5
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 99.5
3t5d_A274 Septin-7; GTP-binding protein, cytoskeleton, signa 99.5
3r7w_A307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 99.5
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 99.5
3t1o_A198 Gliding protein MGLA; G domain containing protein, 99.5
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 99.49
3o47_A329 ADP-ribosylation factor GTPase-activating protein 99.49
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 99.49
3sjy_A 403 Translation initiation factor 2 subunit gamma; zin 99.49
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 99.48
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 99.48
2fh5_B214 SR-beta, signal recognition particle receptor beta 99.48
3j2k_7 439 ERF3, eukaryotic polypeptide chain release factor 99.48
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 99.48
3tr5_A 528 RF-3, peptide chain release factor 3; protein synt 99.48
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 99.47
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 99.47
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 99.47
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 99.47
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 99.47
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 99.46
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 99.45
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 99.45
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 99.44
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 99.44
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.44
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.44
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 99.43
2wkq_A332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 99.42
1kk1_A 410 EIF2gamma; initiation of translation; HET: GNP; 1. 99.42
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 99.41
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 99.41
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 99.39
2elf_A 370 Protein translation elongation factor 1A; tRNA, py 99.39
2c78_A 405 Elongation factor TU-A; hydrolase, GTPase, transla 99.38
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 99.08
1s0u_A 408 EIF-2-gamma, translation initiation factor 2 gamma 99.38
3izy_P 537 Translation initiation factor IF-2, mitochondrial; 99.38
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 99.38
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 99.37
3llu_A196 RAS-related GTP-binding protein C; structural geno 99.36
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 99.35
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 99.34
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 99.34
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 99.33
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 99.33
1zun_B 434 Sulfate adenylate transferase, subunit 1/adenylyls 99.32
2x2e_A353 Dynamin-1; nitration, hydrolase, membrane fission, 99.32
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 99.3
2ywe_A 600 GTP-binding protein LEPA; G domain, beta-barrel, f 99.3
1d2e_A 397 Elongation factor TU (EF-TU); G-protein, beta-barr 99.3
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 99.29
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 99.29
3cb4_D 599 GTP-binding protein LEPA; GTPase, OB-fold, membran 99.28
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 99.28
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 99.25
1jny_A 435 EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF- 99.25
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 99.24
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 99.24
1zo1_I 501 IF2, translation initiation factor 2; E. coli, rib 99.24
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 99.24
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 99.23
2dy1_A 665 Elongation factor G; translocation, GTP complex, s 99.23
1f60_A 458 Elongation factor EEF1A; protein-protein complex, 99.23
2xex_A 693 Elongation factor G; GTPase, translation, biosynth 99.22
2ged_A193 SR-beta, signal recognition particle receptor beta 99.21
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 99.21
1dar_A 691 EF-G, elongation factor G; ribosomal translocase, 99.2
2h5e_A 529 Peptide chain release factor RF-3; beta barrel, tr 99.19
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 99.19
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.19
2qag_A361 Septin-2, protein NEDD5; cell cycle, cell division 99.17
2eyu_A261 Twitching motility protein PILT; pilus retraction 99.17
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 99.16
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.15
1g7s_A 594 Translation initiation factor IF2/EIF5B; translati 99.14
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 99.1
2og2_A359 Putative signal recognition particle receptor; nuc 99.1
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 99.09
3ec1_A369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 99.07
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 99.07
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 99.04
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 99.03
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 99.02
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 99.01
2rdo_7 704 EF-G, elongation factor G; elongation factor G, EF 99.01
1nrj_B218 SR-beta, signal recognition particle receptor beta 99.01
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 99.01
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.99
3h2y_A368 GTPase family protein; GTP-binding protein YQEH, p 98.99
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 98.98
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 98.98
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 98.97
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 98.93
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 98.93
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 98.93
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 98.92
4a74_A231 DNA repair and recombination protein RADA; hydrola 98.91
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.89
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.87
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.87
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 98.87
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 98.86
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 98.83
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 98.83
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 98.81
1n0u_A 842 EF-2, elongation factor 2; G-protein, CIS-proline, 98.81
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 98.79
2ewv_A372 Twitching motility protein PILT; pilus retraction 98.79
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 98.79
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.78
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 98.75
3j25_A 638 Tetracycline resistance protein TETM; antibiotic r 98.75
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.75
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.74
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 98.71
2hf9_A226 Probable hydrogenase nickel incorporation protein 98.71
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 98.69
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.67
3r7w_B331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 98.65
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 98.63
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 98.61
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 98.6
1p9r_A418 General secretion pathway protein E; bacterial typ 98.57
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 98.56
3kta_B173 Chromosome segregation protein SMC; structural mai 98.56
3cnl_A262 YLQF, putative uncharacterized protein; circular p 98.55
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 98.54
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 98.54
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 98.53
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.52
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.48
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.47
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 98.44
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.43
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.43
2cvh_A220 DNA repair and recombination protein RADB; filamen 98.41
4fn5_A 709 EF-G 1, elongation factor G 1; translation, transl 98.37
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 98.36
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 98.34
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.32
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.31
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 98.31
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 98.3
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 98.3
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 98.29
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 98.28
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 98.26
3q5d_A447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 98.24
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 98.23
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.18
1vma_A306 Cell division protein FTSY; TM0570, structural gen 98.18
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 98.18
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 98.14
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.13
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 98.12
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 98.11
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 98.1
2oap_1511 GSPE-2, type II secretion system protein; hexameri 98.09
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 98.07
2eki_A93 DRG 1, developmentally-regulated GTP-binding prote 98.03
3kta_A182 Chromosome segregation protein SMC; structural mai 98.01
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.98
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 97.96
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 97.96
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 97.84
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 97.83
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 97.82
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 97.81
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.75
2ius_A512 DNA translocase FTSK; nucleotide-binding, chromoso 97.73
1kag_A173 SKI, shikimate kinase I; transferase, structural g 97.7
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 97.67
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 97.67
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.67
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 97.64
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.63
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 97.62
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.61
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase 97.4
1w1w_A 430 Structural maintenance of chromosome 1; cohesin, c 97.4
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 97.38
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 97.37
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 97.36
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 97.35
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 97.35
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 97.32
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 97.32
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.3
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 97.3
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 97.3
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.29
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.27
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 97.24
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.22
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.21
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.06
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 97.06
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 97.03
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 97.02
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 97.02
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 97.0
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 96.98
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.97
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 96.94
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 96.94
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 96.9
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 96.88
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 96.78
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 96.76
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 96.73
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.68
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 96.68
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 96.66
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 96.65
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 96.64
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 96.61
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 96.6
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 96.59
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 96.58
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 96.55
1via_A175 Shikimate kinase; structural genomics, transferase 96.54
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 96.53
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 96.53
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 96.52
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 96.51
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 96.5
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 96.49
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 96.49
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.46
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.43
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 96.43
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 96.42
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 96.42
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.42
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 96.39
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 96.39
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 96.38
3r20_A233 Cytidylate kinase; structural genomics, seattle st 96.37
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 96.36
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 96.36
1xjc_A169 MOBB protein homolog; structural genomics, midwest 96.35
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 96.34
3ice_A422 Transcription termination factor RHO; transcriptio 96.31
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 96.31
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.3
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 96.3
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 96.3
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 96.3
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 96.28
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 96.25
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 96.24
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 96.23
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 96.22
2vli_A183 Antibiotic resistance protein; transferase, tunica 96.2
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 96.19
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 96.18
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.17
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 96.15
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 96.15
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.14
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 96.11
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.1
3tlx_A243 Adenylate kinase 2; structural genomics, structura 96.07
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 96.07
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.06
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 96.05
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.05
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.04
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.01
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 95.97
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.96
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 95.91
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 95.87
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 95.87
3bos_A242 Putative DNA replication factor; P-loop containing 95.87
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.86
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 95.81
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.8
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 95.79
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.78
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 95.78
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 95.73
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 95.73
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.7
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 95.7
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 95.66
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 95.64
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 95.6
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 95.58
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 95.53
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 95.5
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 95.5
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 95.44
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.39
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 95.35
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.33
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 95.29
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 95.25
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 95.24
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.22
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=3.1e-47  Score=353.85  Aligned_cols=314  Identities=58%  Similarity=0.954  Sum_probs=276.4

