Citrus Sinensis ID: 021416

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MDVNLEQVKESTDSQEVSHPSPAKLSLSLPSTSSLTSSPLSSQSHLYPASSTTAKWPRHSPGHPLLRQASDSRIPGLKSVNGYSVREERPVIPSWSNESTVGSGVGSSDGWSMNAFSELMATSHKERWSFDSESLGFNHEKIARSCSRVSASSSVDMQTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLGEKKTHKLSERALKSEMESKARNNKRWKNRIVDSNLDSNSVVLDRHKGSWNEGKGPKMASSSSLKSSSGKPFLKRHFSFGSKGSRSLSENHSTWKKGFFWPKSSRT
cccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccHHccccccccccccccccccccHHHHHcccccEEEEEcccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccEHEHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccHccHHHHHHHcccEEEEEEccccEcHHHHHHcccHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccccccHHHHHHHcccccccccccccccccccccccHHHHHccccccccccccccccccccccEEcccccc
mdvnleqvkestdsqevshpspaklslslpstssltssplssqshlypassttakwprhspghpllrqasdsripglksvngysvreerpvipswsnestvgsgvgssdgwsmNAFSELMATSHkerwsfdseslgfnhekiarscsrvsasssvdmqtCGVCSKLLSELCVVAVLTCghlyhadcLENITAEInkydpacpvctlgekkthKLSERALKSEMESKARNnkrwknrivdsnldsnsvvldrhkgswnegkgpkmasssslksssgkpflkrhfsfgskgsrslsenhstwkkgffwpkssrt
mdvnleqvkestdsqevshpspaklslslpSTSSLTSSPLSSQSHLYPASSTTAKWPRHSPGHPllrqasdsripglksvngysvreerpvipswsnestvgsgVGSSDGWSMNAFSELMATSHKERWSFDSESLGFNHEKIARSCSRVSASSSVDMQTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTlgekkthklseralksemeskarnnkrwknrivdsnldsnsvvldrhkgswnegkgpkmasssslksssgkpFLKRHFSfgskgsrslsenhstwkkgffwpkssrt
MDVNLEQVKESTDSQEVshpspaklslslpstssltssplssqshlYPASSTTAKWPRHSPGHPLLRQASDSRIPGLKSVNGYSVREERPVIPSWsnestvgsgvgssdgwsMNAFSELMATSHKERWSFDSESLGFNHEKIarscsrvsasssvDMQTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLGEKKTHKLSERALKSEMESKARNNKRWKNRIVDSNLDSNSVVLDRHKGSWNEGKGPKMAsssslksssGKPFLKRHFSFGSKGSRSLSENHSTWKKGFFWPKSSRT
***************************************************************************************************************************************************************CGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLG***********************************************************************************************GFF*******
**************************************************************************************************************************************************************TCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLGEK**********************************************************************************************FFWPK****
************************************************************PGHPLLRQASDSRIPGLKSVNGYSVREERPVIPSWS**********SSDGWSMNAFSELMATSHKERWSFDSESLGFNHEKIAR*************QTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLGEKKTHKLSERALKSEMESKARNNKRWKNRIVDSNLDSNSVVLDRHKGSWN*******************PFLKRHFSFG***********STWKKGFFWPKSSRT
******Q**E*************************************************************************************************************************************************DMQTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLGEKKTHKLSERALKSEMESKARNNKRWKNRIVDSNLDSNSVVLDRHKGS*********************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVNLEQVKESTDSQEVSHPSPAKLSLSLPSTSSLTSSPLSSQSHLYPASSTTAKWPRHSPGHPLLRQASDSRIPGLKSVNGYSVREERPVIPSWSNESTVGSGVGSSDGWSMNAFSELMATSHKERWSFDSESLGFNHEKIARSCSRVSASSSVDMQTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLGEKKTHKLSxxxxxxxxxxxxxxxxxxxxxIVDSNLDSNSVVLDRHKGSWNEGKGPKMASSSSLKSSSGKPFLKRHFSFGSKGSRSLSENHSTWKKGFFWPKSSRT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
225428394 455 PREDICTED: uncharacterized protein LOC10 0.983 0.674 0.666 4e-96
224077870314 predicted protein [Populus trichocarpa] 0.958 0.952 0.612 7e-94
255543769 433 ubiquitin-protein ligase, putative [Rici 0.964 0.695 0.625 1e-93
224105347 437 predicted protein [Populus trichocarpa] 0.987 0.704 0.606 1e-92
356508284 435 PREDICTED: uncharacterized protein LOC10 0.977 0.701 0.617 1e-91
356542357 432 PREDICTED: uncharacterized protein LOC10 0.964 0.696 0.563 1e-88
356516965 435 PREDICTED: uncharacterized protein LOC10 0.977 0.701 0.589 1e-86
449533797336 PREDICTED: uncharacterized protein LOC10 0.990 0.919 0.616 5e-86
449464702 439 PREDICTED: uncharacterized protein LOC10 0.990 0.703 0.616 2e-85
356516963 421 PREDICTED: uncharacterized protein LOC10 0.849 0.629 0.615 4e-83
>gi|225428394|ref|XP_002283631.1| PREDICTED: uncharacterized protein LOC100250419 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  357 bits (915), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 222/333 (66%), Positives = 261/333 (78%), Gaps = 26/333 (7%)

