Citrus Sinensis ID: 021188
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 316 | ||||||
| 224111664 | 319 | predicted protein [Populus trichocarpa] | 0.968 | 0.959 | 0.559 | 3e-89 | |
| 224099383 | 314 | predicted protein [Populus trichocarpa] | 0.946 | 0.952 | 0.574 | 4e-88 | |
| 295883130 | 299 | putative MYB transcription factor [Rosa | 0.908 | 0.959 | 0.584 | 5e-85 | |
| 357444727 | 311 | R2R3-MYB transcription factor [Medicago | 0.946 | 0.961 | 0.535 | 2e-84 | |
| 359491453 | 328 | PREDICTED: transcription factor MYB75-li | 0.924 | 0.890 | 0.534 | 2e-82 | |
| 297737800 | 295 | unnamed protein product [Vitis vinifera] | 0.901 | 0.966 | 0.584 | 2e-81 | |
| 225424019 | 288 | PREDICTED: myb-related protein 340 [Viti | 0.901 | 0.989 | 0.584 | 2e-81 | |
| 227437136 | 303 | MYB protein [Malus hybrid cultivar] | 0.892 | 0.930 | 0.542 | 3e-81 | |
| 71041084 | 298 | MYB7 [Malus x domestica] | 0.873 | 0.926 | 0.555 | 5e-81 | |
| 356534359 | 308 | PREDICTED: transcription factor MYB21-li | 0.908 | 0.931 | 0.559 | 2e-80 |
| >gi|224111664|ref|XP_002315935.1| predicted protein [Populus trichocarpa] gi|222864975|gb|EEF02106.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 334 bits (856), Expect = 3e-89, Method: Compositional matrix adjust.
Identities = 179/320 (55%), Positives = 223/320 (69%), Gaps = 14/320 (4%)
Query: 4 MRAARAAGTKRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRT 63
MRA+ T+R CNS EE + ELRRGPWTLEEDTLLT YI ++ EGRWNM+AKCAGLKRT
Sbjct: 1 MRASMLGVTRRICNSREE-EGELRRGPWTLEEDTLLTRYIARNREGRWNMLAKCAGLKRT 59
Query: 64 GKSCRLRWLNYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWR 123
GKSCRLRWLNYLKPD+KRGNLTPQEQ LILELHSK GNRWSKIAQ LPGRTDNEIKNYWR
Sbjct: 60 GKSCRLRWLNYLKPDVKRGNLTPQEQLLILELHSKLGNRWSKIAQHLPGRTDNEIKNYWR 119
Query: 124 TRVQKQARQLNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNTLLTNSSAQS------- 176
T+VQK+ARQLNIE++S F +AVR +WMPRL QKMEQ S S ++ +S +Q+
Sbjct: 120 TKVQKEARQLNIEASSTKFLDAVRSFWMPRLPQKMEQASYSSSSTTLDSQSQADHGVRSP 179
Query: 177 SNFSIIPSVSSSTLSPLPSTILYNSNQTINENSSSETSPNFFPGDFSKISQLQQPGITQQ 236
S+ S +PS S+ L P S + + SN +ENSS TSP+ + IS QP I +
Sbjct: 180 SSNSTVPSSLSTLLCPPESKLAHYSNLG-SENSSPVTSPHVLSANSDTIS--PQPEILEN 236
Query: 237 PTSPHAYGNNVCSNQIVPNDSYYVDCCGFDMEGYSLTDPIAEMSSYDISSSECQMAEADW 296
PT +G+ +N I+ + Y C +D++G++ A M +YD S ECQMA +W
Sbjct: 237 PTCSPLHGDTFYNNLILSDTCYEEGSC-YDLDGFNQAS--AGMGTYDNSPLECQMAGGNW 293
Query: 297 MSNDMSDALWSMDDIWQLRE 316
+ + D +W MDD+WQ R+
Sbjct: 294 VFDSRVDTIWDMDDMWQFRD 313
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224099383|ref|XP_002311464.1| predicted protein [Populus trichocarpa] gi|222851284|gb|EEE88831.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|295883130|gb|ADG56766.1| putative MYB transcription factor [Rosa rugosa] | Back alignment and taxonomy information |
|---|
| >gi|357444727|ref|XP_003592641.1| R2R3-MYB transcription factor [Medicago truncatula] gi|355481689|gb|AES62892.1| R2R3-MYB transcription factor [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|359491453|ref|XP_002276526.2| PREDICTED: transcription factor MYB75-like [Vitis vinifera] gi|297734217|emb|CBI15464.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297737800|emb|CBI27001.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225424019|ref|XP_002279433.1| PREDICTED: myb-related protein 340 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|227437136|gb|ACP30364.1| MYB protein [Malus hybrid cultivar] | Back alignment and taxonomy information |
|---|
| >gi|71041084|gb|AAZ20430.1| MYB7 [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|356534359|ref|XP_003535723.1| PREDICTED: transcription factor MYB21-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 316 | ||||||
| TAIR|locus:2199357 | 286 | MYB62 "myb domain protein 62" | 0.490 | 0.541 | 0.806 | 1.4e-74 | |
| TAIR|locus:2032975 | 283 | MYB116 "myb domain protein 116 | 0.487 | 0.544 | 0.735 | 8.6e-71 | |
| TAIR|locus:2084269 | 323 | MYB108 "myb domain protein 108 | 0.920 | 0.900 | 0.399 | 4.6e-57 | |
| TAIR|locus:2065226 | 273 | MYB2 "AT2G47190" [Arabidopsis | 0.474 | 0.549 | 0.618 | 1.5e-51 | |
| TAIR|locus:2202633 | 243 | MYB112 "myb domain protein 112 | 0.462 | 0.600 | 0.639 | 3.1e-51 | |
| TAIR|locus:2089159 | 226 | MYB21 "myb domain protein 21" | 0.411 | 0.575 | 0.636 | 1.3e-49 | |
| TAIR|locus:2170573 | 214 | MYB24 "myb domain protein 24" | 0.367 | 0.542 | 0.692 | 1.2e-47 | |
| TAIR|locus:2174324 | 235 | MYB59 "myb domain protein 59" | 0.348 | 0.468 | 0.663 | 1.6e-47 | |
| TAIR|locus:2084168 | 206 | MYB57 "myb domain protein 57" | 0.376 | 0.577 | 0.638 | 1.4e-44 | |
| TAIR|locus:2075236 | 256 | MYB48 "myb domain protein 48" | 0.335 | 0.414 | 0.660 | 5.2e-43 |
| TAIR|locus:2199357 MYB62 "myb domain protein 62" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 692 (248.7 bits), Expect = 1.4e-74, Sum P(2) = 1.4e-74
Identities = 125/155 (80%), Positives = 141/155 (90%)
Query: 13 KRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWL 72
K++ + E + +ELRRGPWTLEEDTLLT+YI +GEGRWN VAKCAGLKRTGKSCRLRWL
Sbjct: 6 KKKKSFKESEDEELRRGPWTLEEDTLLTNYILHNGEGRWNHVAKCAGLKRTGKSCRLRWL 65
Query: 73 NYLKPDIKRGNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQ 132
NYLKPDI+RGNLTPQEQ LILELHSKWGNRWSKIAQ LPGRTDNEIKNYWRTRVQKQARQ
Sbjct: 66 NYLKPDIRRGNLTPQEQLLILELHSKWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKQARQ 125
Query: 133 LNIESNSETFFEAVRCYWMPRLLQKMEQNSASPNT 167
LNIESNS+ FF+AVR +W+PRL++KMEQNS++ T
Sbjct: 126 LNIESNSDKFFDAVRSFWVPRLIEKMEQNSSTTTT 160
|
|
| TAIR|locus:2032975 MYB116 "myb domain protein 116" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084269 MYB108 "myb domain protein 108" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065226 MYB2 "AT2G47190" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202633 MYB112 "myb domain protein 112" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089159 MYB21 "myb domain protein 21" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170573 MYB24 "myb domain protein 24" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2174324 MYB59 "myb domain protein 59" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084168 MYB57 "myb domain protein 57" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075236 MYB48 "myb domain protein 48" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| MYB164 | hypothetical protein (314 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 316 | |||
| PLN03212 | 249 | PLN03212, PLN03212, Transcription repressor MYB5; | 4e-41 | |
| PLN03091 | 459 | PLN03091, PLN03091, hypothetical protein; Provisio | 4e-40 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 2e-15 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 2e-13 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 5e-13 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 1e-11 | |
| COG5147 | 512 | COG5147, REB1, Myb superfamily proteins, including | 1e-10 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 4e-10 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 5e-10 | |
| pfam13921 | 59 | pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do | 4e-08 | |
| pfam13921 | 59 | pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding do | 1e-04 | |
| cd11660 | 50 | cd11660, SANT_TRF, Telomere repeat binding factor- | 3e-04 |
| >gnl|CDD|178751 PLN03212, PLN03212, Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
Score = 143 bits (361), Expect = 4e-41
Identities = 65/120 (54%), Positives = 85/120 (70%)
Query: 26 LRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLT 85
++RGPWT+EED +L +I + GEGRW + K AGL R GKSCRLRW+NYL+P +KRG +T
Sbjct: 23 MKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGIT 82
Query: 86 PQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSETFFEA 145
E+ LIL LH GNRWS IA +PGRTDNEIKNYW T ++K+ + I+ + +A
Sbjct: 83 SDEEDLILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTHKPLDA 142
|
Length = 249 |
| >gnl|CDD|215570 PLN03091, PLN03091, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|227476 COG5147, REB1, Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|206092 pfam13921, Myb_DNA-bind_6, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|212558 cd11660, SANT_TRF, Telomere repeat binding factor-like DNA-binding domains of the SANT/myb-like family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 100.0 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 100.0 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 100.0 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.81 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 99.81 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.67 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 99.55 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 99.51 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 99.5 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 99.45 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.43 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 99.43 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.37 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.35 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 99.33 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.15 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.1 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.03 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 99.02 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.97 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 98.47 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 98.05 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.97 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.88 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 97.74 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 97.46 | |
| PF13325 | 199 | MCRS_N: N-terminal region of micro-spherule protei | 97.34 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 97.32 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.13 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 96.98 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 96.94 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 96.93 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 96.86 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.69 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 96.56 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.53 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 96.46 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 96.32 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 96.11 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 95.73 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 95.69 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 95.42 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 95.3 | |
| PRK13923 | 170 | putative spore coat protein regulator protein YlbO | 95.2 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 93.07 | |
| KOG2656 | 445 | consensus DNA methyltransferase 1-associated prote | 92.92 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 92.82 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 90.55 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 89.74 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 88.81 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 85.54 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 85.23 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 85.14 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 84.12 |
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.4e-34 Score=262.42 Aligned_cols=126 Identities=52% Similarity=1.004 Sum_probs=116.6
Q ss_pred CccccCCChhhhcCCccCCCCHHHHHHHHHHHHHhCCCCcchhhcccCCccccccccchhccccCCCCccCCCCHHHHHH
Q 021188 12 TKRECNSSEEDQQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNLTPQEQFL 91 (316)
Q Consensus 12 ~k~~~~~~~~~~~~lkkg~WT~eED~~L~~lV~~~g~~~W~~IA~~l~~~Rt~~qcr~Rw~n~L~p~lkkg~WT~EED~~ 91 (316)
...+||.+ ++++|++||+|||++|+++|++||..+|..||+.++.+|+++|||+||.++|+|.+++++||+|||++
T Consensus 13 ~~~pcc~K----~glKRg~WT~EEDe~L~~lV~kyG~~nW~~IAk~~g~gRT~KQCReRW~N~L~P~I~kgpWT~EED~l 88 (249)
T PLN03212 13 KTTPCCTK----MGMKRGPWTVEEDEILVSFIKKEGEGRWRSLPKRAGLLRCGKSCRLRWMNYLRPSVKRGGITSDEEDL 88 (249)
T ss_pred CCCCCccc----CCCcCCCCCHHHHHHHHHHHHHhCcccHHHHHHhhhcCCCcchHHHHHHHhhchhcccCCCChHHHHH
Confidence 34456555 67999999999999999999999988999999999669999999999999999999999999999999
Q ss_pred HHHHHHhcCCChhhhhhcCCCCCHHHHHHHHHHHHHHHHHhcCCCCCchH
Q 021188 92 ILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQARQLNIESNSET 141 (316)
Q Consensus 92 Ll~lv~~~G~~W~~IA~~lpgRT~~q~knRW~~~l~k~~r~~~~~~~e~~ 141 (316)
|++++.+||++|..||+.|||||+++||+||+.++++.+++.++.+.+..
T Consensus 89 Llel~~~~GnKWs~IAk~LpGRTDnqIKNRWns~LrK~l~r~~i~p~~~k 138 (249)
T PLN03212 89 ILRLHRLLGNRWSLIAGRIPGRTDNEIKNYWNTHLRKKLLRQGIDPQTHK 138 (249)
T ss_pred HHHHHHhccccHHHHHhhcCCCCHHHHHHHHHHHHhHHHHhcCCCCCCCC
Confidence 99999999999999999999999999999999999999999888776643
|
|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13325 MCRS_N: N-terminal region of micro-spherule protein | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PRK13923 putative spore coat protein regulator protein YlbO; Provisional | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 316 | ||||
| 1h8a_C | 128 | Crystal Structure Of Ternary Protein-Dna Complex3 L | 9e-22 | ||
| 1h88_C | 159 | Crystal Structure Of Ternary Protein-Dna Complex1 L | 1e-21 | ||
| 1a5j_A | 110 | Chicken B-Myb Dna Binding Domain, Repeat 2 And Repe | 2e-21 | ||
| 1gv2_A | 105 | Crystal Structure Of C-Myb R2r3 Length = 105 | 3e-21 | ||
| 1mse_C | 105 | Solution Structure Of A Specific Dna Complex Of The | 8e-21 | ||
| 3zqc_A | 131 | Structure Of The Trichomonas Vaginalis Myb3 Dna-Bin | 6e-16 | ||
| 3osf_A | 126 | The Structure Of Protozoan Parasite Trichomonas Vag | 4e-13 | ||
| 2k9n_A | 107 | Solution Nmr Structure Of The R2r3 Dna Binding Doma | 4e-10 | ||
| 1idy_A | 54 | Structure Of Myb Transforming Protein, Nmr, Minimiz | 6e-08 | ||
| 1mbj_A | 53 | Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 | 2e-07 | ||
| 1gvd_A | 52 | Crystal Structure Of C-Myb R2 V103l Mutant Length = | 2e-06 | ||
| 1gv5_A | 52 | Crystal Structure Of C-Myb R2 Length = 52 | 3e-06 | ||
| 1mbg_A | 53 | Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 | 3e-06 |
| >pdb|1H8A|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3 Length = 128 | Back alignment and structure |
|
| >pdb|1H88|C Chain C, Crystal Structure Of Ternary Protein-Dna Complex1 Length = 159 | Back alignment and structure |
| >pdb|1A5J|A Chain A, Chicken B-Myb Dna Binding Domain, Repeat 2 And Repeat3, Nmr, 32 Structures Length = 110 | Back alignment and structure |
| >pdb|1GV2|A Chain A, Crystal Structure Of C-Myb R2r3 Length = 105 | Back alignment and structure |
| >pdb|1MSE|C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices Length = 105 | Back alignment and structure |
| >pdb|3ZQC|A Chain A, Structure Of The Trichomonas Vaginalis Myb3 Dna-Binding Domain Bound To A Promoter Sequence Reveals A Unique C- Terminal Beta-Hairpin Conformation Length = 131 | Back alignment and structure |
| >pdb|3OSF|A Chain A, The Structure Of Protozoan Parasite Trichomonas Vaginalis Myb2 In Complex With Mre-2f-13 Dna Length = 126 | Back alignment and structure |
| >pdb|2K9N|A Chain A, Solution Nmr Structure Of The R2r3 Dna Binding Domain Of Myb1 Protein From Protozoan Parasite Trichomonas Vaginalis Length = 107 | Back alignment and structure |
| >pdb|1IDY|A Chain A, Structure Of Myb Transforming Protein, Nmr, Minimized Average Structure Length = 54 | Back alignment and structure |
| >pdb|1MBJ|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 3 Length = 53 | Back alignment and structure |
| >pdb|1GVD|A Chain A, Crystal Structure Of C-Myb R2 V103l Mutant Length = 52 | Back alignment and structure |
| >pdb|1GV5|A Chain A, Crystal Structure Of C-Myb R2 Length = 52 | Back alignment and structure |
| >pdb|1MBG|A Chain A, Mouse C-Myb Dna-Binding Domain Repeat 2 Length = 53 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 316 | |||
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 2e-56 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 1e-55 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 5e-55 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 2e-53 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 2e-50 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 2e-49 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 4e-30 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 2e-07 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 6e-24 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 8e-23 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 2e-04 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 3e-20 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 4e-18 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 2e-16 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 3e-16 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 6e-04 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 2e-15 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 3e-15 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 3e-11 | |
| 1w0u_A | 55 | Telomeric repeat binding factor 2; telomere, DNA-b | 2e-09 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 4e-09 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 5e-09 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 6e-09 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 5e-04 | |
| 1vf9_A | 64 | Telomeric repeat binding factor 2; MYB, helix-turn | 7e-09 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 7e-08 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 6e-07 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 7e-07 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 9e-07 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 6e-04 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 4e-05 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 8e-04 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 7e-05 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 2e-04 |
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Length = 105 | Back alignment and structure |
|---|
Score = 176 bits (450), Expect = 2e-56
Identities = 46/105 (43%), Positives = 72/105 (68%), Gaps = 1/105 (0%)
Query: 25 ELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKRGNL 84
EL +GPWT EED + + ++G RW+++AK R GK CR RW N+L P++K+ +
Sbjct: 1 ELIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKG-RIGKQCRERWHNHLNPEVKKTSW 59
Query: 85 TPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQ 129
T +E +I + H + GNRW++IA+ LPGRTDN IKN+W + ++++
Sbjct: 60 TEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRK 104
|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Length = 131 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Length = 128 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Length = 107 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Length = 126 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Length = 159 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Length = 52 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Length = 52 | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Length = 105 | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Length = 122 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Length = 60 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Length = 83 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Length = 121 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Length = 246 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 100.0 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 100.0 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 100.0 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.98 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.98 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.97 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 99.97 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 99.87 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.85 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.76 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.72 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.71 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.7 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.7 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.69 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.69 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.68 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.67 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.66 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.66 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.62 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.62 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.6 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.6 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.59 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.58 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.57 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.57 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.57 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.56 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.55 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.54 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.54 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.52 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.52 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.51 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.5 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.5 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.49 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.48 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.46 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.45 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.45 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 99.17 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.41 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 99.36 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.35 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 99.04 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 99.34 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.32 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.31 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 99.31 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 99.28 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 99.23 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 99.21 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.17 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.04 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 98.93 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.92 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.88 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.77 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.77 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.7 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.61 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 98.49 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 98.48 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.47 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.42 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.37 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 98.37 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 98.08 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.07 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.05 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 98.04 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 97.98 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 97.1 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.85 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 97.82 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 97.6 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.58 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 97.53 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.53 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 97.21 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 97.19 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 97.18 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 97.13 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 97.01 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 96.96 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 96.45 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 95.44 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 95.27 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 95.23 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 92.57 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 91.87 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 90.07 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 89.11 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 86.65 |
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-35 Score=248.56 Aligned_cols=125 Identities=39% Similarity=0.764 Sum_probs=102.4
Q ss_pred hhhhhhhcCccccCCChhh--hcCCccCCCCHHHHHHHHHHHHHhCCCCcchhhcccCCccccccccchhccccCCCCcc
Q 021188 4 MRAARAAGTKRECNSSEED--QQELRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPDIKR 81 (316)
Q Consensus 4 ~~~~~~~~~k~~~~~~~~~--~~~lkkg~WT~eED~~L~~lV~~~g~~~W~~IA~~l~~~Rt~~qcr~Rw~n~L~p~lkk 81 (316)
|++.+++++..+|..+|.. .|++++|+||+|||++|+++|.+||.++|..||+.|+ +|++.||++||.++|+|.+++
T Consensus 1 Ia~~~~~Rt~~qC~~Rw~~~l~p~~~k~~Wt~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qcr~Rw~~~l~p~~~~ 79 (128)
T 1h8a_C 1 MEAVIKNRTDVQCQHRWQKVLNPELNKGPWTKEEDQRVIEHVQKYGPKRWSDIAKHLK-GRIGKQCRERWHNHLNPEVKK 79 (128)
T ss_dssp ---------------------CTTCCCSCCCHHHHHHHHHHHHHTCSCCHHHHHHHSS-SCCHHHHHHHHHHTTCSSSCC
T ss_pred CccccCCCCHHHHHHHHHHhhCCCCCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHhc-CCcHHHHHHHHHHhccccccc
Confidence 5678899999999999975 6899999999999999999999999888999999998 999999999999999999999
Q ss_pred CCCCHHHHHHHHHHHHhcCCChhhhhhcCCCCCHHHHHHHHHHHHHHH
Q 021188 82 GNLTPQEQFLILELHSKWGNRWSKIAQCLPGRTDNEIKNYWRTRVQKQ 129 (316)
Q Consensus 82 g~WT~EED~~Ll~lv~~~G~~W~~IA~~lpgRT~~q~knRW~~~l~k~ 129 (316)
++||+|||++|++++.+||++|..||+.|||||+++|++||+.++++.
T Consensus 80 ~~WT~eEd~~L~~~~~~~G~~W~~Ia~~l~gRt~~~~k~r~~~~~~~~ 127 (128)
T 1h8a_C 80 TSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAVKNHWNSTMRRK 127 (128)
T ss_dssp SCCCHHHHHHHHHHHHHHCSCHHHHGGGSTTCCHHHHHHHHHTTTTC-
T ss_pred ccCCHHHHHHHHHHHHHHCcCHHHHHHHCCCCCHHHHHHHHHHHHhcc
Confidence 999999999999999999999999999999999999999999988764
|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 316 | ||||
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 2e-19 | |
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 6e-09 | |
| d2ckxa1 | 83 | a.4.1.3 (A:578-660) Telomere binding protein TBP1 | 2e-19 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 4e-18 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 1e-07 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 3e-16 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 6e-06 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 7e-16 | |
| d1w0ua_ | 55 | a.4.1.4 (A:) Telomeric repeat binding factor 2, TR | 8e-06 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 2e-15 | |
| d1igna1 | 86 | a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Ba | 8e-09 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 3e-12 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 5e-09 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 1e-11 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 4e-10 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 2e-11 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 1e-06 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 4e-11 | |
| d2cjja1 | 63 | a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti | 3e-07 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 4e-11 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 2e-08 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 4e-10 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 2e-08 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 5e-10 | |
| d1ug2a_ | 95 | a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mu | 2e-06 |
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 78.2 bits (193), Expect = 2e-19
Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
Query: 26 LRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPD 78
L +GPWT EED L + ++G RW+++AK R GK CR RW N+L P+
Sbjct: 1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52
|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 83 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 55 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 316 | |||
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.76 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.75 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.7 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.65 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.62 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.6 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.58 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.55 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 99.53 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.52 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.52 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.49 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.45 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.45 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.4 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.37 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.36 | |
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.36 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.32 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 99.3 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.27 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 99.24 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.22 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.09 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.08 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.01 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.97 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.81 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.12 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.03 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 97.97 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 97.74 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 97.41 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 97.28 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 97.09 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 97.08 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 96.23 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 94.67 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 94.48 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 94.23 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 93.07 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 89.73 |
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: c-Myb, DNA-binding domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.76 E-value=1.2e-19 Score=127.34 Aligned_cols=52 Identities=46% Similarity=0.910 Sum_probs=50.1
Q ss_pred CccCCCCHHHHHHHHHHHHHhCCCCcchhhcccCCccccccccchhccccCCC
Q 021188 26 LRRGPWTLEEDTLLTHYIHQHGEGRWNMVAKCAGLKRTGKSCRLRWLNYLKPD 78 (316)
Q Consensus 26 lkkg~WT~eED~~L~~lV~~~g~~~W~~IA~~l~~~Rt~~qcr~Rw~n~L~p~ 78 (316)
|+||+||+|||++|+++|.+||.++|..||+.|+ +||+.||++||.++|+|+
T Consensus 1 l~rg~WT~eED~~L~~~v~~~g~~~W~~Ia~~l~-~Rt~~qc~~Rw~~~L~P~ 52 (52)
T d1gvda_ 1 LIKGPWTKEEDQRLIKLVQKYGPKRWSVIAKHLK-GRIGKQCRERWHNHLNPE 52 (52)
T ss_dssp CCCCSCCHHHHHHHHHHHHHHCTTCHHHHHTTST-TCCHHHHHHHHHHTTSCC
T ss_pred CCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHC-CCCHHHHHHHHHhhCCCC
Confidence 6899999999999999999999889999999999 999999999999999985
|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|