Q ss_pred             CHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhhhcCCCCCCC--CCCCCcEEEEeCCcEEEEEcCCCCcHHHHH
Q 021103            2 GIIEKIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGSS--GAGEGFEVTKFGHGRVALIGFPSVGKSTLL   79 (317)
Q Consensus         2 ~~~~~i~~~~~~i~~~~~~k~~~~~~~~l~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~g~~valiG~ngaGKSTLl   79 (317)
                      |++|||+++|++++++|+||||++++.+|++|++++++++.....++.  +++.+|.+..++...|||||+|||||||||
T Consensus        10 t~~eki~~ie~~~~~~~k~k~Te~~~~~lk~kla~lr~el~~~~~~~~~~~~~~~f~v~k~g~a~V~ivG~PNvGKSTL~   89 (376)
T 4a9a_A           10 TTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRRELLTSASSGSGGGAGIGFDVARTGVASVGFVGFPSVGKSTLL   89 (376)
T ss_dssp             HHHHHHHHHHHHHHHSCCSTTTHHHHHHHHHHHHHHHHHHHCC-------CCSBTTTBCBCSSEEEEEECCCCHHHHHHH
T ss_pred             CHHHHHHHHHHHHHhcchhhhHHHHHHHHHHHHHHHHHHHhhhhccCCCCCCCCCceEeecCCCeEEEECCCCCCHHHHH
Confidence            689999999999999999999999999999999999999876554433  335678888888899999999999999999