Query: 3   VNLEQVKESTDSQEVSHPSPAKLS-------LSLPSTSSLTSSPLSSQSHLYPASSTTAK 55
           + L  VKEST S  VS PSPAKLS        +LPS SSL++SP+SSQSH+ PA+ST ++
Sbjct: 124 LELVIVKESTGSPGVSDPSPAKLSPALPSPSPTLPSPSSLSTSPVSSQSHILPATSTPSR 183

Query: 56  WPRHSPGHPLLRQASDSRIPGLKSVNGYSVREERP--VIPSWSNESTVGSGVGSSDGWSM 113
           W R SPGH LLRQ SDSRIPGLKS N YS+ EERP  V+P W+N+S  GS  GSSDGWSM
Sbjct: 184 WSRGSPGHHLLRQVSDSRIPGLKSPN-YSISEERPPFVLPVWNNDSIRGSYGGSSDGWSM 242

Query: 114 NAFSELMATSHKERWSFDSESLGFNHEKIARSCSRVSASSSVDMQTCGVCSKLLS----- 168
           +AFSELMATS +ERWSFDSESLGFN +KI RS SR+SAS S+D+QTCGVC+KLL+     
Sbjct: 243 HAFSELMATSRRERWSFDSESLGFNRDKITRSSSRISASPSIDLQTCGVCAKLLTERSSW 302

Query: 169 ---------ELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLGEKKTHKLSERAL 219
                    EL VVAVL CGH+YHA+CLEN+TAEINKYDPACPVCT GEK+T KLSE+AL
Sbjct: 303 GGQKIIASNELSVVAVLICGHVYHAECLENMTAEINKYDPACPVCTFGEKQTLKLSEKAL 362

Query: 220 KSEMESKARNNKRWKNRIVDSNLDSNSVVLDRHKGSWNEGKGPKMASSSSLKSSSGKPFL 279
           K+EM+ KA+ NKR +NR+VDS+LD  +VV D  K S  EGKGPK+ SSSS+KSS GKPFL
Sbjct: 363 KAEMDLKAK-NKRSRNRVVDSDLDGETVVFDHRKSSGREGKGPKLGSSSSMKSSLGKPFL 421

Query: 280 KRHFSFGSKGSRSLSENH-STWKKGFFWPKSSR 311
           +RHFSFGSKG++S SE+H ST KKGFFW KSSR
Sbjct: 422 RRHFSFGSKGTKSFSESHQSTRKKGFFWAKSSR 454

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224077870|ref|XP_002305445.1| predicted protein [Populus trichocarpa] gi|222848409|gb|EEE85956.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255543769|ref|XP_002512947.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547958|gb|EEF49450.1| ubiquitin-protein ligase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224105347|ref|XP_002313778.1| predicted protein [Populus trichocarpa] gi|222850186|gb|EEE87733.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356508284|ref|XP_003522888.1| PREDICTED: uncharacterized protein LOC100778123 [Glycine max] Back     alignment and taxonomy information
>gi|356542357|ref|XP_003539633.1| PREDICTED: uncharacterized protein LOC100790241 [Glycine max] Back     alignment and taxonomy information
>gi|356516965|ref|XP_003527161.1| PREDICTED: uncharacterized protein LOC100795372 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|449533797|ref|XP_004173858.1| PREDICTED: uncharacterized protein LOC101229954 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449464702|ref|XP_004150068.1| PREDICTED: uncharacterized protein LOC101206081 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356516963|ref|XP_003527160.1| PREDICTED: uncharacterized protein LOC100795372 isoform 1 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
TAIR|locus:2018404455 AT1G75400 [Arabidopsis thalian 0.830 0.569 0.429 2e-49
TAIR|locus:2136368429 AT4G39140 [Arabidopsis thalian 0.817 0.594 0.395 1.6e-45
TAIR|locus:2050110421 AT2G21500 [Arabidopsis thalian 0.778 0.577 0.411 2.2e-43
TAIR|locus:2013114444 AT1G19680 [Arabidopsis thalian 0.826 0.581 0.414 7.3e-43
TAIR|locus:2172314320 AT5G18260 [Arabidopsis thalian 0.230 0.225 0.306 0.00021
TAIR|locus:2035819348 AT1G14180 [Arabidopsis thalian 0.144 0.129 0.4 0.00054
TAIR|locus:2018404 AT1G75400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 515 (186.3 bits), Expect = 2.0e-49, P = 2.0e-49
 Identities = 118/275 (42%), Positives = 152/275 (55%)

Query:    48 PASSTTAKWPRHSPGHPLLRQASDSRIPGLKS-VNGYSVREERP--VIPSWXXXXXXXXX 104
             P  ST ++  R SPGH L RQ SDS+I GLKS +N YS+ E R   V+ +          
Sbjct:   164 PPKSTPSRRARRSPGHQLFRQVSDSQILGLKSPINNYSISEGRSSFVLSTCSNDFATGSQ 223

Query:   105 XXXXXXX-XMNAFSELMATSHKERWSFDSESLGFNHEKIXXXXXXXXXX-XXXDMQTCGV 162
                      MN FSEL+A S ++RWSFDSE LG    K+              D Q CG 
Sbjct:   224 YASSEGGWSMNTFSELVAYSQRDRWSFDSEHLGSGRRKLSGGSSRFSFSPSVVDQQVCGA 283

Query:   163 CSKLLSE--------LCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLGEKKTHKL 214
             CSKLL+E        L + AVL CGH+YHA+CLE +T +I KYDPACP+CT+GEK+  K+
Sbjct:   284 CSKLLTERSSIATFELPIAAVLACGHVYHAECLETMTTDIEKYDPACPICTIGEKRVAKI 343

Query:   215 SERALKSEMESKARNNKRWKNRIVDSNLDSNSVVLDRHKGSWNEGKGPKMAXXXXXXXXX 274
             + +ALK+E E+KA+  KR KNR+VDS  +S        K    EGK  K+          
Sbjct:   344 TRKALKAEAEAKAKQYKRCKNRVVDSYGESECDEFVFQKMGKREGKALKLEASCSSKSSS 403

Query:   275 GKPFLKRHF-SFGSKGSRSLSENHSTWKKGFFWPK 308
              K FLK HF S  SK ++  S++ S  KKGF W +
Sbjct:   404 NKSFLKWHFASISSKWNKPSSKD-SALKKGF-WSR 436
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2136368 AT4G39140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2050110 AT2G21500 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2013114 AT1G19680 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2172314 AT5G18260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2035819 AT1G14180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_IV0651
hypothetical protein (314 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 6e-06
smart0018440 smart00184, RING, Ring finger 1e-05
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-04
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 0.002
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 42.4 bits (100), Expect = 6e-06
 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 4/47 (8%)

Query: 158 QTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVC 204
             C +C         V VL CGH++H +CL+       +    CP+C
Sbjct: 1   DECPICLDEFEPGEEVVVLPCGHVFHKECLDKWL----RSSNTCPLC 43

Length = 46
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.39
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.26
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.14
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.13
PHA02929238 N1R/p28-like protein; Provisional 98.99
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.92
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.89
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.88
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.85
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.83
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.83
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.77
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.76
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.76
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.75
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.72
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.71
PF1463444 zf-RING_5: zinc-RING finger domain 98.66
PHA02926242 zinc finger-like protein; Provisional 98.65
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.63
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.61
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.59
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.52
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.51
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.45
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.3
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.27
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.21
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.21
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.15
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.12
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.11
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.1
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.06
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.01
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.94
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.87
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.77
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.71
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.62
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.57
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.57
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.46
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 97.37
COG52191525 Uncharacterized conserved protein, contains RING Z 97.26
KOG1941518 consensus Acetylcholine receptor-associated protei 97.26
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.14
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.13
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.11
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.87
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.8
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.78
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.69
KOG2660 331 consensus Locus-specific chromosome binding protei 96.69
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.68
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.68
KOG3039303 consensus Uncharacterized conserved protein [Funct 96.66
KOG4445368 consensus Uncharacterized conserved protein, conta 96.66
COG5152259 Uncharacterized conserved protein, contains RING a 96.54
KOG1940276 consensus Zn-finger protein [General function pred 96.47
COG5222427 Uncharacterized conserved protein, contains RING Z 96.1
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.91
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.78
PF04641260 Rtf2: Rtf2 RING-finger 95.63
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 95.21
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.21
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.19
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.14
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 95.08
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.0
PHA03096284 p28-like protein; Provisional 94.68
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 94.66
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.58
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 94.47
PHA02825162 LAP/PHD finger-like protein; Provisional 94.44
PHA02862156 5L protein; Provisional 94.42
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.4
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 94.26
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.26
KOG4739233 consensus Uncharacterized protein involved in syna 93.95
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.82
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.71
KOG1001674 consensus Helicase-like transcription factor HLTF/ 93.65
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 93.62
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.54
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 92.97
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 92.87
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.74
COG5236 493 Uncharacterized conserved protein, contains RING Z 92.6
KOG3002 299 consensus Zn finger protein [General function pred 92.37
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 92.34
KOG4367 699 consensus Predicted Zn-finger protein [Function un 91.78
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 91.24
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 91.0
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 90.94
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 90.52
KOG02981394 consensus DEAD box-containing helicase-like transc 90.42
KOG3039 303 consensus Uncharacterized conserved protein [Funct 88.36
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 87.98
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 87.0
KOG0825 1134 consensus PHD Zn-finger protein [General function 86.44
KOG4718235 consensus Non-SMC (structural maintenance of chrom 85.68
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 84.8
KOG03091081 consensus Conserved WD40 repeat-containing protein 84.21
PF10272358 Tmpp129: Putative transmembrane protein precursor; 84.04
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 82.86
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 81.38
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 80.41
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information 
Probab=99.39  E-value=1.3e-13  Score=95.54  Aligned_cols=44  Identities=30%  Similarity=0.831  Sum_probs=38.2

Q ss_pred             cccccccccccccceeEEeccCCcchHHHHHHHHHhcCCCCCCCCCCC
Q 021416          158 QTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCT  205 (312)
Q Consensus       158 ~~C~ICle~f~~~~vv~~LpCGH~FH~~CI~~Wl~~~~~~~~~CPvCR  205 (312)
                      ..|+||++.|..+..+..|+|||+||.+||.+|+..    ...||+||
T Consensus         1 d~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~~~~~~----~~~CP~CR   44 (44)
T PF13639_consen    1 DECPICLEEFEDGEKVVKLPCGHVFHRSCIKEWLKR----NNSCPVCR   44 (44)
T ss_dssp             -CETTTTCBHHTTSCEEEETTSEEEEHHHHHHHHHH----SSB-TTTH
T ss_pred             CCCcCCChhhcCCCeEEEccCCCeeCHHHHHHHHHh----CCcCCccC
Confidence            369999999986777778999999999999999988    67999996

...
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-04
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-04
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 4e-04
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 4e-04
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 7e-04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 8e-04
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 9e-04
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
 Score = 37.8 bits (88), Expect = 2e-04
 Identities = 15/62 (24%), Positives = 27/62 (43%), Gaps = 10/62 (16%)

Query: 159 TCGVCSKLLSELC----VVAVLTCGHLYHADCLENITAEINKYDPACPVC--TLGEKKTH 212
           +C +C    SE+     ++    CGH++ + CL +     N     CP C   +  K+ H
Sbjct: 5   SCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANT----CPTCRKKINHKRYH 60

Query: 213 KL 214
            +
Sbjct: 61  PI 62
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.51
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.42
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.42
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.38
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.36
2ect_A78 Ring finger protein 126; metal binding protein, st 99.35
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.32
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.32
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.3
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.28
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.28
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.28
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.25
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.25
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.25
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.24
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.23
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.22
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.2
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.2
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.2
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.2
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.19
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.18
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.18
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.17
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.17
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.15
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.14
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.13
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.12
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.11
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.11
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.11
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.09
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.08
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.08
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.08
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.07
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.06
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.06
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.06
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.05
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.01
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.01
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.97
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.97
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.96
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.93
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.91
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.91
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.84
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.82
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.81
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.8
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.79
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.79
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.78
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.75
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.75
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.69
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.63
2ea5_A68 Cell growth regulator with ring finger domain prot 98.57
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.46
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.43
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.39
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.34
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.17
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.86
3nw0_A238 Non-structural maintenance of chromosomes element 97.27
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 95.72
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 92.45
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 90.29
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 89.64
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 86.29
2k16_A75 Transcription initiation factor TFIID subunit 3; p 85.77
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 85.59
1wil_A89 KIAA1045 protein; ring finger domain, structural g 84.91
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 84.49
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 84.23
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 81.81
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 81.33
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.51  E-value=1.6e-14  Score=113.13  Aligned_cols=74  Identities=19%  Similarity=0.315  Sum_probs=59.0

Q ss_pred             CcccCCCHHHHhhcccccccC---CCCCCcccccccccccccceeEEeccCCcchHHHHHHHHHhcCCCCCCCCCCCCCC
Q 021416          132 SESLGFNHEKIARSCSRVSAS---SSVDMQTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKYDPACPVCTLGE  208 (312)
Q Consensus       132 ~e~~G~~~e~I~~~~~~~s~s---~~~~~~~C~ICle~f~~~~vv~~LpCGH~FH~~CI~~Wl~~~~~~~~~CPvCR~~~  208 (312)
                      ....|++.+.|..++......   ...+...|+||++.|..+..+..|+|||.||..||..|+..    ...||+||..+
T Consensus        12 ~~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~----~~~CP~Cr~~~   87 (91)
T 2l0b_A           12 VANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQK----SGTCPVCRCMF   87 (91)
T ss_dssp             SCCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTT----TCBCTTTCCBS
T ss_pred             cCCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHc----CCcCcCcCccC
Confidence            356688999998888662221   12356789999999987777888999999999999999976    67999999766


Q ss_pred             c
Q 021416          209 K  209 (312)
Q Consensus       209 ~  209 (312)
                      .
T Consensus        88 ~   88 (91)
T 2l0b_A           88 P   88 (91)
T ss_dssp             S
T ss_pred             C
Confidence            3
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 312
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-05
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 9e-04
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 0.002
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.3 bits (99), Expect = 3e-06
 Identities = 15/67 (22%), Positives = 22/67 (32%), Gaps = 6/67 (8%)

Query: 138 NHEKIARSCSRVSASSSVDMQTCGVCSKLLSELCVVAVLTCGHLYHADCLENITAEINKY 197
           +H K+ +    +        Q C +C         V +  CGHL    CL +        
Sbjct: 4   DHIKVTQEQYELYCEMGSTFQLCKIC---AENDKDVKIEPCGHLMCTSCLTSW---QESE 57

Query: 198 DPACPVC 204
              CP C
Sbjct: 58  GQGCPFC 64
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.45
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.33
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.29
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.25
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.25
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.23
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.17
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.16
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.15
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.12
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.08
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.02
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.97
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.95
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.92
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.69
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 92.98
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 88.97
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 86.0
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 84.36
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 82.61
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 81.29
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.45  E-value=1e-14  Score=103.54  Aligned_cols=49  Identities=33%  Similarity=0.710  Sum_probs=42.5

Q ss_pred             CCcccccccccccccceeEEec-cCCcchHHHHHHHHHhcCCCCCCCCCCCCCC
Q 021416          156 DMQTCGVCSKLLSELCVVAVLT-CGHLYHADCLENITAEINKYDPACPVCTLGE  208 (312)
Q Consensus       156 ~~~~C~ICle~f~~~~vv~~Lp-CGH~FH~~CI~~Wl~~~~~~~~~CPvCR~~~  208 (312)
                      +...|+||++.|..++.+..++ |||.||.+||.+|+..    +..||+||..+
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~----~~~CP~CR~~i   53 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGS----HSTCPLCRLTV   53 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTT----CCSCSSSCCCS
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHh----CCcCCCCCCEe
Confidence            5567999999999777776675 9999999999999976    77899999865
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure