Citrus Sinensis ID: 021374
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| 297739793 | 350 | unnamed protein product [Vitis vinifera] | 0.948 | 0.848 | 0.795 | 1e-137 | |
| 225441543 | 353 | PREDICTED: F-box protein At3g58530 [Viti | 0.948 | 0.841 | 0.795 | 1e-136 | |
| 224088164 | 341 | predicted protein [Populus trichocarpa] | 0.875 | 0.803 | 0.792 | 1e-133 | |
| 255580692 | 351 | ubiquitin-protein ligase, putative [Rici | 0.942 | 0.840 | 0.751 | 1e-132 | |
| 147789108 | 349 | hypothetical protein VITISV_044261 [Viti | 0.948 | 0.851 | 0.791 | 1e-131 | |
| 297817168 | 353 | hypothetical protein ARALYDRAFT_486305 [ | 0.948 | 0.841 | 0.721 | 1e-119 | |
| 356530677 | 353 | PREDICTED: F-box protein At3g58530-like | 0.936 | 0.830 | 0.683 | 1e-114 | |
| 18410977 | 353 | F-box protein [Arabidopsis thaliana] gi| | 0.872 | 0.773 | 0.713 | 1e-113 | |
| 15450960 | 353 | putative protein [Arabidopsis thaliana] | 0.872 | 0.773 | 0.713 | 1e-113 | |
| 388498858 | 357 | unknown [Lotus japonicus] | 0.920 | 0.806 | 0.665 | 1e-110 |
| >gi|297739793|emb|CBI29975.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 492 bits (1267), Expect = e-137, Method: Compositional matrix adjust.
Identities = 237/298 (79%), Positives = 273/298 (91%), Gaps = 1/298 (0%)
Query: 3 MEEEKVKAAEEEETWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVI 62
MEE + +A + + WS+ET+PKV+RI+ TRL QRD+ISLLLVSPW+HRTLVS SLWLV+
Sbjct: 1 MEETEARAGGDLK-WSRETIPKVLRIVGTRLPQRDLISLLLVSPWIHRTLVSCSSLWLVL 59
Query: 63 DLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLN 122
D RE NNAGNRLVAALS+ RY+HV++INLEFAQDIED+HL+LLKTKCL SLQ+LESLNLN
Sbjct: 60 DFRETNNAGNRLVAALSLFRYQHVKQINLEFAQDIEDKHLDLLKTKCLDSLQELESLNLN 119
Query: 123 GCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDK 182
CQKISD+G+E I+S CP+LKVFSIYWNVRVTDIG+ HLVKNCKHI+DLNLSGCKN+ DK
Sbjct: 120 VCQKISDRGVETITSACPKLKVFSIYWNVRVTDIGMTHLVKNCKHIVDLNLSGCKNITDK 179
Query: 183 SLQLIADNYQELESLNLTRCVKLTDGGLQKILIKCSSLRSLNLYALSGFTDEAYKKISLL 242
SLQLIADNY +LE LNLTRC+KLTDGGLQ+IL+KCSSL+SLNLYALS FTDEAYKKISLL
Sbjct: 180 SLQLIADNYPDLELLNLTRCIKLTDGGLQQILLKCSSLQSLNLYALSSFTDEAYKKISLL 239
Query: 243 AHLKFLDLCGAQNLSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCSSLEFLS 300
L+FLDLCGAQNLSD+GL CIAKCKNLVSLNLTWCVR+TDVGV+AIA+GC+SLEFLS
Sbjct: 240 TDLRFLDLCGAQNLSDQGLCCIAKCKNLVSLNLTWCVRVTDVGVIAIAQGCTSLEFLS 297
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225441543|ref|XP_002276459.1| PREDICTED: F-box protein At3g58530 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224088164|ref|XP_002308350.1| predicted protein [Populus trichocarpa] gi|222854326|gb|EEE91873.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255580692|ref|XP_002531168.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223529238|gb|EEF31211.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|147789108|emb|CAN73494.1| hypothetical protein VITISV_044261 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297817168|ref|XP_002876467.1| hypothetical protein ARALYDRAFT_486305 [Arabidopsis lyrata subsp. lyrata] gi|297322305|gb|EFH52726.1| hypothetical protein ARALYDRAFT_486305 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356530677|ref|XP_003533907.1| PREDICTED: F-box protein At3g58530-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18410977|ref|NP_567069.1| F-box protein [Arabidopsis thaliana] gi|75154905|sp|Q8LB33.1|FB330_ARATH RecName: Full=F-box protein At3g58530 gi|21593045|gb|AAM64994.1| unknown [Arabidopsis thaliana] gi|332646275|gb|AEE79796.1| F-box protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15450960|gb|AAK96751.1| putative protein [Arabidopsis thaliana] gi|17978711|gb|AAL47349.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|388498858|gb|AFK37495.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 313 | ||||||
| TAIR|locus:2076376 | 353 | AT3G58530 [Arabidopsis thalian | 0.910 | 0.807 | 0.708 | 1.1e-108 | |
| TAIR|locus:2166978 | 405 | AT5G23340 [Arabidopsis thalian | 0.696 | 0.538 | 0.282 | 1.6e-23 | |
| RGD|1562243 | 422 | Fbxl2 "F-box and leucine-rich | 0.680 | 0.504 | 0.305 | 6.8e-23 | |
| UNIPROTKB|F1PWK1 | 422 | FBXL2 "Uncharacterized protein | 0.680 | 0.504 | 0.305 | 8.8e-23 | |
| MGI|MGI:1919429 | 423 | Fbxl2 "F-box and leucine-rich | 0.680 | 0.503 | 0.305 | 8.9e-23 | |
| UNIPROTKB|F1NHD2 | 423 | FBXL2 "Uncharacterized protein | 0.677 | 0.501 | 0.293 | 1.2e-22 | |
| UNIPROTKB|Q9UKC9 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.680 | 0.503 | 0.305 | 2e-22 | |
| UNIPROTKB|Q5R3Z8 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.680 | 0.503 | 0.305 | 2e-22 | |
| UNIPROTKB|Q58DG6 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.680 | 0.488 | 0.315 | 4e-22 | |
| UNIPROTKB|Q96IG2 | 436 | FBXL20 "F-box/LRR-repeat prote | 0.680 | 0.488 | 0.315 | 4e-22 |
| TAIR|locus:2076376 AT3G58530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1074 (383.1 bits), Expect = 1.1e-108, P = 1.1e-108
Identities = 202/285 (70%), Positives = 243/285 (85%)
Query: 16 TWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNAGNRLV 75
TW +E V V+R++STRL Q D+ISLLLVSPWL+RTL+SYPS+WL I+LREM NAG+RL+
Sbjct: 13 TWRREIVTSVMRLVSTRLPQTDLISLLLVSPWLYRTLISYPSIWLTINLREMTNAGDRLL 72
Query: 76 AALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEII 135
AALS+PRYR V+ INLEFAQ + D HL+L+KT+C +L LE LNLN CQKISD GIE I
Sbjct: 73 AALSLPRYRQVKHINLEFAQGVVDSHLKLVKTECPDALLSLEWLNLNVCQKISDNGIEAI 132
Query: 136 SSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDKSLQLIADNYQELE 195
+S CP+LKVFSIYWNVRVTD GI++LVKNC+HI DLNLSGCK+L DKS+QL+A++Y +LE
Sbjct: 133 TSICPKLKVFSIYWNVRVTDAGIRNLVKNCRHITDLNLSGCKSLTDKSMQLVAESYPDLE 192
Query: 196 SLNLTRCVKLTDGGLQKILIKCSSLRSLNLYALSGFTDEAYKKISLLAHLKFLDLCGAQN 255
SLN+TRCVK+TD GL ++L KC SL++LNLYALSGFTD+AY KISLLA L+FLD+CGAQN
Sbjct: 193 SLNITRCVKITDDGLLQVLQKCFSLQTLNLYALSGFTDKAYMKISLLADLRFLDICGAQN 252
Query: 256 LSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCSSLEFLS 300
+SDEG+ IAKC L SLNLTWCVRITD GV IA C+SLEFLS
Sbjct: 253 ISDEGIGHIAKCNKLESLNLTWCVRITDAGVNTIANSCTSLEFLS 297
|
|
| TAIR|locus:2166978 AT5G23340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58DG6 FBXL20 "F-box/LRR-repeat protein 20" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96IG2 FBXL20 "F-box/LRR-repeat protein 20" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00025432001 | SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (353 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 2e-14 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 6e-09 | |
| smart00367 | 26 | smart00367, LRR_CC, Leucine-rich repeat - CC (cyst | 3e-04 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 70.8 bits (174), Expect = 2e-14
Identities = 46/181 (25%), Positives = 73/181 (40%), Gaps = 31/181 (17%)
Query: 110 LGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHII 169
L + L+ L L G + I D+G+ ++ +CP L+V + +TD GI L NC +
Sbjct: 48 LSNCNKLKKLILPGSKLIDDEGLIALAQSCPNLQVLDLRACENITDSGIVALATNCPKLQ 107
Query: 170 DLNLS---GCKNLLDKSLQLIADNYQELESLNLTRCVKLTDGGLQKILIKCSSLRSLNLY 226
+NL + D SL + N L+++ C +TD G+ ++ CS
Sbjct: 108 TINLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGC-DVTDKGVWELASGCSK------- 159
Query: 227 ALSGFTDEAYKKISLLAHLKFLDLCGAQNLSDEGLACIAK---CKNLVSLNLTWCVRITD 283
L+ L L +NL+D+ + I NL L C ITD
Sbjct: 160 -----------------SLERLSLNNCRNLTDQSIPAILASNYFPNLSVLEFRGCPLITD 202
Query: 284 V 284
Sbjct: 203 F 203
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|197685 smart00367, LRR_CC, Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.97 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.95 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.88 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.68 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.63 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.6 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.51 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.45 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.44 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.38 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.37 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.31 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.26 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.26 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.23 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.16 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 99.09 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.04 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 99.02 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.95 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.92 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.82 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.81 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.67 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.67 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 98.57 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.52 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.47 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.4 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.38 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.33 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.3 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.27 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.25 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.02 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.01 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.0 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 97.98 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 97.98 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.96 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.95 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.92 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.86 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.86 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.79 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 97.66 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.65 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.56 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.55 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.48 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.37 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.28 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.25 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.24 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 97.2 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 97.05 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 97.04 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 96.87 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.78 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 96.77 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 96.64 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.63 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.58 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.58 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 96.48 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 96.4 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.23 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 96.15 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.85 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.61 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.47 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 95.33 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.21 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.1 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 94.9 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 94.68 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 94.46 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 94.45 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 94.42 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 94.26 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 92.08 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 90.71 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 88.49 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 87.85 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 86.82 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 83.59 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 83.11 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.5e-31 Score=215.42 Aligned_cols=288 Identities=25% Similarity=0.411 Sum_probs=199.1
Q ss_pred hhhcccccccCCchHHHHHHHcCCCccchhHHhhccHHHHHHHccCCCcceeecccccccch-hhHHHHhhccccCCcCe
Q 021374 10 AAEEEETWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNAG-NRLVAALSIPRYRHVRE 88 (313)
Q Consensus 10 ~~~~~~~~~~~~~peiL~~If~~L~~~~l~~~~~v~~~w~~~~~~~~~~~~~l~~~~~~~~~-~~~~~~~~~~~~~~l~~ 88 (313)
..+.+..| .+|||++.+||++|+...+++++++|+.|... +.+..-|+++|+..+..-. ..+++.+.......+++
T Consensus 66 ~~~~~~~~--~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~-AlD~~~~q~idL~t~~rDv~g~VV~~~~~Rcgg~lk~ 142 (483)
T KOG4341|consen 66 ADNNSISR--SLPPELLLKVFSMLDTKSLCRAAQCCTMWNKL-ALDGSCWQHIDLFTFQRDVDGGVVENMISRCGGFLKE 142 (483)
T ss_pred hhcccccc--cCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhh-hhccccceeeehhcchhcCCCcceehHhhhhcccccc
Confidence 44556678 77999999999999999999999999999976 7899999999987655431 12222222222234555
Q ss_pred eeccCCccCchHHHHHHHHHhcCCCCCCcEEecCCCCCCChHHHHHHHhcCCCCcEEEecCCcccCHHHHHHHHhcCCCC
Q 021374 89 INLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHI 168 (313)
Q Consensus 89 L~l~~~~~~~~~~~~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L 168 (313)
|.+.++..+.+..+..+...| +++++|.+.+|..+++..+..+...|++|+.|++..|..+++..++.++..|++|
T Consensus 143 LSlrG~r~v~~sslrt~~~~C----pnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL 218 (483)
T KOG4341|consen 143 LSLRGCRAVGDSSLRTFASNC----PNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKL 218 (483)
T ss_pred ccccccccCCcchhhHHhhhC----CchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhH
Confidence 555555444444444444333 5555555555544555544444455555555555544445554444444445555
Q ss_pred cEEecc--------------------------CCcccchHHHHHHHHhCCCCcEEecCCCCCCCHHHHHHHHhhCCCCCE
Q 021374 169 IDLNLS--------------------------GCKNLLDKSLQLIADNYQELESLNLTRCVKLTDGGLQKILIKCSSLRS 222 (313)
Q Consensus 169 ~~L~l~--------------------------~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~ 222 (313)
++|+++ ||....+..+.....+++-+..+++..|+.+++.++..+...+..|+.
T Consensus 219 ~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~ 298 (483)
T KOG4341|consen 219 KYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQV 298 (483)
T ss_pred HHhhhccCchhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhh
Confidence 555444 444444444444445555666777777777788777777777888888
Q ss_pred EEeCCCCCCCHHHHHHhh-cCCCCCEEecCCCCCCChHHHHHhhC-CCCCceeeccCCCCCChHHHHHHHHhCCCccEee
Q 021374 223 LNLYALSGFTDEAYKKIS-LLAHLKFLDLCGAQNLSDEGLACIAK-CKNLVSLNLTWCVRITDVGVMAIAEGCSSLEFLS 300 (313)
Q Consensus 223 L~l~~~~~~~~~~~~~l~-~~~~L~~L~l~~~~~~~~~~~~~l~~-~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~ 300 (313)
|..++|..+++..+..++ .+++|+.|.+++|..+++.++..+++ ++.|+.+++.+|..+++..+..+..+||.|++++
T Consensus 299 l~~s~~t~~~d~~l~aLg~~~~~L~~l~l~~c~~fsd~~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~ls 378 (483)
T KOG4341|consen 299 LCYSSCTDITDEVLWALGQHCHNLQVLELSGCQQFSDRGFTMLGRNCPHLERLDLEECGLITDGTLASLSRNCPRLRVLS 378 (483)
T ss_pred hcccCCCCCchHHHHHHhcCCCceEEEeccccchhhhhhhhhhhcCChhhhhhcccccceehhhhHhhhccCCchhccCC
Confidence 888888888888888887 68899999999998889888888875 8899999999988888888888888999999998
Q ss_pred cCCc
Q 021374 301 SGAE 304 (313)
Q Consensus 301 l~~~ 304 (313)
++.|
T Consensus 379 lshc 382 (483)
T KOG4341|consen 379 LSHC 382 (483)
T ss_pred hhhh
Confidence 8865
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 313 | ||||
| 3ogk_B | 592 | Structure Of Coi1-Ask1 In Complex With Coronatine A | 3e-04 |
| >pdb|3OGK|B Chain B, Structure Of Coi1-Ask1 In Complex With Coronatine And An Incomplete Jaz1 Degron Length = 592 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 313 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-42 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-28 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-27 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-22 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 7e-22 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 4e-13 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-28 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-26 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-24 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 9e-23 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-21 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-11 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 8e-15 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-12 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-11 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 2e-05 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-13 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-13 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-13 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-12 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-11 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 8e-09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 7e-06 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 3e-12 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-06 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-11 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 3e-11 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 3e-08 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 1e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 4e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-08 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 3e-07 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 1e-04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 4e-06 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 5e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-04 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 1e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 5e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 6e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 147 bits (373), Expect = 3e-42
Identities = 60/305 (19%), Positives = 125/305 (40%), Gaps = 29/305 (9%)
Query: 25 VIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMN---NAGNRLVAALSIP 81
++ I S L +++ + V +R L S SLW +DL N + RL++ I
Sbjct: 17 LLGIFS-CLCLPELLKVSGVCKRWYR-LASDESLWQTLDLTGKNLHPDVTGRLLSQGVIA 74
Query: 82 RYRHVREINLEFAQDIEDRHLELLKTKC-----------LGSLQDLESLNLNGCQKISDK 130
++ A+ ++ + L L++L+L G ++SD
Sbjct: 75 FRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGL-RLSDP 133
Query: 131 GIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDKSLQ-LIAD 189
+ ++ L ++ ++ +Q L+ +C + +LNLS C + +K +Q +A
Sbjct: 134 IVNTLAK-NSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAH 192
Query: 190 NYQELESLNLTRCVK-LTDGGLQKILIKCSSLRSLNLYALSGFTDEAYKKISLLAHLKFL 248
+ + LNL+ K L L ++ +C +L L+L ++ +++ L +L+ L
Sbjct: 193 VSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHL 252
Query: 249 DLCGAQNLSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCSSLEFLSSGAEMNCC 308
L ++ E L + + L +L + + D + + E L ++NC
Sbjct: 253 SLSRCYDIIPETLLELGEIPTLKTLQVFGI--VPDGTLQLLKEALPHL-------QINCS 303
Query: 309 SCSHI 313
+ I
Sbjct: 304 HFTTI 308
|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Length = 197 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 100.0 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.94 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.92 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.86 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.85 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.85 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.8 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.78 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.78 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.77 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.67 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.66 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.58 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.58 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.58 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.57 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.56 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.55 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.54 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.54 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.54 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.52 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.52 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.5 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.48 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.48 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.47 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.46 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.44 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.44 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.44 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.44 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.43 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.43 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.43 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.42 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.4 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.39 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.39 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.39 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.38 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.38 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.38 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.38 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.37 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.37 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.37 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.36 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.36 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.35 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.35 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.34 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.34 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.34 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.34 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.33 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.33 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.3 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.3 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.3 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.3 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.3 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.29 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.29 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.29 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.29 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.29 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.28 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.28 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.27 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.25 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.25 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.25 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.23 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.23 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.22 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.21 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.21 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.2 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.19 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.19 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.19 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.19 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.18 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.17 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.17 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.15 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.15 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.15 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.14 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.13 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.13 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.12 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.1 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.1 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.08 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.08 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.07 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.07 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.07 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.07 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.06 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.06 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.06 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.0 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.0 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.0 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.97 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.96 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.92 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.89 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.86 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.8 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.77 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.76 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.75 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.74 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.72 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.72 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.69 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.69 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.68 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.65 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.64 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.63 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.59 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.58 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.58 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.56 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.54 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.52 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.5 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.47 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.46 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.44 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.38 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.38 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.33 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.32 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.3 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.23 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.21 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.18 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.01 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.97 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.89 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.83 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.81 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 97.67 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.62 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.48 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.44 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.34 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.31 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.28 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.24 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 95.73 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 95.08 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 94.05 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 92.88 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 91.73 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 90.63 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 86.76 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 83.75 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=100.00 E-value=8.6e-32 Score=227.37 Aligned_cols=275 Identities=20% Similarity=0.283 Sum_probs=196.8
Q ss_pred hcccccccCCchHHHHHHHcCCCccchhHHhhccHHHHHHHccCCCcceeecccccccchhhHHHHh-------------
Q 021374 12 EEEETWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNAGNRLVAAL------------- 78 (313)
Q Consensus 12 ~~~~~~~~~~~peiL~~If~~L~~~~l~~~~~v~~~w~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~------------- 78 (313)
.++..|. .+|+|++.+||+||+.+|+.+++.|||+|+.+. ..|..|+.+++.........+....
T Consensus 4 ~~~~~~~-~LP~eil~~If~~L~~~d~~~~~~vc~~W~~~~-~~~~~~~~l~l~~~~~~~~~~~~~~~~~l~~L~l~~n~ 81 (336)
T 2ast_B 4 FPGVSWD-SLPDELLLGIFSCLCLPELLKVSGVCKRWYRLA-SDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSF 81 (336)
T ss_dssp ---CCSS-SSCHHHHHHHHTTSCHHHHHHTTSSCHHHHHHH-TCSTTSSEEECTTCBCCHHHHHHHHHTTCSEEECTTCE
T ss_pred cccCChh-hCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHh-cCchhheeeccccccCCHHHHHhhhhccceEEEcCCcc
Confidence 3456784 455589999999999999999999999999985 5699999999987543322211110
Q ss_pred ------hccccCCcCeeeccCCccCchHHHHHHHHHhcCCCCCCcEEecCCCCCCChHHHHHHHhcCCCCcEEEecCCcc
Q 021374 79 ------SIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVR 152 (313)
Q Consensus 79 ------~~~~~~~l~~L~l~~~~~~~~~~~~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~ 152 (313)
....+++|+.|+++++. +++..+... +..+++|++|+++++ .+++.....+ ..+++|++|++++|..
T Consensus 82 l~~~~~~~~~~~~L~~L~L~~~~-l~~~~~~~~----~~~~~~L~~L~L~~~-~l~~~~~~~l-~~~~~L~~L~L~~~~~ 154 (336)
T 2ast_B 82 MDQPLAEHFSPFRVQHMDLSNSV-IEVSTLHGI----LSQCSKLQNLSLEGL-RLSDPIVNTL-AKNSNLVRLNLSGCSG 154 (336)
T ss_dssp ECSCCCSCCCCBCCCEEECTTCE-ECHHHHHHH----HTTBCCCSEEECTTC-BCCHHHHHHH-TTCTTCSEEECTTCBS
T ss_pred ccccchhhccCCCCCEEEccCCC-cCHHHHHHH----HhhCCCCCEEeCcCc-ccCHHHHHHH-hcCCCCCEEECCCCCC
Confidence 01124667777777753 444434433 345588888888886 5565555555 4478888888888766
Q ss_pred cCHHHHHHHHhcCCCCcEEeccCCcccchHHHHHHHHhCC-CCcEEecCCCC-CCCHHHHHHHHhhCCCCCEEEeCCCCC
Q 021374 153 VTDIGIQHLVKNCKHIIDLNLSGCKNLLDKSLQLIADNYQ-ELESLNLTRCV-KLTDGGLQKILIKCSSLRSLNLYALSG 230 (313)
Q Consensus 153 ~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~l~~l~~~~~-~L~~L~l~~~~-~~~~~~~~~~~~~~~~L~~L~l~~~~~ 230 (313)
+++.++......+++|++|++++|..+++..+......++ +|++|++++|. .+++..+...+..+++|+.|+++++..
T Consensus 155 l~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~ 234 (336)
T 2ast_B 155 FSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVM 234 (336)
T ss_dssp CCHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTT
T ss_pred CCHHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCc
Confidence 7777777767778888888888875677666666666788 88888888864 566667777777888888888888655
Q ss_pred CCHHHHHHhhcCCCCCEEecCCCCCCChHHHHHhhCCCCCceeeccCCCCCChHHHHHHHHhCCCcc
Q 021374 231 FTDEAYKKISLLAHLKFLDLCGAQNLSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCSSLE 297 (313)
Q Consensus 231 ~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~ 297 (313)
+++..+..+..+++|++|++++|..+++.++..+.++++|++|++++| +++.++..+.+.+|+|+
T Consensus 235 l~~~~~~~l~~l~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~--i~~~~~~~l~~~l~~L~ 299 (336)
T 2ast_B 235 LKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI--VPDGTLQLLKEALPHLQ 299 (336)
T ss_dssp CCGGGGGGGGGCTTCCEEECTTCTTCCGGGGGGGGGCTTCCEEECTTS--SCTTCHHHHHHHSTTSE
T ss_pred CCHHHHHHHhCCCCCCEeeCCCCCCCCHHHHHHHhcCCCCCEEeccCc--cCHHHHHHHHhhCcceE
Confidence 776667777778888888888887677766666777888888888877 77777777765566555
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 313 | ||||
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 1e-08 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 1e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.004 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.4 bits (124), Expect = 1e-08
Identities = 51/272 (18%), Positives = 98/272 (36%), Gaps = 44/272 (16%)
Query: 58 LWLVIDLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLE 117
LW +DL N + LS + F H + ++
Sbjct: 1 LWQTLDLTGKNLHPDVTGRLLS--QGVIAFRCPRSFMDQPLAEHFSPFR---------VQ 49
Query: 118 SLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCK 177
++L+ I + I S C +L+ S+ R++D + L +++ LNLSGC
Sbjct: 50 HMDLSNS-VIEVSTLHGILSQCSKLQNLSLEGL-RLSDPIVNTLA-KNSNLVRLNLSGCS 106
Query: 178 NLLDKSLQLIADNYQELESLNLTRCVKLTDGGLQKIL----------------------- 214
+ +LQ + + L+ LNL+ C T+ +Q +
Sbjct: 107 GFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSD 166
Query: 215 -----IKCSSLRSLNLYALSGFTDEAYKKISLLAHLKFLDLCGAQNLSDEGLACIAKCKN 269
+C +L L+L ++ +++ L +L+ L L ++ E L + +
Sbjct: 167 LSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIPT 226
Query: 270 LVSLNLTWCVRITDVGVMAIAEGCSSLEFLSS 301
L +L + V D + + E L+ S
Sbjct: 227 LKTLQVFGIV--PDGTLQLLKEALPHLQINCS 256
|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 313 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.95 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.93 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.59 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.53 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.41 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.38 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.24 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.23 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.21 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.21 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.21 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.15 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.08 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.05 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.01 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.99 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.97 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.97 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.92 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.91 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.86 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.84 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 98.81 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.8 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.77 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.76 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 98.75 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.74 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.73 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.69 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.68 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.68 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.67 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.6 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.58 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.53 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.47 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.38 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.32 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.12 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.08 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.73 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.4 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.28 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 96.13 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.51 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95 E-value=3.9e-26 Score=185.65 Aligned_cols=206 Identities=20% Similarity=0.327 Sum_probs=176.5
Q ss_pred CCcCeeeccCCccCchHHHHHHHHHhcCCCCCCcEEecCCCCCCChHHHHHHHhcCCCCcEEEecCCcccCHHHHHHHHh
Q 021374 84 RHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVK 163 (313)
Q Consensus 84 ~~l~~L~l~~~~~~~~~~~~~l~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~~ 163 (313)
..|++|+++++ .+++..+..+.. .+++|++|++++| .+++..+..+ ..+++|++|++++|..+++.++..++.
T Consensus 46 ~~L~~LdLs~~-~i~~~~l~~l~~----~c~~L~~L~L~~~-~l~~~~~~~l-~~~~~L~~L~Ls~c~~itd~~l~~l~~ 118 (284)
T d2astb2 46 FRVQHMDLSNS-VIEVSTLHGILS----QCSKLQNLSLEGL-RLSDPIVNTL-AKNSNLVRLNLSGCSGFSEFALQTLLS 118 (284)
T ss_dssp BCCCEEECTTC-EECHHHHHHHHT----TBCCCSEEECTTC-BCCHHHHHHH-TTCTTCSEEECTTCBSCCHHHHHHHHH
T ss_pred CCCCEEECCCC-ccCHHHHHHHHH----hCCCccccccccc-CCCcHHHHHH-hcCCCCcCccccccccccccccchhhH
Confidence 46899999876 466666777754 4499999999998 6777777766 468999999999988999999999888
Q ss_pred cCCCCcEEeccCCcccchHHHHHHHH-hCCCCcEEecCCC-CCCCHHHHHHHHhhCCCCCEEEeCCCCCCCHHHHHHhhc
Q 021374 164 NCKHIIDLNLSGCKNLLDKSLQLIAD-NYQELESLNLTRC-VKLTDGGLQKILIKCSSLRSLNLYALSGFTDEAYKKISL 241 (313)
Q Consensus 164 ~~~~L~~L~l~~~~~~~~~~l~~l~~-~~~~L~~L~l~~~-~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~ 241 (313)
.+++|++|++++|..+++..+..... .+++|+.|++.+| ..+++.++..+..++++|++|++++|..+++..+..+..
T Consensus 119 ~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l~~ 198 (284)
T d2astb2 119 SCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQ 198 (284)
T ss_dssp HCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGGGG
T ss_pred HHHhccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhhcc
Confidence 99999999999998888877765444 4589999999986 467888898888999999999999988899988888999
Q ss_pred CCCCCEEecCCCCCCChHHHHHhhCCCCCceeeccCCCCCChHHHHHHHHhCCCccE
Q 021374 242 LAHLKFLDLCGAQNLSDEGLACIAKCKNLVSLNLTWCVRITDVGVMAIAEGCSSLEF 298 (313)
Q Consensus 242 ~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~ 298 (313)
+++|++|++++|..+++.++..++++++|++|++.+| +++.++..+.+.+|+|+.
T Consensus 199 ~~~L~~L~L~~C~~i~~~~l~~L~~~~~L~~L~l~~~--~~d~~l~~l~~~lp~L~i 253 (284)
T d2astb2 199 LNYLQHLSLSRCYDIIPETLLELGEIPTLKTLQVFGI--VPDGTLQLLKEALPHLQI 253 (284)
T ss_dssp CTTCCEEECTTCTTCCGGGGGGGGGCTTCCEEECTTS--SCTTCHHHHHHHSTTSEE
T ss_pred cCcCCEEECCCCCCCChHHHHHHhcCCCCCEEeeeCC--CCHHHHHHHHHhCccccc
Confidence 9999999999998999988888889999999999987 788889999888998874
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|