Q ss_pred             HHHhccCCCCCccccceeeeeeEEEEECCeeEEEecCCCccccccCCchhHHHHHhhhccCcEEEEEecCCCchhhHHHH
Q 021103           80 TLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHRQIL  159 (317)
Q Consensus        80 n~L~g~~~~v~~~p~tT~~~~~G~i~~~g~~i~~~d~~g~~~~~~~~~~~~~~~~~~~~~~d~i~~v~~~~~~~~~~~~~  159 (317)
                      |+|+|....+++|||||++|..|.+.+.|.++.++||||+.+....+.+.+.+++..++.+|++++++|+.++..+.+.+
T Consensus        90 n~Lt~~~~~v~~~pftT~~~~~g~~~~~~~~i~l~D~pGl~~~a~~~~~~g~~~l~~i~~ad~il~vvD~~~p~~~~~~i  169 (376)
T 4a9a_A           90 SKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIILDVNKPLHHKQII  169 (376)
T ss_dssp             HHHHSBCCCGGGTCSSCCCEEEEEEEETTEEEEEEECGGGCCC-----CHHHHHHHHHHHCSEEEEEEETTSHHHHHHHH
T ss_pred             HHHhCCCCcccCCCCceeeeeeEEEEeCCcEEEEEeCCCccCCchhhhHHHHHHHHHHHhcCccccccccCccHHHHHHH
Confidence            99999988899999999999999999999999999999999887777888889999999999999999998877777788


Q ss_pred             HHHHHHccccccccCCcccccceeeeeeEeeecCCCCCCCHHHHHHHHHHhcccCcEEEecCCCChhhHHHHHhc-ccce
Q 021103          160 TKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTHVDEKLCYQILHEYKIHNAEVLFREDATVDDLIDVIEG-NRKY  238 (317)
Q Consensus       160 ~~~L~~~~l~~~~~~~~LS~g~~qr~~ialilDEPt~~LD~~~~~~~l~~l~~~~~~i~~shd~~~~~~~~~~~~-~~~~  238 (317)
                      ...|+.+++.+.+++..+....+.+.++.+....|..++|.+.+..++..+......+++.-+.+.+++++.+.. .+.+
T Consensus       170 ~~EL~~~~~~l~~k~~~i~~nK~d~~gi~i~~~~~~~~l~~eeik~il~~~~lt~kpv~~~~nv~eddl~d~~~~~~~~~  249 (376)
T 4a9a_A          170 EKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEASSRRY  249 (376)
T ss_dssp             HHHHHHTTEEETCCCCCEEEEECSSSCEEEEESSCCSSCCHHHHHHHHHHTTCCSEEEEECSCCCHHHHHHHHTTTTCEE
T ss_pred             HHHHHHhhHhhccCChhhhhhHhhhhhhhhhcchhhhhccHHHHHHHHHHhcccCCCeeecccCCHHHHHHHHHHHHhhc
Confidence            888999998778888887777777888888888899999999999988888777777777778888898888754 5678


Q ss_pred             eeeeEEEecccCCChhhHHHHhcCCCeEEEeccccccHHHHHHHHHHHhCeeEEEecCCCCCCCCCCCEEEecc-cee
Q 021103          239 MKCVYVYNKIDVIGIDDVDKLARQPNSVVISCNLKLNLDRLLARMWEEMGLVRVYTKPQGQQPDFTEPVVLSVV-CYI  315 (317)
Q Consensus       239 ~p~i~v~NK~D~~~~~~~~~l~~~~~~v~iSa~~~~~i~~l~~~i~~~l~~~~~~~~~~~~~~~~~~p~~~~~~-~~v  315 (317)
                      .|++++.||+|....++++.+.+.+..+++|+..+.|+++|.+.+++.|+.+++||+.|+..++|..|++++++ +||
T Consensus       250 ~p~i~v~nKid~~~~eele~l~~~~~~~~is~~~e~gLd~Li~~~y~~L~Li~~fT~g~~E~rawt~~~~~~a~~at~  327 (376)
T 4a9a_A          250 MPAIYVLNKIDSLSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVLRSDRCSV  327 (376)
T ss_dssp             ECEEEEEECGGGSCHHHHHHHTTSTTEEECCTTTCTTHHHHHHHHHHHHCCEEEEECCSSSCCCSSSCEEEBTTBCBH
T ss_pred             cceEEEEecccccCHHHHHHHhcccchhhhhhhhcccchhHHHHHHHHcCCcEEEeCCCCCcCCCCccccccCCCCcH
Confidence            99999999999999888888888889999999999999999999999999999999999999999999999987 775



>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>1wxq_A GTP-binding protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.60A {Pyrococcus horikoshii} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>1jal_A YCHF protein; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; 2.40A {Haemophilus influenzae} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2dby_A GTP-binding protein; GDP, structural genomics, NPPSFA, natio project on protein structural and functional analyses; HET: GDP; 1.76A {Thermus thermophilus} PDB: 2dwq_A Back     alignment and structure
>2ohf_A Protein OLA1, GTP-binding protein 9; ATPase, GTPase, P-loop, OBG-like, hydrolase; HET: ACP; 2.70A {Homo sapiens} Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>3i8s_A Ferrous iron transport protein B; GTPase, GPCR, iron uptake, FEO, cell inner membrane, cell ME GTP-binding, ION transport, membrane; 1.80A {Escherichia coli} PDB: 3i8x_A* 3i92_A* 3hyr_A 3hyt_A* 2wic_A* 2wib_A* 2wia_A* Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* Back     alignment and structure
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1wb1_A Translation elongation factor SELB; selenocysteine, protein synthesis, selenium, ribosome; HET: GDP DXC; 3.0A {Methanococcus maripaludis} SCOP: b.43.3.1 b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1wb2_A* 1wb3_A* Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>3t5d_A Septin-7; GTP-binding protein, cytoskeleton, signaling protein; HET: GDP; 3.30A {Homo sapiens} PDB: 3tw4_A* Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_A* Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} SCOP: c.37.1.8 PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 4gmx_A* 4gpt_A* 4hat_A* 4hau_A* 4hav_A* 4haw_A* ... Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3sjy_A Translation initiation factor 2 subunit gamma; zinc finger, initiate translation, tRNA binding, mRNA bindin binding; HET: GCP GDP; 2.00A {Sulfolobus solfataricus P2} PDB: 3pen_A* 3sjz_A* 2qn6_A* 2aho_A 2qmu_A* 2plf_A* 3v11_A* 3i1f_A* 3cw2_A 2pmd_A* 3p3m_A* 3qsy_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>3j2k_7 ERF3, eukaryotic polypeptide chain release factor 3; rabbit 80S ribosome, ribosome-translation complex; 17.00A {Oryctolagus cuniculus} Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3tr5_A RF-3, peptide chain release factor 3; protein synthesis, translation; HET: GDP; 2.11A {Coxiella burnetii} Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A* Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>2elf_A Protein translation elongation factor 1A; tRNA, pyrrolysine, structural genomics, NPPSFA; HET: CIT; 1.70A {Methanosarcina mazei} Back     alignment and structure
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2y0u_Z* 2y0w_Z* 2y0y_Z* 2y10_Z* 2y12_Z* 2y14_Z* 2y16_Z* 2y18_Z* 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 2xqd_Z* 3fic_Z* 4abr_Z* 1b23_P* 1ob5_A* 1ttt_A* ... Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>3izy_P Translation initiation factor IF-2, mitochondrial; E coli, RNA, ribosomal; 10.80A {Bos taurus} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>2ywe_A GTP-binding protein LEPA; G domain, beta-barrel, ferredoxin-like domain, structural GE NPPSFA; 2.05A {Aquifex aeolicus} PDB: 2ywf_A* 2ywg_A* 2ywh_A* Back     alignment and structure
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>3cb4_D GTP-binding protein LEPA; GTPase, OB-fold, membrane, nucleotide-binding, translation; 2.80A {Escherichia coli} PDB: 3deg_C* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A* 3agj_A* Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>1zo1_I IF2, translation initiation factor 2; E. coli, ribosome, initiation of protein synthesis, cryo-eletron microscopy, translation/RNA complex; 13.80A {Escherichia coli} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* Back     alignment and structure
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A Back     alignment and structure
>2xex_A Elongation factor G; GTPase, translation, biosynthetic protein; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1dar_A EF-G, elongation factor G; ribosomal translocase, translational GTPase; HET: GDP; 2.40A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 PDB: 1elo_A 1ktv_A 2om7_L* 2wri_Y* 2wrk_Y* 2xsy_Y* 2xuy_Y* 2j7k_A* 2efg_A* 1jqm_B 1efg_A* 1fnm_A* 1pn6_A 2bm1_A* 2bm0_A* 2bv3_A* 3izp_E 1zn0_B 1jqs_C 2bcw_C ... Back     alignment and structure
>2h5e_A Peptide chain release factor RF-3; beta barrel, translation; HET: GDP; 2.80A {Escherichia coli} PDB: 2o0f_A 3sfs_W* 3zvo_Y* 3uoq_W* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>1g7s_A Translation initiation factor IF2/EIF5B; translational GTPase; HET: GDP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: b.43.3.1 b.43.3.1 c.20.1.1 c.37.1.8 PDB: 1g7r_A* 1g7t_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2rdo_7 EF-G, elongation factor G; elongation factor G, EF-G, RRF, GDPNP, 50S subunit, cryo-EM, REAL-space refinement, ribonucleoprotein; 9.10A {Escherichia coli} PDB: 3j0e_H Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>1n0u_A EF-2, elongation factor 2; G-protein, CIS-proline, translation; HET: SO1; 2.12A {Saccharomyces cerevisiae} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1n0v_C 1s1h_T 2e1r_A* 2npf_A* 2p8w_T* 3dny_T 3b82_A* 1zm2_A* 1zm3_A* 1zm4_A* 1zm9_A* 2p8x_T* 2p8y_T* 2p8z_T* 2zit_A* 1u2r_A* 3b78_A* 3b8h_A* Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3j25_A Tetracycline resistance protein TETM; antibiotic resistance, translation; HET: GCP; 7.20A {Enterococcus faecalis} Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} PDB: 4arz_B* Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>4fn5_A EF-G 1, elongation factor G 1; translation, translation-antibiotic compl; HET: 0UO; 2.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2eki_A DRG 1, developmentally-regulated GTP-binding protein 1; protein NEDD3, neural precursor cell expressed developmentally DOWN-regulated protein 3; NMR {Homo sapiens} Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 317
d1wxqa1319 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyr 4e-30
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 2e-18
d1jala1278 c.37.1.8 (A:1-278) YchF GTP-binding protein N-term 3e-18
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 1e-17
d1ni3a1296 c.37.1.8 (A:11-306) YchF GTP-binding protein N-ter 2e-14
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 4e-10
d1egaa1179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 3e-08
d1tq4a_400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 3e-06
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 5e-06
d2cxxa1184 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyroc 6e-06
d2gj8a1161 c.37.1.8 (A:216-376) Probable tRNA modification GT 1e-05
d1puia_188 c.37.1.8 (A:) Probable GTPase EngB {Escherichia co 1e-05
d1h65a_257 c.37.1.8 (A:) Chloroplast protein translocon GTPas 3e-05
d1wf3a1178 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain { 4e-05
d1mkya2186 c.37.1.8 (A:173-358) Probable GTPase Der, N-termin 7e-05
d1mkya1171 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal 1e-04
d1svia_195 c.37.1.8 (A:) Probable GTPase EngB {Bacillus subti 9e-04
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 0.002
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 0.002
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 0.002
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 0.002
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 0.004
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Length = 319 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: GTP-binding protein PH0525
species: Pyrococcus horikoshii [TaxId: 53953]
 Score =  114 bits (285), Expect = 4e-30
 Identities = 54/301 (17%), Positives = 107/301 (35%), Gaps = 57/301 (18%)

Query: 64  RVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIH------------------ 105
            + ++G P+VGKST  +  T    E A+Y FTT+    G+ +                  
Sbjct: 2   EIGVVGKPNVGKSTFFSAATLVDVEIANYPFTTIEANVGVTYAITDHPCKELGCSPNPQN 61

Query: 106 ------YNDTKIQLLDLPGIIEGASEGKGRGRQVIAVSKSSDIVLMVLDASKSEGHR--- 156
                      ++++D+ G++ GA EG+G G + +   + +  ++ V+DA+         
Sbjct: 62  YEYRNGLALIPVKMVDVAGLVPGAHEGRGLGNKFLDDLRMASALIHVVDATGKTDPEGQP 121

Query: 157 ----------QILTKELEAVGLRLNKRPPQIYFKKKKTGGISFNSTLPLTH----VDEKL 202
                     + L +E++     +  +    + K+ K   I   S +        V+E  
Sbjct: 122 TDYHDPVEDIEFLEREIDYWIYGILSKGWDKFAKRIKLQKIKLESAIAEHLSGIGVNEND 181

Query: 203 CYQILHEYKIHNAEVLFREDATVDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLARQ 262
            ++ +H+  +      + +D   D L    E  R     V   NK D    + + +L R+
Sbjct: 182 VWEAMHKLNLPEDPTKWSQD---DLLAFASEIRRVNKPMVIAANKADAASDEQIKRLVRE 238

Query: 263 PNS-----VVISCNLKLNLDRL--------LARMWEEMGLVRVYTKPQGQQPDFTEPVVL 309
                   +  S   +L L +         +    E   L  +  K +       E V+ 
Sbjct: 239 EEKRGYIVIPTSAAAELTLRKAAKAGFIEYIPGASEFKVLRDMSEKQKRALMVIKEKVLD 298

Query: 310 S 310
            
Sbjct: 299 R 299


>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Length = 278 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 296 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Length = 184 Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Length = 188 Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 257 Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Length = 178 Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 186 Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Length = 195 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query317
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.97
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.97
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.97
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.97
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.97
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.96
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.96
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.96
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.96
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.95
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.95
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.95
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.93
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.93
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.93
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.93
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.92
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.92
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.92
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.89
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.86
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.85
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.84
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.84
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.82
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.81
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.8
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.78
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.78
d1wxqa1319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.77
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.75
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.7
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.7
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.66
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.64
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.59
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.58
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 99.55
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.54
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.53
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.51
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.51
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.5
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 99.5
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.49
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.47
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.46
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.45
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.44
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.43
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.43
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.43
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.43
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.42
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.42
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.41
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.4
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.39
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.39
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.39
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.38
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.38
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.37
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.37
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.36
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.36
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.36
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.35
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.35
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.35
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.33
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.31
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.31
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.31
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 99.3
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.3
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.27
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.25
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.23
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.22
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.19
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.18
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.17
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.15
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.13
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 99.11
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.09
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.08
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.0
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 98.97
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 98.94
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 98.91
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.9
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 98.81
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.78
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 98.66
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 98.59
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 98.5
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 98.43
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 98.42
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.39
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 98.33
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.1
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 97.92
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.87
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 97.73
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 97.59
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.57
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 97.55
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 97.45
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.42
d1vmaa2213 GTPase domain of the signal recognition particle r 97.42
d2qy9a2211 GTPase domain of the signal recognition particle r 97.42
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 97.36
d1okkd2207 GTPase domain of the signal recognition particle r 97.34
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.34
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 97.3
d1ls1a2207 GTPase domain of the signal sequence recognition p 97.28
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.26
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 97.24
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.22
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.19
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.15
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.12
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.1
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 97.1
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.08
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 97.05
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 97.05
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 97.05
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 97.01
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 96.97
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 96.97
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 96.96
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.94
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 96.87
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.85
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 96.84
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 96.82
d1u0la2 225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 96.81
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.81
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.79
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 96.78
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.77
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 96.76
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.76
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 96.75
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 96.73
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.73
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 96.72
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.7
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 96.7
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.69
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 96.68
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.68
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 96.65
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.64
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.6
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.57
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.49
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.32
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.32
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.16
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.13
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 96.1
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.09
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.03
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 95.92
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 95.8
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 95.8
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 95.73
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.73
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 95.71
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 95.71
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 95.68
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.63
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.59
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.59
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.58
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 95.5
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.47
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.37
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.35
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.32
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 95.31
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.28
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.23
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.23
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 95.16
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 95.09
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.07
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 94.98
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 94.95
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 94.91
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.89
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 94.85
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 94.83
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.79
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.65
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 94.63
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 94.55
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 94.48
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 94.4
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 94.31
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 94.23
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.14
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 93.95
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 93.94
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 93.94
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 93.84
d1xpua3289 Transcription termination factor Rho, ATPase domai 93.82
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.79
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.75
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 93.7
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 93.53
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 93.32
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 93.31
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 93.02
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.99
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 92.68
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 92.63
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 92.63
d1tuea_205 Replication protein E1 helicase domain {Human papi 92.37
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 92.25
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 92.22
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 91.74
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 91.42
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 90.97
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 90.95
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 90.79
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 90.66
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 90.57
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 90.43
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 90.21
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 89.48
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 88.97
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 88.96
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 88.95
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 88.32
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 88.19
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 86.37
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 85.47
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 85.37
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 85.06
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 83.56
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 83.42
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 82.71
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 81.37
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 80.52
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Maltose transport protein MalK, N-terminal domain
species: Archaeon Thermococcus litoralis [TaxId: 2265]
Probab=99.97  E-value=1.8e-32  Score=236.95  Aligned_cols=188  Identities=16%  Similarity=0.173  Sum_probs=135.5

Q ss_pred             CCcEEEEeCCcEEEEEcCCCCcHHHHHHHHhccCCCCCccccceeeeeeEEEEECCeeEEEecCCCccccccCCchhHHH
Q 021103           53 EGFEVTKFGHGRVALIGFPSVGKSTLLTLLTGTHSEAASYEFTTLTCIPGIIHYNDTKIQLLDLPGIIEGASEGKGRGRQ  132 (317)
Q Consensus        53 ~~~~~~~~~g~~valiG~ngaGKSTLln~L~g~~~~v~~~p~tT~~~~~G~i~~~g~~i~~~d~~g~~~~~~~~~~~~~~  132 (317)
                      .++||++++|+++||+||||||||||+++|+|+..|           ++|.|.++|.++...+............++++|
T Consensus        20 ~~vsl~i~~Ge~~~liG~sGaGKSTll~~i~gl~~p-----------~sG~I~~~g~~i~~~~~~~~~~~~~r~ig~v~Q   88 (240)
T d1g2912          20 REMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEP-----------SRGQIYIGDKLVADPEKGIFVPPKDRDIAMVFQ   88 (240)
T ss_dssp             EEEEEEEETTCEEEEECSTTSSHHHHHHHHHTSSCC-----------SEEEEEETTEEEEEGGGTEECCGGGSSEEEECS
T ss_pred             cceeeEEcCCCEEEEECCCCChHHHHHHHHhcCCCC-----------CCCEEEECCEEecccchhhhcccccccceeccc
Confidence            578899999999999999999999999999999988           899999999988655432222222334444444


Q ss_pred             HHhhhcc---CcEEEEEecC--CCchhhHHHHHHHHHHccc--cccccCCcccccceeeeeeE---------eeecCCCC
Q 021103          133 VIAVSKS---SDIVLMVLDA--SKSEGHRQILTKELEAVGL--RLNKRPPQIYFKKKKTGGIS---------FNSTLPLT  196 (317)
Q Consensus       133 ~~~~~~~---~d~i~~v~~~--~~~~~~~~~~~~~L~~~~l--~~~~~~~~LS~g~~qr~~ia---------lilDEPt~  196 (317)
                      ....+..   .+++.+....  .......+++.++|+.+++  ..++++.+|||||+||++||         +++||||+
T Consensus        89 ~~~L~~~ltV~eni~~~~~~~~~~~~e~~~~v~~~l~~~~l~~~~~~~p~~LSGGqkQRv~IAraL~~~P~iLllDEPt~  168 (240)
T d1g2912          89 SYALYPHMTVYDNIAFPLKLRKVPRQEIDQRVREVAELLGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLS  168 (240)
T ss_dssp             CCCCCTTSCHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHTCGGGTTCCGGGSCHHHHHHHHHHHHHHTCCSEEEEECTTT
T ss_pred             chhhcchhhhhHhhhhhHHHcCCCHHHHHHHHHHHHHHcCChhHhcCChhhCCHHHHHHHHHHHHHhcCCCEEEecCCCc
Confidence            4333322   2222222221  2233445678999999999  77999999999999999999         99999999


Q ss_pred             CCCHHHHHHHHH---Hhcc-cC-cEEEecCCCC-hhhHHHHHhcccceeeeeEEEecccCCChhhHHHHhc
Q 021103          197 HVDEKLCYQILH---EYKI-HN-AEVLFREDAT-VDDLIDVIEGNRKYMKCVYVYNKIDVIGIDDVDKLAR  261 (317)
Q Consensus       197 ~LD~~~~~~~l~---~l~~-~~-~~i~~shd~~-~~~~~~~~~~~~~~~p~i~v~NK~D~~~~~~~~~l~~  261 (317)
                      +||+.....+++   .+.. .+ |+|++|||.. +..+|          ..++|+++.-++..+..+++..
T Consensus       169 ~LD~~~~~~i~~~l~~l~~~~g~tvi~vTHd~~~~~~~~----------drv~vm~~G~iv~~G~~~el~~  229 (240)
T d1g2912         169 NLDAKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMG----------DRIAVMNRGVLQQVGSPDEVYD  229 (240)
T ss_dssp             TSCHHHHHHHHHHHHHHHHHHTCEEEEEESCHHHHHHHC----------SEEEEEETTEEEEEECHHHHHH
T ss_pred             ccCHHHHHHHHHHHHHHHhccCCEEEEEcCCHHHHHHhC----------CEEEEEECCEEEEEcCHHHHHh
Confidence            999998655544   4433 24 9999999954 44544          4578888887765554444443



>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure