Citrus Sinensis ID: 021188


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310------
MHTMRAARAAGTKRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNTLLTNSSAQSSNFSIIPSVSSSTLSPLPSTILYNSNQTINENSSSETSPNFFPGDFSKISQLQQPGITQQPTSPHAYGNNVCSNQIVPNDSYYVDCCGFDMEGYSLTDPIAEMSSYDISSSECQMAEADWMSNDMSDALWSMDDIWQLRE
cccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHccccccHHHHcccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccc
cccccccHHcccccccccccHHccccccccccHHHHHHHHHHHHHHcccccHHHHHHccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHcccHHHHcccccccccccHHHHHcccccHHHHcccccccccHcccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccHHHHHHHcc
MHTMRAARAagtkrecnsseedqqelrrgpwtleeDTLLTHYIHQHGEGRWNMVAKCAglkrtgksCRLRWLNylkpdikrgnltpQEQFLILELHSKWGnrwskiaqclpgrtdneikNYWRTRVQKQARQLNIESNSETFFEAVRCYWMPRLLQKmeqnsaspntlltnssaqssnfsiipsvssstlsplpstilynsnqtinensssetspnffpgdfskisqlqqpgitqqptsphaygnnvcsnqivpndsyyvdccgfdmegysltdpiaemssydissseCQMAEADWMSNDMSDALWSMDDIWQLRE
mhtmraaraagtkrecnsseedqqelrrgpwTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYlkpdikrgnlTPQEQFLILELHSKWGNRWSKIAqclpgrtdneikNYWRTRVQKQArqlniesnseTFFEAVRCYWMPRLLQKMEQNSASPNTLLTNSSAQSSNFSIIPSVSSSTLSPLPSTILYNSNQTINENSSSETSPNFFPGDFSKISQLQQPGITQQPTSPHAYGNNVCSNQIVPNDSYYVDCCGFDMEGYSLTDPIAEMSSYDISSSECQMAEADWMSNDMSDALWSMDDIWQLRE
MHTMRAARAAGTKRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNTLLTNSSAQssnfsiipsvssstlsplpstilYNSNQTINENSSSETSPNFFPGDFSKISQLQQPGITQQPTSPHAYGNNVCSNQIVPNDSYYVDCCGFDMEGYSLTDPIAEMSSYDISSSECQMAEADWMSNDMSDALWSMDDIWQLRE
******************************WTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSETFFEAVRCYWMPRLL***************************************************************************************YGNNVCSNQIVPNDSYYVDCCGFDMEGYSLTDPIAEM****************W******DALWSMDDIW****
*****************************PWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQK******************************************************************************************************************YGNNVCSNQIVPNDSYYVDCCGFDMEGYS****************ECQMAEADWMSNDMSDALWSMDDIWQLRE
***************************RGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNTLLTNSSAQSSNFSIIPSVSSSTLSPLPSTILYNSNQTI*********PNFFPGDFSKISQLQQPGITQQPTSPHAYGNNVCSNQIVPNDSYYVDCCGFDMEGYSLTDPIAEMSSYDISSSECQMAEADWMSNDMSDALWSMDDIWQLRE
**************ECNSSE**QQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSETFFEAVRCYWM**********************************SSSTLSPLPST*****************************SQLQQPGITQQPTSPHAYGNNVCSNQ**PNDSYYVDCCGFDMEGYSLTDPIAEMSSYDISSSECQMAEADWMSNDMSDALWSMDDIWQLRE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHTMRAARAAGTKRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNTLLTNSSAQSSNFSIIPSVSSSTLSPLPSTILYNSNQTINENSSSETSPNFFPGDFSKISQLQQPGITQQPTSPHAYGNNVCSNQIVPNDSYYVDCCGFDMEGYSLTDPIAEMSSYDISSSECQMAEADWMSNDMSDALWSMDDIWQLRE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query316 2.2.26 [Sep-21-2011]
P81391205 Myb-related protein 305 O N/A no 0.398 0.614 0.676 7e-49
Q9LK95226 Transcription factor MYB2 no no 0.370 0.517 0.675 6e-48
P81396198 Myb-related protein 340 O N/A no 0.370 0.590 0.685 7e-47
Q4JL84235 Transcription factor MYB5 no no 0.348 0.468 0.663 7e-42
Q9LX82256 Transcription factor MYB4 no no 0.335 0.414 0.660 1e-40
P81394268 Myb-related protein 315 O N/A no 0.607 0.716 0.426 4e-37
Q4JL76242 Myb-related protein MYBAS no no 0.348 0.454 0.609 7e-37
Q53NK6237 Myb-related protein MYBAS no no 0.348 0.464 0.590 2e-36
Q9SEI0203 Transcription factor WER no no 0.370 0.576 0.555 2e-35
A2WW87 553 Transcription factor GAMY N/A no 0.335 0.191 0.575 4e-35
>sp|P81391|MYB05_ANTMA Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1 Back     alignment and function desciption
 Score =  194 bits (493), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 88/130 (67%), Positives = 109/130 (83%), Gaps = 4/130 (3%)

Query: 13  KRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWL 72
           K+ CNS +    E+R+GPWT+EED +L +YI  HGEG WN +A+ AGLKRTGKSCRLRWL
Sbjct: 3   KKPCNSQD---VEVRKGPWTMEEDLILINYIANHGEGVWNSLARSAGLKRTGKSCRLRWL 59

Query: 73  NYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQ 132
           NYL+PD++RGN+TP+EQ LI+ELH+KWGNRWSKIA+ LPGRTDNEIKNYWRTR+QK   Q
Sbjct: 60  NYLRPDVRRGNITPEEQLLIMELHAKWGNRWSKIAKTLPGRTDNEIKNYWRTRIQKHMEQ 119

Query: 133 LNIESNSETF 142
            + +S+S TF
Sbjct: 120 GD-QSSSTTF 128




Transcription factor.
Antirrhinum majus (taxid: 4151)
>sp|Q9LK95|MYB21_ARATH Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1 Back     alignment and function description
>sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL84|MYB59_ARATH Transcription factor MYB59 OS=Arabidopsis thaliana GN=MYB59 PE=2 SV=2 Back     alignment and function description
>sp|Q9LX82|MYB48_ARATH Transcription factor MYB48 OS=Arabidopsis thaliana GN=MYB48 PE=2 SV=1 Back     alignment and function description
>sp|P81394|MYB15_ANTMA Myb-related protein 315 OS=Antirrhinum majus GN=MYB315 PE=2 SV=1 Back     alignment and function description
>sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica GN=MYBAS2 PE=2 SV=1 Back     alignment and function description
>sp|Q53NK6|MYBA1_ORYSJ Myb-related protein MYBAS1 OS=Oryza sativa subsp. japonica GN=MYBAS1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SEI0|WER_ARATH Transcription factor WER OS=Arabidopsis thaliana GN=WER PE=1 SV=1 Back     alignment and function description
>sp|A2WW87|GAM1_ORYSI Transcription factor GAMYB OS=Oryza sativa subsp. indica GN=GAM1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
224111664319 predicted protein [Populus trichocarpa] 0.968 0.959 0.559 3e-89
224099383314 predicted protein [Populus trichocarpa] 0.946 0.952 0.574 4e-88
295883130299 putative MYB transcription factor [Rosa 0.908 0.959 0.584 5e-85
357444727311 R2R3-MYB transcription factor [Medicago 0.946 0.961 0.535 2e-84
359491453328 PREDICTED: transcription factor MYB75-li 0.924 0.890 0.534 2e-82
297737800295 unnamed protein product [Vitis vinifera] 0.901 0.966 0.584 2e-81
225424019288 PREDICTED: myb-related protein 340 [Viti 0.901 0.989 0.584 2e-81
227437136303 MYB protein [Malus hybrid cultivar] 0.892 0.930 0.542 3e-81
71041084298 MYB7 [Malus x domestica] 0.873 0.926 0.555 5e-81
356534359308 PREDICTED: transcription factor MYB21-li 0.908 0.931 0.559 2e-80
>gi|224111664|ref|XP_002315935.1| predicted protein [Populus trichocarpa] gi|222864975|gb|EEF02106.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  334 bits (856), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 179/320 (55%), Positives = 223/320 (69%), Gaps = 14/320 (4%)

Query: 4   MRAARAAGTKRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRT 63
           MRA+    T+R CNS EE + ELRRGPWTLEEDTLLT YI ++ EGRWNM+AKCAGLKRT
Sbjct: 1   MRASMLGVTRRICNSREE-EGELRRGPWTLEEDTLLTRYIARNREGRWNMLAKCAGLKRT 59

Query: 64  GKSCRLRWLNYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWR 123
           GKSCRLRWLNYLKPD+KRGNLTPQEQ LILELHSK GNRWSKIAQ LPGRTDNEIKNYWR
Sbjct: 60  GKSCRLRWLNYLKPDVKRGNLTPQEQLLILELHSKLGNRWSKIAQHLPGRTDNEIKNYWR 119

Query: 124 TRVQKQARQLNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNTLLTNSSAQS------- 176
           T+VQK+ARQLNIE++S  F +AVR +WMPRL QKMEQ S S ++   +S +Q+       
Sbjct: 120 TKVQKEARQLNIEASSTKFLDAVRSFWMPRLPQKMEQASYSSSSTTLDSQSQADHGVRSP 179

Query: 177 SNFSIIPSVSSSTLSPLPSTILYNSNQTINENSSSETSPNFFPGDFSKISQLQQPGITQQ 236
           S+ S +PS  S+ L P  S + + SN   +ENSS  TSP+    +   IS   QP I + 
Sbjct: 180 SSNSTVPSSLSTLLCPPESKLAHYSNLG-SENSSPVTSPHVLSANSDTIS--PQPEILEN 236

Query: 237 PTSPHAYGNNVCSNQIVPNDSYYVDCCGFDMEGYSLTDPIAEMSSYDISSSECQMAEADW 296
           PT    +G+   +N I+ +  Y    C +D++G++     A M +YD S  ECQMA  +W
Sbjct: 237 PTCSPLHGDTFYNNLILSDTCYEEGSC-YDLDGFNQAS--AGMGTYDNSPLECQMAGGNW 293

Query: 297 MSNDMSDALWSMDDIWQLRE 316
           + +   D +W MDD+WQ R+
Sbjct: 294 VFDSRVDTIWDMDDMWQFRD 313




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224099383|ref|XP_002311464.1| predicted protein [Populus trichocarpa] gi|222851284|gb|EEE88831.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|295883130|gb|ADG56766.1| putative MYB transcription factor [Rosa rugosa] Back     alignment and taxonomy information
>gi|357444727|ref|XP_003592641.1| R2R3-MYB transcription factor [Medicago truncatula] gi|355481689|gb|AES62892.1| R2R3-MYB transcription factor [Medicago truncatula] Back     alignment and taxonomy information
>gi|359491453|ref|XP_002276526.2| PREDICTED: transcription factor MYB75-like [Vitis vinifera] gi|297734217|emb|CBI15464.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737800|emb|CBI27001.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424019|ref|XP_002279433.1| PREDICTED: myb-related protein 340 [Vitis vinifera] Back     alignment and taxonomy information
>gi|227437136|gb|ACP30364.1| MYB protein [Malus hybrid cultivar] Back     alignment and taxonomy information
>gi|71041084|gb|AAZ20430.1| MYB7 [Malus x domestica] Back     alignment and taxonomy information
>gi|356534359|ref|XP_003535723.1| PREDICTED: transcription factor MYB21-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query316
TAIR|locus:2199357286 MYB62 "myb domain protein 62" 0.490 0.541 0.806 1.4e-74
TAIR|locus:2032975283 MYB116 "myb domain protein 116 0.487 0.544 0.735 8.6e-71
TAIR|locus:2084269323 MYB108 "myb domain protein 108 0.920 0.900 0.399 4.6e-57
TAIR|locus:2065226273 MYB2 "AT2G47190" [Arabidopsis 0.474 0.549 0.618 1.5e-51
TAIR|locus:2202633243 MYB112 "myb domain protein 112 0.462 0.600 0.639 3.1e-51
TAIR|locus:2089159226 MYB21 "myb domain protein 21" 0.411 0.575 0.636 1.3e-49
TAIR|locus:2170573214 MYB24 "myb domain protein 24" 0.367 0.542 0.692 1.2e-47
TAIR|locus:2174324235 MYB59 "myb domain protein 59" 0.348 0.468 0.663 1.6e-47
TAIR|locus:2084168206 MYB57 "myb domain protein 57" 0.376 0.577 0.638 1.4e-44
TAIR|locus:2075236256 MYB48 "myb domain protein 48" 0.335 0.414 0.660 5.2e-43
TAIR|locus:2199357 MYB62 "myb domain protein 62" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 692 (248.7 bits), Expect = 1.4e-74, Sum P(2) = 1.4e-74
 Identities = 125/155 (80%), Positives = 141/155 (90%)

Query:    13 KRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWL 72
             K++ +  E + +ELRRGPWTLEEDTLLT+YI  +GEGRWN VAKCAGLKRTGKSCRLRWL
Sbjct:     6 KKKKSFKESEDEELRRGPWTLEEDTLLTNYILHNGEGRWNHVAKCAGLKRTGKSCRLRWL 65

Query:    73 NYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQ 132
             NYLKPDI+RGNLTPQEQ LILELHSKWGNRWSKIAQ LPGRTDNEIKNYWRTRVQKQARQ
Sbjct:    66 NYLKPDIRRGNLTPQEQLLILELHSKWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKQARQ 125

Query:   133 LNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNT 167
             LNIESNS+ FF+AVR +W+PRL++KMEQNS++  T
Sbjct:   126 LNIESNSDKFFDAVRSFWVPRLIEKMEQNSSTTTT 160


GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0009751 "response to salicylic acid stimulus" evidence=IEP
GO:0009686 "gibberellin biosynthetic process" evidence=IMP
GO:0016036 "cellular response to phosphate starvation" evidence=IEP
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009944 "polarity specification of adaxial/abaxial axis" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010075 "regulation of meristem growth" evidence=RCA
TAIR|locus:2032975 MYB116 "myb domain protein 116" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084269 MYB108 "myb domain protein 108" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065226 MYB2 "AT2G47190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202633 MYB112 "myb domain protein 112" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089159 MYB21 "myb domain protein 21" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2170573 MYB24 "myb domain protein 24" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2174324 MYB59 "myb domain protein 59" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2084168 MYB57 "myb domain protein 57" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2075236 MYB48 "myb domain protein 48" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
MYB164
hypothetical protein (314 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
PLN03212249 PLN03212, PLN03212, Transcription repressor MYB5; 4e-41
PLN03091 459 PLN03091, PLN03091, hypothetical protein; Provisio 4e-40
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-15
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 2e-13
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 5e-13
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-11
COG5147 512 COG5147, REB1, Myb superfamily proteins, including 1e-10
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 4e-10
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 5e-10
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 4e-08
pfam1392159 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do 1e-04
cd1166050 cd11660, SANT_TRF, Telomere repeat binding factor- 3e-04
>gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional Back     alignment and domain information
 Score =  143 bits (361), Expect = 4e-41
 Identities = 65/120 (54%), Positives = 85/120 (70%)

Query: 26  LRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLT 85
           ++RGPWT+EED +L  +I + GEGRW  + K AGL R GKSCRLRW+NYL+P +KRG +T
Sbjct: 23  MKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGIT 82

Query: 86  PQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSETFFEA 145
             E+ LIL LH   GNRWS IA  +PGRTDNEIKNYW T ++K+  +  I+  +    +A
Sbjct: 83  SDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTHKPLDA 142


Length = 249

>gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 316
PLN03212249 Transcription repressor MYB5; Provisional 100.0
KOG0048238 consensus Transcription factor, Myb superfamily [T 100.0
PLN03091 459 hypothetical protein; Provisional 100.0
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.81
KOG0049 939 consensus Transcription factor, Myb superfamily [T 99.81
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.67
COG5147 512 REB1 Myb superfamily proteins, including transcrip 99.55
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 99.51
KOG0048238 consensus Transcription factor, Myb superfamily [T 99.5
PLN03212249 Transcription repressor MYB5; Provisional 99.45
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.43
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.43
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.37
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.35
PLN03091 459 hypothetical protein; Provisional 99.33
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.15
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.1
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.03
KOG0051607 consensus RNA polymerase I termination factor, Myb 99.02
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.97
COG5147 512 REB1 Myb superfamily proteins, including transcrip 98.47
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 98.05
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.97
KOG0457438 consensus Histone acetyltransferase complex SAGA/A 97.88
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 97.74
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 97.46
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 97.34
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 97.32
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.13
KOG1279506 consensus Chromatin remodeling factor subunit and 96.98
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.94
KOG1279506 consensus Chromatin remodeling factor subunit and 96.93
COG5259531 RSC8 RSC chromatin remodeling complex subunit RSC8 96.86
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.69
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 96.56
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 96.53
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.46
PRK13923170 putative spore coat protein regulator protein YlbO 96.32
COG5114432 Histone acetyltransferase complex SAGA/ADA, subuni 96.11
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.73
PLN031421033 Probable chromatin-remodeling complex ATPase chain 95.69
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 95.42
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 95.3
PRK13923170 putative spore coat protein regulator protein YlbO 95.2
KOG4282345 consensus Transcription factor GT-2 and related pr 93.07
KOG2656445 consensus DNA methyltransferase 1-associated prote 92.92
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 92.82
KOG1194 534 consensus Predicted DNA-binding protein, contains 90.55
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 89.74
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 88.81
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 85.54
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 85.23
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 85.14
KOG4282345 consensus Transcription factor GT-2 and related pr 84.12
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.4e-34  Score=262.42  Aligned_cols=126  Identities=52%  Similarity=1.004  Sum_probs=116.6

Q ss_pred             CccccCCChhhhcCCccCCCCHHHHHHHHHHHHHhCCCCcchhhcccCCccccccccchhccccCCCCccCCCCHHHHHH
Q 021188           12 TKRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQFL   91 (316)
Q Consensus        12 ~k~~~~~~~~~~~~lkkg~WT~eED~~L~~lV~~~g~~~W~~IA~~l~~~Rt~~qcr~Rw~n~L~p~lkkg~WT~EED~~   91 (316)
                      ...+||.+    ++++|++||+|||++|+++|++||..+|..||+.++.+|+++|||+||.++|+|.+++++||+|||++
T Consensus        13 ~~~pcc~K----~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~l   88 (249)
T PLN03212         13 KTTPCCTK----MGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDL   88 (249)
T ss_pred             CCCCCccc----CCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHH
Confidence            34456555    67999999999999999999999988999999999669999999999999999999999999999999


Q ss_pred             HHHHHHhcCCChhhhhhcCCCCCHHHHHHHHHHHHHHHHHhcCCCCCchH
Q 021188           92 ILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSET  141 (316)
Q Consensus        92 Ll~lv~~~G~~W~~IA~~lpgRT~~q~knRW~~~l~k~~r~~~~~~~e~~  141 (316)
                      |++++.+||++|..||+.|||||+++||+||+.++++.+++.++.+.+..
T Consensus        89 Llel~~~~GnKWs~IAk~LpGRTDnqIKNRWns~LrK~l~r~~i~p~~~k  138 (249)
T PLN03212         89 ILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTHK  138 (249)
T ss_pred             HHHHHHhccccHHHHHhhcCCCCHHHHHHHHHHHHhHHHHhcCCCCCCCC
Confidence            99999999999999999999999999999999999999999888776643



>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1h8a_C128 Crystal Structure Of Ternary Protein-Dna Complex3 L 9e-22
1h88_C159 Crystal Structure Of Ternary Protein-Dna Complex1 L 1e-21
1a5j_A110 Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe 2e-21
1gv2_A105 Crystal Structure Of C-Myb R2r3 Length = 105 3e-21
1mse_C105 Solution Structure Of A Specific Dna Complex Of The 8e-21
3zqc_A131 Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin 6e-16
3osf_A126 The Structure Of Protozoan Parasite Trichomonas Vag 4e-13
2k9n_A107 Solution Nmr Structure Of The R2r3 Dna Binding Doma 4e-10
1idy_A54 Structure Of Myb Transforming Protein, Nmr, Minimiz 6e-08
1mbj_A53 Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 2e-07
1gvd_A52 Crystal Structure Of C-Myb R2 V103l Mutant Length = 2e-06
1gv5_A52 Crystal Structure Of C-Myb R2 Length = 52 3e-06
1mbg_A53 Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 3e-06
>pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 Back     alignment and structure

Iteration: 1

Score = 100 bits (250), Expect = 9e-22, Method: Compositional matrix adjust. Identities = 47/107 (43%), Positives = 74/107 (69%), Gaps = 3/107 (2%) Query: 25 ELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLK-RTGKSCRLRWLNYLKPDIKRGN 83 EL +GPWT EED + ++ ++G RW+ +AK LK R GK CR RW N+L P++K+ + Sbjct: 24 ELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAK--HLKGRIGKQCRERWHNHLNPEVKKTS 81 Query: 84 LTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQA 130 T +E +I + H + GNRW++IA+ LPGRTDN +KN+W + ++++ Sbjct: 82 WTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRKV 128
>pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 Back     alignment and structure
>pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 Back     alignment and structure
>pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 Back     alignment and structure
>pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 Back     alignment and structure
>pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 Back     alignment and structure
>pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 Back     alignment and structure
>pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 Back     alignment and structure
>pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 Back     alignment and structure
>pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 Back     alignment and structure
>pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 Back     alignment and structure
>pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 Back     alignment and structure
>pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query316
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 2e-56
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 1e-55
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 5e-55
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 2e-53
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 2e-50
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-49
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 4e-30
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 2e-07
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 6e-24
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 8e-23
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 2e-04
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 3e-20
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 4e-18
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 2e-16
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 3e-16
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 6e-04
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 2e-15
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 3e-15
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 3e-11
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 2e-09
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 4e-09
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 5e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 6e-09
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 5e-04
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 7e-09
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 7e-08
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 6e-07
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 7e-07
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 9e-07
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 6e-04
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 4e-05
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 8e-04
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 7e-05
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 2e-04
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 Back     alignment and structure
 Score =  176 bits (450), Expect = 2e-56
 Identities = 46/105 (43%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 25  ELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNL 84
           EL +GPWT EED  +   + ++G  RW+++AK     R GK CR RW N+L P++K+ + 
Sbjct: 1   ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSW 59

Query: 85  TPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQ 129
           T +E  +I + H + GNRW++IA+ LPGRTDN IKN+W + ++++
Sbjct: 60  TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK 104


>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 100.0
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 100.0
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 100.0
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.98
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.98
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.97
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.87
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.85
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.76
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.72
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.71
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.7
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.7
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.69
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.69
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.68
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.67
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.66
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.66
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.62
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.62
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.6
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.6
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.59
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.58
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.57
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.57
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.57
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.56
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.55
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.54
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.54
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.52
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.52
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.51
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.5
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.5
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.49
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.48
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.46
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.45
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.45
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.17
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.41
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.36
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.35
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.04
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.34
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.32
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.31
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.31
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.28
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.23
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.21
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.17
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.04
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.93
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.92
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 98.88
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.77
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.77
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.7
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.61
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.49
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.48
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.47
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.42
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.37
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.37
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 98.08
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 98.07
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.05
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.04
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.98
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.1
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.85
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 97.82
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.6
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 97.58
2crg_A70 Metastasis associated protein MTA3; transcription 97.53
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 97.53
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.21
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.19
2crg_A70 Metastasis associated protein MTA3; transcription 97.18
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.13
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.01
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.96
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 96.45
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 95.44
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 95.27
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 95.23
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 92.57
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 91.87
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 90.07
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 89.11
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 86.65
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
Probab=100.00  E-value=1.1e-35  Score=248.56  Aligned_cols=125  Identities=39%  Similarity=0.764  Sum_probs=102.4

Q ss_pred             hhhhhhhcCccccCCChhh--hcCCccCCCCHHHHHHHHHHHHHhCCCCcchhhcccCCccccccccchhccccCCCCcc
Q 021188            4 MRAARAAGTKRECNSSEED--QQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKR   81 (316)
Q Consensus         4 ~~~~~~~~~k~~~~~~~~~--~~~lkkg~WT~eED~~L~~lV~~~g~~~W~~IA~~l~~~Rt~~qcr~Rw~n~L~p~lkk   81 (316)
                      |++.+++++..+|..+|..  .|++++|+||+|||++|+++|.+||.++|..||+.|+ +|++.||++||.++|+|.+++
T Consensus         1 Ia~~~~~Rt~~qC~~Rw~~~l~p~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~   79 (128)
T 1h8a_C            1 MEAVIKNRTDVQCQHRWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLK-GRIGKQCRERWHNHLNPEVKK   79 (128)
T ss_dssp             ---------------------CTTCCCSCCCHHHHHHHHHHHHHTCSCCHHHHHHHSS-SCCHHHHHHHHHHTTCSSSCC
T ss_pred             CccccCCCCHHHHHHHHHHhhCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHhc-CCcHHHHHHHHHHhccccccc
Confidence            5678899999999999975  6899999999999999999999999888999999998 999999999999999999999


Q ss_pred             CCCCHHHHHHHHHHHHhcCCChhhhhhcCCCCCHHHHHHHHHHHHHHH
Q 021188           82 GNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQ  129 (316)
Q Consensus        82 g~WT~EED~~Ll~lv~~~G~~W~~IA~~lpgRT~~q~knRW~~~l~k~  129 (316)
                      ++||+|||++|++++.+||++|..||+.|||||+++|++||+.++++.
T Consensus        80 ~~WT~eEd~~L~~~~~~~G~~W~~Ia~~l~gRt~~~~k~r~~~~~~~~  127 (128)
T 1h8a_C           80 TSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRK  127 (128)
T ss_dssp             SCCCHHHHHHHHHHHHHHCSCHHHHGGGSTTCCHHHHHHHHHTTTTC-
T ss_pred             ccCCHHHHHHHHHHHHHHCcCHHHHHHHCCCCCHHHHHHHHHHHHhcc
Confidence            999999999999999999999999999999999999999999988764



>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 316
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 2e-19
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 6e-09
d2ckxa183 a.4.1.3 (A:578-660) Telomere binding protein TBP1 2e-19
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 4e-18
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 1e-07
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 3e-16
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 6e-06
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 7e-16
d1w0ua_55 a.4.1.4 (A:) Telomeric repeat binding factor 2, TR 8e-06
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 2e-15
d1igna186 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba 8e-09
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 3e-12
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 5e-09
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 1e-11
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 4e-10
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 2e-11
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 1e-06
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 4e-11
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 3e-07
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 4e-11
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 2e-08
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 4e-10
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 2e-08
d1x41a147 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T 5e-10
d1ug2a_95 a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu 2e-06
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 78.2 bits (193), Expect = 2e-19
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 26 LRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPD 78
          L +GPWT EED  L   + ++G  RW+++AK     R GK CR RW N+L P+
Sbjct: 1  LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52


>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query316
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.76
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.75
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.7
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.65
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.62
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.6
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.58
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.55
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.53
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.52
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.52
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.49
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.45
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.45
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.4
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.37
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.36
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.36
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.32
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.3
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.27
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.24
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.22
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.09
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.08
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.01
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.97
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 98.81
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.12
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.03
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 97.97
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 97.74
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 97.41
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.28
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 97.09
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 97.08
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 96.23
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.67
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 94.48
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.23
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 93.07
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 89.73
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: c-Myb, DNA-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.76  E-value=1.2e-19  Score=127.34  Aligned_cols=52  Identities=46%  Similarity=0.910  Sum_probs=50.1

Q ss_pred             CccCCCCHHHHHHHHHHHHHhCCCCcchhhcccCCccccccccchhccccCCC
Q 021188           26 LRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPD   78 (316)
Q Consensus        26 lkkg~WT~eED~~L~~lV~~~g~~~W~~IA~~l~~~Rt~~qcr~Rw~n~L~p~   78 (316)
                      |+||+||+|||++|+++|.+||.++|..||+.|+ +||+.||++||.++|+|+
T Consensus         1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qc~~Rw~~~L~P~   52 (52)
T d1gvda_           1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE   52 (52)
T ss_dssp             CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTSCC
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCCHHHHHHHHHhhCCCC
Confidence            6899999999999999999999889999999999 999999999999999985



>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure