Citrus Sinensis ID: 021438


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310--
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDIKNLKL
ccccccccccccccEEEEccccccccccccEEEccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccccccccc
ccccccccccccccEEEccccccEEcHHccEEEcccEccccccHEEccccccccccccccccccccccccccEEEEcccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHcccccHHHccc
MADSYCADCKRLTEVvfdhsagdticseCGLVLEaysvdetsewrifanessdhdpvrvggplnpllsggglstviakptaggstellsgslgklqarsshpdrNLIQAFKSISAMSDRLGLVTTIKDRANEIYKkvedqkplrgrnQEAIVAACLYIACrqenkprtvKEFCSVANGTTKKEIGRAKEFIVKHLEAemgqsvemgtiHASDYLRRFCSNLGMTNQAVKAAQEAVQKsedldirrspISVAAAVIYIITQLsndtkplkeISIVTRVAEGTIKNVYKDLFPHLariipdwfaneediknlkl
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFAnessdhdpvrVGGPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKsisamsdrlGLVTTIKDRANEIykkvedqkplrgrnQEAIVAACLYIACrqenkprtvKEFCSvangttkkeigRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQksedldirrsPISVAAAVIYIItqlsndtkplkeISIVTRVAEGTIKNVYKDLFPHLARiipdwfaneediknlkl
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVggplnpllsggglsTVIAKPTAggstellsgslgklQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNqavkaaqeavqkSEDLDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDIKNLKL
****YCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFAN**********************L*TV*******************************IQAFKSISAMSDRLGLVTTIKDRANEIYKKV*******GRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVK***********LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFAN*********
**DSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWR********************LLSGGGL********************************NLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDIKNLKL
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNPLLSGGGLSTVIAKPTAGGSTELLSGSL*********PDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQ**************LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDIKNLKL
****YCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFAN***********GPLNPLLSGGGLSTVIAKPTA***TELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDI****L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDIKNLKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query312 2.2.26 [Sep-21-2011]
P48513313 Transcription initiation yes no 0.993 0.990 0.767 1e-144
Q8W0W3312 Transcription initiation yes no 0.990 0.990 0.767 1e-142
Q9SS44312 Transcription initiation yes no 0.993 0.993 0.752 1e-142
P48512312 Transcription initiation no no 0.990 0.990 0.712 1e-133
P29052315 Transcription initiation yes no 0.932 0.923 0.463 4e-67
P29054316 Transcription initiation N/A no 0.926 0.914 0.442 3e-63
P62916316 Transcription initiation yes no 0.926 0.914 0.436 1e-60
P62915316 Transcription initiation yes no 0.926 0.914 0.436 1e-60
Q5R886316 Transcription initiation yes no 0.926 0.914 0.436 1e-60
Q4R3J5316 Transcription initiation N/A no 0.926 0.914 0.436 1e-60
>sp|P48513|TF2B_SOYBN Transcription initiation factor IIB OS=Glycine max GN=TFIIB1 PE=2 SV=1 Back     alignment and function desciption
 Score =  511 bits (1317), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 238/310 (76%), Positives = 274/310 (88%)

Query: 1   MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVG 60
           M+D++C+DCKR TEVVFDHSAGDT+CSECGLVLE++S+DETSEWR FANES D+DP RVG
Sbjct: 1   MSDAFCSDCKRQTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPNRVG 60

Query: 61  GPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRL 120
           GP NPLL+ GGLSTVIAKP  GG  E LS SLG+ Q R S+PDR LIQAFK+I+ MSDRL
Sbjct: 61  GPSNPLLTDGGLSTVIAKPNGGGGGEFLSSSLGRWQNRGSNPDRALIQAFKTIATMSDRL 120

Query: 121 GLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTT 180
           GLV TIKDRANEIYK+VEDQK  RGRNQ+A++AACLYIACRQE+KPRTVKE CSVANG T
Sbjct: 121 GLVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGAT 180

Query: 181 KKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED 240
           KKEIGRAKE+IVK L  E G +VEMGTIHA D++RRFCSNL M NQAVKAAQEAVQKSE+
Sbjct: 181 KKEIGRAKEYIVKQLGLENGNAVEMGTIHAGDFMRRFCSNLCMNNQAVKAAQEAVQKSEE 240

Query: 241 LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDW 300
            DIRRSPIS+AAAVIYIITQLS+D KPLK+IS+ T VAEGTI+N YKDL+PH+++IIP+W
Sbjct: 241 FDIRRSPISIAAAVIYIITQLSDDKKPLKDISLATGVAEGTIRNSYKDLYPHVSKIIPNW 300

Query: 301 FANEEDIKNL 310
           +A EED+KNL
Sbjct: 301 YAKEEDLKNL 310




General factor that plays a major role in the activation of eukaryotic genes transcribed by RNA polymerase II.
Glycine max (taxid: 3847)
>sp|Q8W0W3|TF2B_ORYSJ Transcription initiation factor IIB OS=Oryza sativa subsp. japonica GN=TFIIB PE=1 SV=1 Back     alignment and function description
>sp|Q9SS44|TF2B2_ARATH Transcription initiation factor IIB-2 OS=Arabidopsis thaliana GN=TFIIB2 PE=2 SV=1 Back     alignment and function description
>sp|P48512|TF2B1_ARATH Transcription initiation factor IIB-1 OS=Arabidopsis thaliana GN=TFIIB1 PE=1 SV=1 Back     alignment and function description
>sp|P29052|TF2B_DROME Transcription initiation factor IIB OS=Drosophila melanogaster GN=TfIIB PE=2 SV=1 Back     alignment and function description
>sp|P29054|TF2B_XENLA Transcription initiation factor IIB OS=Xenopus laevis GN=gtf2b PE=2 SV=1 Back     alignment and function description
>sp|P62916|TF2B_RAT Transcription initiation factor IIB OS=Rattus norvegicus GN=Gtf2b PE=2 SV=1 Back     alignment and function description
>sp|P62915|TF2B_MOUSE Transcription initiation factor IIB OS=Mus musculus GN=Gtf2b PE=1 SV=1 Back     alignment and function description
>sp|Q5R886|TF2B_PONAB Transcription initiation factor IIB OS=Pongo abelii GN=GTF2B PE=2 SV=1 Back     alignment and function description
>sp|Q4R3J5|TF2B_MACFA Transcription initiation factor IIB OS=Macaca fascicularis GN=GTF2B PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
224135681311 predicted protein [Populus trichocarpa] 0.990 0.993 0.841 1e-147
351724605313 transcription initiation factor IIB [Gly 0.993 0.990 0.767 1e-142
449465789312 PREDICTED: transcription initiation fact 0.990 0.990 0.770 1e-142
255544920312 transcription initiation factor iib, put 0.990 0.990 0.770 1e-142
317106705312 JHL06B08.6 [Jatropha curcas] 0.990 0.990 0.774 1e-142
225464249312 PREDICTED: transcription initiation fact 0.990 0.990 0.774 1e-142
225441886312 PREDICTED: transcription initiation fact 0.990 0.990 0.770 1e-142
225436547314 PREDICTED: transcription initiation fact 0.993 0.987 0.771 1e-141
297829558312 transcription initiation factor IIB-2 [A 0.993 0.993 0.755 1e-141
255588003312 transcription initiation factor iib, put 0.990 0.990 0.770 1e-141
>gi|224135681|ref|XP_002322134.1| predicted protein [Populus trichocarpa] gi|222869130|gb|EEF06261.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  525 bits (1353), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/310 (84%), Positives = 285/310 (91%), Gaps = 1/310 (0%)

Query: 1   MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVG 60
           M DSYC DCKRLTE+VFDHSAGDTICSECGL+LEA+SVDETSEWR F+NESSDHDP RVG
Sbjct: 1   MEDSYCPDCKRLTEIVFDHSAGDTICSECGLILEAHSVDETSEWRTFSNESSDHDPNRVG 60

Query: 61  GPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRL 120
           GPLNPLL+ GGLST I+K T GGS ELLS SLGK Q+R ++PDRN IQAFKSI+AM+DRL
Sbjct: 61  GPLNPLLADGGLSTTISK-TNGGSNELLSCSLGKWQSRGANPDRNRIQAFKSIAAMADRL 119

Query: 121 GLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTT 180
           GLVTTIKDRANEIYKKVEDQKPL+GRNQ+AI+AACLYIACRQENK RTVKE CSV NGTT
Sbjct: 120 GLVTTIKDRANEIYKKVEDQKPLKGRNQDAILAACLYIACRQENKARTVKEICSVVNGTT 179

Query: 181 KKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED 240
           KKEIGRAKEFIVKHLE EMG S+EMGTIHA+DYLRRFCSNLGMTNQAVKAA EAVQKSE+
Sbjct: 180 KKEIGRAKEFIVKHLEVEMGHSMEMGTIHAADYLRRFCSNLGMTNQAVKAAHEAVQKSEE 239

Query: 241 LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDW 300
           LDIRRSPIS+AAAVIYII QLS+D KPLK+IS+VT+VAEGTIKN YKDL PHL++IIP W
Sbjct: 240 LDIRRSPISIAAAVIYIIIQLSDDKKPLKDISVVTQVAEGTIKNSYKDLSPHLSQIIPSW 299

Query: 301 FANEEDIKNL 310
           FA EEDIKNL
Sbjct: 300 FAKEEDIKNL 309




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|351724605|ref|NP_001238343.1| transcription initiation factor IIB [Glycine max] gi|1351222|sp|P48513.1|TF2B_SOYBN RecName: Full=Transcription initiation factor IIB; AltName: Full=General transcription factor TFIIB gi|945087|gb|AAB09756.1| transcription factor TFIIB [Glycine max] Back     alignment and taxonomy information
>gi|449465789|ref|XP_004150610.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis sativus] gi|449529834|ref|XP_004171903.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255544920|ref|XP_002513521.1| transcription initiation factor iib, putative [Ricinus communis] gi|223547429|gb|EEF48924.1| transcription initiation factor iib, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|317106705|dbj|BAJ53205.1| JHL06B08.6 [Jatropha curcas] Back     alignment and taxonomy information
>gi|225464249|ref|XP_002269045.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera] gi|296088031|emb|CBI35314.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225441886|ref|XP_002284342.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera] gi|297739630|emb|CBI29812.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225436547|ref|XP_002277679.1| PREDICTED: transcription initiation factor IIB [Vitis vinifera] gi|297734946|emb|CBI17180.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|297829558|ref|XP_002882661.1| transcription initiation factor IIB-2 [Arabidopsis lyrata subsp. lyrata] gi|297328501|gb|EFH58920.1| transcription initiation factor IIB-2 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255588003|ref|XP_002534470.1| transcription initiation factor iib, putative [Ricinus communis] gi|223525233|gb|EEF27913.1| transcription initiation factor iib, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query312
TAIR|locus:2076259312 AT3G10330 [Arabidopsis thalian 0.993 0.993 0.665 4.3e-109
TAIR|locus:2062703312 TFIIB "transcription factor II 0.990 0.990 0.629 2e-102
TAIR|locus:2093852336 pBRP2 "plant-specific TFIIB-re 0.980 0.910 0.391 7.2e-52
FB|FBgn0004915315 TfIIB "Transcription factor II 0.897 0.888 0.418 9.2e-52
ZFIN|ZDB-GENE-030131-3544316 gtf2b "general transcription f 0.926 0.914 0.399 1.3e-50
UNIPROTKB|F1NXP2306 GTF2B "Uncharacterized protein 0.926 0.944 0.392 2e-49
MGI|MGI:2385191316 Gtf2b "general transcription f 0.926 0.914 0.385 4.7e-48
RGD|619735316 Gtf2b "general transcription f 0.926 0.914 0.385 4.7e-48
UNIPROTKB|F2Z4J6316 LOC786656 "Uncharacterized pro 0.926 0.914 0.385 6e-48
UNIPROTKB|E2RPG1316 GTF2B "Uncharacterized protein 0.926 0.914 0.385 6e-48
TAIR|locus:2076259 AT3G10330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1078 (384.5 bits), Expect = 4.3e-109, P = 4.3e-109
 Identities = 207/311 (66%), Positives = 243/311 (78%)

Query:     1 MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVX 60
             M+D++C+DCKR TEVVFDHSAGDT+CSECGLVLE++S+DETSEWR FANES D+DPVRV 
Sbjct:     1 MSDAFCSDCKRHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG 60

Query:    61 XXXXXXXXXXXXXTVIAKPTAXXXXXXXXXXXXXXQARSSHPDRNLIQAFKSISAMSDRL 120
                          TVI+KP                Q R S+PDR LI AFK+I+ M+DRL
Sbjct:    61 GPTNPLLADGGLTTVISKPNGSSGDFLSSSLGRW-QNRGSNPDRGLIVAFKTIATMADRL 119

Query:   121 GLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTT 180
             GLV TIKDRANEIYK+VEDQK  RGRNQ+A++AACLYIACRQE+KPRTVKE CSVANG T
Sbjct:   120 GLVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGAT 179

Query:   181 KKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNXXXXXXXXXXXXSED 240
             KKEIGRAKE+IVK L  E GQ VEMGTIHA D++RRFCSNLGMTN            SE+
Sbjct:   180 KKEIGRAKEYIVKQLGLETGQLVEMGTIHAGDFMRRFCSNLGMTNQTVKAAQESVQKSEE 239

Query:   241 LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDW 300
              DIRRSPIS+AAAVIYIITQLS++ KPL++IS+ T VAEGTI+N YKDL+PHL++IIP W
Sbjct:   240 FDIRRSPISIAAAVIYIITQLSDEKKPLRDISVATGVAEGTIRNSYKDLYPHLSKIIPAW 299

Query:   301 FANEEDIKNLK 311
             +A EED+KNL+
Sbjct:   300 YAKEEDLKNLQ 310




GO:0003743 "translation initiation factor activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006352 "DNA-dependent transcription, initiation" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0006413 "translational initiation" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=IDA
GO:0000394 "RNA splicing, via endonucleolytic cleavage and ligation" evidence=RCA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=RCA
TAIR|locus:2062703 TFIIB "transcription factor IIB" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093852 pBRP2 "plant-specific TFIIB-related protein 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0004915 TfIIB "Transcription factor IIB" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3544 gtf2b "general transcription factor IIB" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXP2 GTF2B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2385191 Gtf2b "general transcription factor IIB" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619735 Gtf2b "general transcription factor IIB" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4J6 LOC786656 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPG1 GTF2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8W0W3TF2B_ORYSJNo assigned EC number0.76770.99030.9903yesno
Q8TT29TF2B_METACNo assigned EC number0.33550.88140.8160yesno
Q05959TF2B_KLULANo assigned EC number0.36360.91980.8039yesno
Q9SS44TF2B2_ARATHNo assigned EC number0.75240.99350.9935yesno
Q8TX21TF2B_METKANo assigned EC number0.31270.88460.8990yesno
O59151TF2B_PYRHONo assigned EC number0.31390.89420.93yesno
P58111TF2B1_SULSONo assigned EC number0.34340.88780.8964yesno
A0B5T8TF2B_METTPNo assigned EC number0.33650.89420.8278yesno
Q975S1TF2B_SULTONo assigned EC number0.33550.89100.9025yesno
P62915TF2B_MOUSENo assigned EC number0.43620.92620.9145yesno
P62916TF2B_RATNo assigned EC number0.43620.92620.9145yesno
P61998TF2B_PYRFUNo assigned EC number0.310.91340.95yesno
O28970TF2B_ARCFUNo assigned EC number0.33880.89740.8588yesno
A8AC96TF2B_IGNH4No assigned EC number0.31720.86530.8544yesno
P0CW15TF2B_METMANo assigned EC number0.33550.88140.8160yesno
P0CW14TF2B_METMZNo assigned EC number0.33550.88140.8160yesno
Q9UWN6TF2B_SULACNo assigned EC number0.33330.88780.9022yesno
Q2KIN8TF2B_BOVINNo assigned EC number0.43280.92620.9145yesno
Q54FD6TF2B_DICDINo assigned EC number0.420.90700.8707yesno
A3CSQ6TF2B_METMJNo assigned EC number0.33000.88780.8219yesno
Q5R886TF2B_PONABNo assigned EC number0.43620.92620.9145yesno
P29052TF2B_DROMENo assigned EC number0.46330.93260.9238yesno
P29055TF2B_YEASTNo assigned EC number0.34710.93580.8463yesno
A7IAR4TF2B_METB6No assigned EC number0.32240.89100.8323yesno
B8GJQ9TF2B_METPENo assigned EC number0.32570.89100.8323yesno
Q9HJM7TF2B1_THEACNo assigned EC number0.340.89420.8942yesno
Q2NEL6TF2B_METSTNo assigned EC number0.32670.90380.9067yesno
A5UKA1TF2B_METS3No assigned EC number0.34100.90060.9064yesno
O16991TF2B_CAEELNo assigned EC number0.43290.89100.9084yesno
Q5JGN1TF2B1_PYRKONo assigned EC number0.33220.88780.9233yesno
Q8SRP3TF2B_ENCCUNo assigned EC number0.40640.93260.9326yesno
O13749TF2B_SCHPONo assigned EC number0.38170.93580.8588yesno
P48512TF2B1_ARATHNo assigned EC number0.71290.99030.9903nono
P48513TF2B_SOYBNNo assigned EC number0.76770.99350.9904yesno
Q9HRE6TF2B2_HALSANo assigned EC number0.31330.87170.8369yesno
Q979Q3TF2B1_THEVONo assigned EC number0.33330.89420.8942yesno
Q00403TF2B_HUMANNo assigned EC number0.43620.92620.9145yesno
Q9V0V5TF2B_PYRABNo assigned EC number0.31740.89420.93yesno
O26971TF2B_METTHNo assigned EC number0.32340.90380.9096yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
fgenesh4_pg.C_LG_XV000426
hypothetical protein (311 aa)
(Populus trichocarpa)
Predicted Functional Partners:
GTF902
global transcription factor group (201 aa)
    0.839
GTF901
global transcription factor group (202 aa)
    0.835
estExt_Genewise1_v1.C_LG_I4990
hypothetical protein (176 aa)
    0.635
gw1.IX.2304.1
hypothetical protein (321 aa)
    0.633
gw1.IV.3113.1
hypothetical protein (690 aa)
    0.530
estExt_Genewise1_v1.C_LG_IV3101
hypothetical protein (421 aa)
     0.504
grail3.2024000101
hypothetical protein (140 aa)
       0.451
estExt_fgenesh4_pg.C_LG_XII1303
RecName- Full=Proteasome subunit alpha type; EC=3.4.25.1;; The proteasome is a multicatalytic p [...] (236 aa)
       0.441
estExt_Genewise1_v1.C_LG_XV2760
RecName- Full=Proteasome subunit alpha type; EC=3.4.25.1; (235 aa)
       0.439
gw1.I.2689.1
hypothetical protein (1334 aa)
     0.436

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
COG1405285 COG1405, SUA7, Transcription initiation factor TFI 8e-71
PRK00423310 PRK00423, tfb, transcription initiation factor IIB 3e-60
pfam0038271 pfam00382, TFIIB, Transcription factor TFIIB repea 3e-19
cd0004388 cd00043, CYCLIN, Cyclin box fold 3e-13
pfam0038271 pfam00382, TFIIB, Transcription factor TFIIB repea 1e-10
smart0038583 smart00385, CYCLIN, domain present in cyclins, TFI 3e-10
pfam0827140 pfam08271, TF_Zn_Ribbon, TFIIB zinc-binding 3e-09
smart0038583 smart00385, CYCLIN, domain present in cyclins, TFI 5e-08
cd0004388 cd00043, CYCLIN, Cyclin box fold 4e-07
COG5333297 COG5333, CCL1, Cdk activating kinase (CAK)/RNA pol 6e-06
pfam00134127 pfam00134, Cyclin_N, Cyclin, N-terminal domain 0.003
>gnl|CDD|224323 COG1405, SUA7, Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
 Score =  220 bits (563), Expect = 8e-71
 Identities = 106/299 (35%), Positives = 161/299 (53%), Gaps = 22/299 (7%)

Query: 6   CADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNP 65
           C +C   T ++ D+  G+ +C++CGLVLE   +D   EWR F          RVG PL P
Sbjct: 4   CPECGS-TNIITDYERGEIVCADCGLVLEDSLIDPGPEWRAFDERHER----RVGAPLTP 58

Query: 66  LLSGGGLSTVIAKPTAGGSTELLSGSLGKLQAR---SSHPDRNLIQAFKSISAMSDRLGL 122
            +   GLST+I     G   +     L K Q R   SS  +RNLI A + +  ++  LGL
Sbjct: 59  SIHDKGLSTII-----GWGDKDKMYRLRKWQIRIRVSSAKERNLITALEELERIASALGL 113

Query: 123 VTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKK 182
             ++++ A  IY+K  D+  LRGR+ E++ AAC+Y ACR    PRT+ E      G +KK
Sbjct: 114 PESVRETAARIYRKAVDKGLLRGRSIESVAAACIYAACRINGVPRTLDEIAKAL-GVSKK 172

Query: 183 EIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED-- 240
           EIGR    +V+ L       +++  +  SDY+ RF S LG++++  + A E V+K++   
Sbjct: 173 EIGRTYRLLVREL------KLKIPPVDPSDYIPRFASKLGLSDEVRRKAIEIVKKAKRAG 226

Query: 241 LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPD 299
           L   +SP  +AAA IY+ + L  + +  KE++ V  V E TI+N YK+L   L   +  
Sbjct: 227 LTAGKSPAGLAAAAIYLASLLLGERRTQKEVAKVAGVTEVTIRNRYKELADALDIEVTV 285


Length = 285

>gnl|CDD|234758 PRK00423, tfb, transcription initiation factor IIB; Reviewed Back     alignment and domain information
>gnl|CDD|109440 pfam00382, TFIIB, Transcription factor TFIIB repeat Back     alignment and domain information
>gnl|CDD|238003 cd00043, CYCLIN, Cyclin box fold Back     alignment and domain information
>gnl|CDD|109440 pfam00382, TFIIB, Transcription factor TFIIB repeat Back     alignment and domain information
>gnl|CDD|214641 smart00385, CYCLIN, domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>gnl|CDD|203895 pfam08271, TF_Zn_Ribbon, TFIIB zinc-binding Back     alignment and domain information
>gnl|CDD|214641 smart00385, CYCLIN, domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>gnl|CDD|238003 cd00043, CYCLIN, Cyclin box fold Back     alignment and domain information
>gnl|CDD|227640 COG5333, CCL1, Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|215740 pfam00134, Cyclin_N, Cyclin, N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 312
KOG1597308 consensus Transcription initiation factor TFIIB [T 100.0
PRK00423310 tfb transcription initiation factor IIB; Reviewed 100.0
COG1405285 SUA7 Transcription initiation factor TFIIIB, Brf1 100.0
KOG1598 521 consensus Transcription initiation factor TFIIIB, 100.0
KOG0835 367 consensus Cyclin L [General function prediction on 99.8
PF0038271 TFIIB: Transcription factor TFIIB repeat; InterPro 99.77
KOG0834323 consensus CDK9 kinase-activating protein cyclin T 99.74
PF0038271 TFIIB: Transcription factor TFIIB repeat; InterPro 99.69
TIGR00569305 ccl1 cyclin ccl1. University). 99.69
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 99.62
COG5333297 CCL1 Cdk activating kinase (CAK)/RNA polymerase II 99.54
PRK00423310 tfb transcription initiation factor IIB; Reviewed 99.53
KOG0794264 consensus CDK8 kinase-activating protein cyclin C 99.39
COG1405285 SUA7 Transcription initiation factor TFIIIB, Brf1 99.3
KOG1597308 consensus Transcription initiation factor TFIIB [T 99.28
cd0004388 CYCLIN Cyclin box fold. Protein binding domain fun 99.19
smart0038583 CYCLIN domain present in cyclins, TFIIB and Retino 99.09
cd0004388 CYCLIN Cyclin box fold. Protein binding domain fun 99.08
smart0038583 CYCLIN domain present in cyclins, TFIIB and Retino 99.07
KOG0656335 consensus G1/S-specific cyclin D [Cell cycle contr 98.98
COG5024440 Cyclin [Cell division and chromosome partitioning] 98.45
KOG2496325 consensus Cdk activating kinase (CAK)/RNA polymera 98.36
KOG0653391 consensus Cyclin B and related kinase-activating p 98.36
PF00134127 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR 98.33
KOG1598 521 consensus Transcription initiation factor TFIIIB, 98.21
PF02984118 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR 98.1
KOG4557262 consensus Origin recognition complex, subunit 6 [R 98.08
PF01857135 RB_B: Retinoblastoma-associated protein B domain; 97.77
KOG0655408 consensus G1/S-specific cyclin E [Cell cycle contr 97.53
PF1178136 RRN7: RNA polymerase I-specific transcription init 97.29
PHA0062659 hypothetical protein 96.77
PF0879233 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I 96.75
KOG0835367 consensus Cyclin L [General function prediction on 96.74
PRK0041559 rps27e 30S ribosomal protein S27e; Reviewed 96.73
COG205167 RPS27A Ribosomal protein S27E [Translation, riboso 96.67
PF1480334 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. 96.64
PF02984118 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR 96.48
PF0166755 Ribosomal_S27e: Ribosomal protein S27; InterPro: I 96.47
PF1324826 zf-ribbon_3: zinc-ribbon domain 96.11
smart0077837 Prim_Zn_Ribbon Zinc-binding domain of primase-heli 96.07
PLN0020986 ribosomal protein S27; Provisional 96.03
PF01857135 RB_B: Retinoblastoma-associated protein B domain; 95.99
PRK00420112 hypothetical protein; Validated 95.98
PF0215035 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I 95.92
PTZ0008385 40S ribosomal protein S27; Provisional 95.92
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 95.87
PF1324023 zinc_ribbon_2: zinc-ribbon domain 95.8
PF00134127 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR 95.75
PF0827430 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 95.71
PRK10220111 hypothetical protein; Provisional 95.68
TIGR0120654 lysW lysine biosynthesis protein LysW. This very s 95.49
PRK0043250 30S ribosomal protein S27ae; Validated 95.36
KOG0834 323 consensus CDK9 kinase-activating protein cyclin T 95.2
PRK1182760 hypothetical protein; Provisional 95.18
TIGR00569 305 ccl1 cyclin ccl1. University). 95.01
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 94.9
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 94.87
PF08613149 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eu 94.82
COG283560 Uncharacterized conserved protein [Function unknow 94.71
KOG0654359 consensus G2/Mitotic-specific cyclin A [Cell cycle 94.66
COG2824112 PhnA Uncharacterized Zn-ribbon-containing protein 94.6
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 94.52
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 94.45
PF0827340 Prim_Zn_Ribbon: Zinc-binding domain of primase-hel 94.43
COG199851 RPS31 Ribosomal protein S27AE [Translation, riboso 94.29
COG1645131 Uncharacterized Zn-finger containing protein [Gene 94.29
PF0396668 Trm112p: Trm112p-like protein; InterPro: IPR005651 94.25
smart0066152 RPOL9 RNA polymerase subunit 9. 94.1
PF1435461 Lar_restr_allev: Restriction alleviation protein L 94.06
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 93.98
TIGR02393238 RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter 93.95
PRK00464154 nrdR transcriptional regulator NrdR; Validated 93.87
KOG4164497 consensus Cyclin ik3-1/CABLES [Cell cycle control, 93.58
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 93.46
TIGR0365553 anti_R_Lar restriction alleviation protein, Lar fa 93.05
PRK07408256 RNA polymerase sigma factor SigF; Reviewed 93.04
TIGR00686109 phnA alkylphosphonate utilization operon protein P 92.84
PF0929732 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do 92.79
COG1594113 RPB9 DNA-directed RNA polymerase, subunit M/Transc 92.73
PF0667741 Auto_anti-p27: Sjogren's syndrome/scleroderma auto 92.71
TIGR00244147 transcriptional regulator NrdR. Members of this al 92.58
PF1276046 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int 92.49
PRK1489299 putative transcription elongation factor Elf1; Pro 92.45
PF1371937 zinc_ribbon_5: zinc-ribbon domain 92.25
PF1373055 HTH_36: Helix-turn-helix domain 92.16
PF1361353 HTH_Tnp_4: Helix-turn-helix of DDE superfamily end 92.01
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 91.92
PF09862113 DUF2089: Protein of unknown function (DUF2089); In 91.85
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 91.84
PF08613149 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eu 91.7
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 91.58
KOG177984 consensus 40s ribosomal protein S27 [Translation, 91.49
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 91.35
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 91.3
KOG4557262 consensus Origin recognition complex, subunit 6 [R 91.13
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 91.07
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 90.9
PRK05657325 RNA polymerase sigma factor RpoS; Validated 90.85
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 90.85
PRK09210367 RNA polymerase sigma factor RpoD; Validated 90.8
PF0728269 OrfB_Zn_ribbon: Putative transposase DNA-binding d 90.59
PRK12495226 hypothetical protein; Provisional 90.54
PF1393644 HTH_38: Helix-turn-helix domain; PDB: 2W48_A. 90.5
PF0109639 TFIIS_C: Transcription factor S-II (TFIIS); InterP 90.22
TIGR01384104 TFS_arch transcription factor S, archaeal. There h 90.13
KOG1010920 consensus Rb (Retinoblastoma tumor suppressor)-rel 90.09
PF1338450 HTH_23: Homeodomain-like domain; PDB: 2X48_C. 89.61
smart0044040 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo 89.6
PTZ0025590 60S ribosomal protein L37a; Provisional 89.38
COG347868 Predicted nucleic-acid-binding protein containing 89.36
TIGR02394285 rpoS_proteo RNA polymerase sigma factor RpoS. A si 89.25
PF1066860 Phage_terminase: Phage terminase small subunit; In 89.17
PF0512981 Elf1: Transcription elongation factor Elf1 like; I 89.01
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 88.84
PF0035646 LacI: Bacterial regulatory proteins, lacI family; 88.72
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 88.61
PRK00135188 scpB segregation and condensation protein B; Revie 88.49
COG5333 297 CCL1 Cdk activating kinase (CAK)/RNA polymerase II 88.43
PRK1228657 rpmF 50S ribosomal protein L32; Reviewed 88.4
PF05460 353 ORC6: Origin recognition complex subunit 6 (ORC6); 88.35
PF0019658 GerE: Bacterial regulatory proteins, luxR family; 88.25
PF0311928 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f 88.13
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 88.01
PRK05901509 RNA polymerase sigma factor; Provisional 87.98
cd0009267 HTH_CRP helix_turn_helix, cAMP Regulatory protein 87.95
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo 87.94
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 87.9
COG5349126 Uncharacterized protein conserved in bacteria [Fun 87.88
PF0360432 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa 87.88
PF0137187 Trp_repressor: Trp repressor protein; InterPro: IP 87.85
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 87.8
PRK05978148 hypothetical protein; Provisional 87.77
PRK11169164 leucine-responsive transcriptional regulator; Prov 87.7
PF0279645 HTH_7: Helix-turn-helix domain of resolvase; Inter 87.59
PRK07406373 RNA polymerase sigma factor RpoD; Validated 87.51
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 87.39
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 87.21
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 87.19
COG4640 465 Predicted membrane protein [Function unknown] 87.19
PF0102247 HTH_5: Bacterial regulatory protein, arsR family; 87.02
PRK0967872 DNA-binding transcriptional regulator; Provisional 87.01
PRK07405317 RNA polymerase sigma factor SigD; Validated 86.87
smart0034560 HTH_GNTR helix_turn_helix gluconate operon transcr 86.84
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 86.81
TIGR0387973 near_KaiC_dom probable regulatory domain. This mod 86.73
COG1725125 Predicted transcriptional regulators [Transcriptio 86.71
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 86.7
COG406864 Uncharacterized protein containing a Zn-ribbon [Fu 86.46
PF0178356 Ribosomal_L32p: Ribosomal L32p protein family; Int 86.37
PHA0259183 hypothetical protein; Provisional 86.34
PRK05911257 RNA polymerase sigma factor sigma-28; Reviewed 86.33
PRK08402355 replication factor A; Reviewed 86.18
PF1277350 DZR: Double zinc ribbon 86.09
cd0657190 Bac_DnaA_C C-terminal domain of bacterial DnaA pro 86.06
PF0828154 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 86.01
PF0985564 DUF2082: Nucleic-acid-binding protein containing Z 86.01
PF1354252 HTH_Tnp_ISL3: Helix-turn-helix domain of transposa 86.01
PF1371736 zinc_ribbon_4: zinc-ribbon domain 85.93
KOG2496 325 consensus Cdk activating kinase (CAK)/RNA polymera 85.57
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 85.49
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR- 85.27
TIGR0103155 rpmF_bact ribosomal protein L32. This protein desc 85.06
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 84.94
PF1425552 Cys_rich_CPXG: Cysteine-rich CPXCG 84.57
PRK0971064 lar restriction alleviation and modification prote 84.54
PRK06266178 transcription initiation factor E subunit alpha; V 84.49
TIGR0244359 conserved hypothetical metal-binding protein. Memb 84.46
KOG2906105 consensus RNA polymerase III subunit C11 [Transcri 84.36
PF0032532 Crp: Bacterial regulatory proteins, crp family; In 84.0
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 83.95
PF04161208 Arv1: Arv1-like family ; InterPro: IPR007290 Arv1 83.94
PF08646146 Rep_fac-A_C: Replication factor-A C terminal domai 83.92
smart0034284 HTH_ARAC helix_turn_helix, arabinose operon contro 83.88
PRK04217110 hypothetical protein; Provisional 83.71
TIGR0132194 TrpR trp operon repressor, proteobacterial. This m 83.51
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 83.32
PF0039264 GntR: Bacterial regulatory proteins, gntR family; 83.11
TIGR0161095 phage_O_Nterm phage replication protein O, N-termi 83.06
PF0972342 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 82.98
COG199649 RPC10 DNA-directed RNA polymerase, subunit RPC10 ( 82.94
TIGR0012269 birA_repr_reg BirA biotin operon repressor domain. 82.88
PF0828059 HTH_Mga: M protein trans-acting positive regulator 82.74
PF1012251 Mu-like_Com: Mu-like prophage protein Com; InterPr 82.73
PRK02935110 hypothetical protein; Provisional 82.68
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 82.26
COG1326201 Uncharacterized archaeal Zn-finger protein [Genera 82.11
PF1412287 YokU: YokU-like protein 82.08
COG1522154 Lrp Transcriptional regulators [Transcription] 82.0
PRK05949327 RNA polymerase sigma factor; Validated 81.93
COG1327156 Predicted transcriptional regulator, consists of a 81.49
PF0204252 RWP-RK: RWP-RK domain; InterPro: IPR003035 This do 81.27
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 81.23
PHA02942383 putative transposase; Provisional 81.07
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 81.05
TIGR02479224 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f 80.96
COG1191247 FliA DNA-directed RNA polymerase specialized sigma 80.95
PF1277350 DZR: Double zinc ribbon 80.93
PRK11337 292 DNA-binding transcriptional repressor RpiR; Provis 80.93
TIGR02395429 rpoN_sigma RNA polymerase sigma-54 factor. A sigma 80.56
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 80.37
PF1005854 DUF2296: Predicted integral membrane metal-binding 80.13
PRK1313056 H/ACA RNA-protein complex component Nop10p; Review 80.09
PF0522545 HTH_psq: helix-turn-helix, Psq domain; InterPro: I 80.02
>KOG1597 consensus Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
Probab=100.00  E-value=4.6e-76  Score=507.69  Aligned_cols=301  Identities=58%  Similarity=0.902  Sum_probs=281.3

Q ss_pred             CCCCCCCCCCc-eeeeCCCCceEcCCCcccccCcccccccccccccCCCCCCCCCccCCCCCCcccCCCcceEEecCCCC
Q 021438            4 SYCADCKRLTE-VVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNPLLSGGGLSTVIAKPTAG   82 (312)
Q Consensus         4 ~~Cp~Cg~~~~-ii~D~~~G~~vC~~CG~Vv~e~~id~~~ewr~f~~~~~~~~~~r~G~~~~~~~~~~~~~t~i~~~~~~   82 (312)
                      +.||+|+..+. +++|+.+|++||..||+|+++++||.++|||+|++|+++.||+|||++.||++.++++.|+|+++. +
T Consensus         1 ~~c~~C~~~~~~~V~d~~~gdtvC~~CGlVl~~r~Id~~sEwrtfsnd~~~~DPsrvG~~sNPlL~~g~L~T~I~~g~-g   79 (308)
T KOG1597|consen    1 MTCPDCKRHPENLVEDHSAGDTVCSECGLVLEDRIIDEGSEWRTFSNDDSDADPSRVGASSNPLLDGGDLSTFISKGT-G   79 (308)
T ss_pred             CCCCCCCCCCCCeeeeccCCceecccCCeeeccccccccccccccccCCCCCCccccCCCCCCCCCCCCcceeeecCC-C
Confidence            47999998665 999999999999999999999999999999999999989999999999999999999999999987 4


Q ss_pred             CCcccccccchhcccc--CCcchhhHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHH
Q 021438           83 GSTELLSGSLGKLQAR--SSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIAC  160 (312)
Q Consensus        83 ~~~~~~~~~l~~~~~~--~~~~e~~l~~~~~~I~~~~~~L~Lp~~v~~~A~~i~~~~~~~~~~~gr~~~~iaaAcly~ac  160 (312)
                      .++.+++ .|.+||++  +++.|+.+..+|..|..||+.++||..+.+.|.++|+++.+.+.++||+.++++|||||+||
T Consensus        80 ~~s~~~s-~l~~~Q~~~sm~~~d~~~~~a~~~I~~m~d~~~Lp~~I~d~A~~ifk~v~~~k~lrGks~eai~AAclyiAC  158 (308)
T KOG1597|consen   80 TSSSFAS-SLGKAQNRNSMSNSDRVLKAAFKEITAMCDRLSLPATIKDRANEIFKLVEDSKLLRGKSVEALAAACLYIAC  158 (308)
T ss_pred             CCHHHHH-HHHHHhcccccCCccHHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHHHhhhhcCccHHHHHHHHHHHHH
Confidence            4444443 38899985  56889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhCCCCCHHHHHHHhcCCCHHHHHHHHHHHHHHHhhhhccccccCCCCHHHHHHHHHhhcCCCHHHHHHHHHHHHHhhh
Q 021438          161 RQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED  240 (312)
Q Consensus       161 r~~~~p~tl~dia~~~~~v~~~~i~~~~~~l~~~l~~~~~~~~~~~~~~p~~~i~r~~~~L~l~~~v~~~A~~i~~~~~~  240 (312)
                      |+++.|||++||+.++ +++.++|++.++.|.+.|+..    .+....+..+||+|||+.|+|+.+++..|.++++.+.+
T Consensus       159 Rq~~~pRT~kEI~~~a-nv~kKEIgr~~K~i~~~l~~s----~~~~s~~t~~~m~RFCs~L~L~~~~q~aA~e~a~ka~~  233 (308)
T KOG1597|consen  159 RQEDVPRTFKEISAVA-NVSKKEIGRCVKLIGEALETS----VDLISISTGDFMPRFCSNLGLPKSAQEAATEIAEKAEE  233 (308)
T ss_pred             HhcCCCchHHHHHHHH-cCCHHHHHHHHHHHHHHHhcc----chhhhhhHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHH
Confidence            9999999999999999 699999999999999998862    23335568999999999999999999999999999998


Q ss_pred             --ccCCCChHHHHHHHHHHHHHhcCCCCCHHHHHHHhCcchhHHHHHHHHHHhhhcccCCccccccccccccC
Q 021438          241 --LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDIKNLK  311 (312)
Q Consensus       241 --l~~Gr~P~~iaaAaiyla~~~~~~~~~~~~Ia~~~~vs~~ti~~~~kel~~~~~~~~p~~~~~~~~~~~l~  311 (312)
                        +..||+|.+||||+|||+++++..+++++||..++||+++|||+.||+||+++..|+|.||.+++++|+||
T Consensus       234 ~~~~~gRsPiSIAAa~IYmisqls~~kkt~keI~~vtgVaE~TIr~sYK~Lyp~~~~liP~~~a~~~~lk~Lp  306 (308)
T KOG1597|consen  234 MDIRAGRSPISIAAAAIYMISQLSDEKKTQKEIGEVTGVAEVTIRNSYKDLYPHADKLIPSWYANAVPLKNLP  306 (308)
T ss_pred             hccccCCCchhHHHHHHHHHHHhccCcccHHHHHHHhhhhHHHHHHHHHHHhhchhhhChhhhccccchhhcC
Confidence              67899999999999999999999999999999999999999999999999999999999999999999998



>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription] Back     alignment and domain information
>KOG0835 consensus Cyclin L [General function prediction only] Back     alignment and domain information
>PF00382 TFIIB: Transcription factor TFIIB repeat; InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>KOG0834 consensus CDK9 kinase-activating protein cyclin T [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00382 TFIIB: Transcription factor TFIIB repeat; InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>TIGR00569 ccl1 cyclin ccl1 Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5333 CCL1 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00423 tfb transcription initiation factor IIB; Reviewed Back     alignment and domain information
>KOG0794 consensus CDK8 kinase-activating protein cyclin C [Transcription] Back     alignment and domain information
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>KOG1597 consensus Transcription initiation factor TFIIB [Transcription] Back     alignment and domain information
>cd00043 CYCLIN Cyclin box fold Back     alignment and domain information
>smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>cd00043 CYCLIN Cyclin box fold Back     alignment and domain information
>smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma Back     alignment and domain information
>KOG0656 consensus G1/S-specific cyclin D [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5024 Cyclin [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2496 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0653 consensus Cyclin B and related kinase-activating proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF00134 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription] Back     alignment and domain information
>PF02984 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR004367 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>KOG4557 consensus Origin recognition complex, subunit 6 [Replication, recombination and repair] Back     alignment and domain information
>PF01857 RB_B: Retinoblastoma-associated protein B domain; InterPro: IPR002719 Retinoblastoma-like and retinoblastoma-associated proteins may have a function in cell cycle regulation Back     alignment and domain information
>KOG0655 consensus G1/S-specific cyclin E [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] Back     alignment and domain information
>KOG0835 consensus Cyclin L [General function prediction only] Back     alignment and domain information
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed Back     alignment and domain information
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C Back     alignment and domain information
>PF02984 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR004367 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase Back     alignment and domain information
>PLN00209 ribosomal protein S27; Provisional Back     alignment and domain information
>PF01857 RB_B: Retinoblastoma-associated protein B domain; InterPro: IPR002719 Retinoblastoma-like and retinoblastoma-associated proteins may have a function in cell cycle regulation Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 Back     alignment and domain information
>PTZ00083 40S ribosomal protein S27; Provisional Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF00134 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues Back     alignment and domain information
>PRK10220 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01206 lysW lysine biosynthesis protein LysW Back     alignment and domain information
>PRK00432 30S ribosomal protein S27ae; Validated Back     alignment and domain information
>KOG0834 consensus CDK9 kinase-activating protein cyclin T [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK11827 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00569 ccl1 cyclin ccl1 Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF08613 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>COG2835 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0654 consensus G2/Mitotic-specific cyclin A [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 Back     alignment and domain information
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] Back     alignment and domain information
>PF03966 Trm112p: Trm112p-like protein; InterPro: IPR005651 This family of short proteins have no known function Back     alignment and domain information
>smart00661 RPOL9 RNA polymerase subunit 9 Back     alignment and domain information
>PF14354 Lar_restr_allev: Restriction alleviation protein Lar Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>KOG4164 consensus Cyclin ik3-1/CABLES [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family Back     alignment and domain information
>PRK07408 RNA polymerase sigma factor SigF; Reviewed Back     alignment and domain information
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA Back     alignment and domain information
>PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains Back     alignment and domain information
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] Back     alignment and domain information
>PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) Back     alignment and domain information
>TIGR00244 transcriptional regulator NrdR Back     alignment and domain information
>PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc Back     alignment and domain information
>PRK14892 putative transcription elongation factor Elf1; Provisional Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF08613 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>KOG1779 consensus 40s ribosomal protein S27 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>KOG4557 consensus Origin recognition complex, subunit 6 [Replication, recombination and repair] Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK05657 RNA polymerase sigma factor RpoS; Validated Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>PRK09210 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins Back     alignment and domain information
>PRK12495 hypothetical protein; Provisional Back     alignment and domain information
>PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A Back     alignment and domain information
>PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR01384 TFS_arch transcription factor S, archaeal Back     alignment and domain information
>KOG1010 consensus Rb (Retinoblastoma tumor suppressor)-related protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C Back     alignment and domain information
>smart00440 ZnF_C2C2 C2C2 Zinc finger Back     alignment and domain information
>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only] Back     alignment and domain information
>TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information
>PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PRK00135 scpB segregation and condensation protein B; Reviewed Back     alignment and domain information
>COG5333 CCL1 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed Back     alignment and domain information
>PF05460 ORC6: Origin recognition complex subunit 6 (ORC6); InterPro: IPR008721 The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 [] Back     alignment and domain information
>PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators Back     alignment and domain information
>PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PRK05901 RNA polymerase sigma factor; Provisional Back     alignment and domain information
>cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates Back     alignment and domain information
>PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>PRK05978 hypothetical protein; Provisional Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms Back     alignment and domain information
>PRK07406 RNA polymerase sigma factor RpoD; Validated Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>COG4640 Predicted membrane protein [Function unknown] Back     alignment and domain information
>PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK07405 RNA polymerase sigma factor SigD; Validated Back     alignment and domain information
>smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>TIGR03879 near_KaiC_dom probable regulatory domain Back     alignment and domain information
>COG1725 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown] Back     alignment and domain information
>PF01783 Ribosomal_L32p: Ribosomal L32p protein family; InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PHA02591 hypothetical protein; Provisional Back     alignment and domain information
>PRK05911 RNA polymerase sigma factor sigma-28; Reviewed Back     alignment and domain information
>PRK08402 replication factor A; Reviewed Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins Back     alignment and domain information
>PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins Back     alignment and domain information
>PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG2496 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>TIGR01031 rpmF_bact ribosomal protein L32 Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG Back     alignment and domain information
>PRK09710 lar restriction alleviation and modification protein; Reviewed Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>TIGR02443 conserved hypothetical metal-binding protein Back     alignment and domain information
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription] Back     alignment and domain information
>PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PF04161 Arv1: Arv1-like family ; InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis Back     alignment and domain information
>PF08646 Rep_fac-A_C: Replication factor-A C terminal domain; InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing Back     alignment and domain information
>smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein Back     alignment and domain information
>PRK04217 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01321 TrpR trp operon repressor, proteobacterial Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain Back     alignment and domain information
>PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria Back     alignment and domain information
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] Back     alignment and domain information
>TIGR00122 birA_repr_reg BirA biotin operon repressor domain Back     alignment and domain information
>PF08280 HTH_Mga: M protein trans-acting positive regulator (MGA) HTH domain; InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] Back     alignment and domain information
>PF10122 Mu-like_Com: Mu-like prophage protein Com; InterPro: IPR019294 Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ] Back     alignment and domain information
>PRK02935 hypothetical protein; Provisional Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14122 YokU: YokU-like protein Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK05949 RNA polymerase sigma factor; Validated Back     alignment and domain information
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] Back     alignment and domain information
>PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PHA02942 putative transposase; Provisional Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family Back     alignment and domain information
>COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>TIGR02395 rpoN_sigma RNA polymerase sigma-54 factor Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>PF10058 DUF2296: Predicted integral membrane metal-binding protein (DUF2296); InterPro: IPR019273 This domain, found mainly in the eukaryotic lunapark proteins, has no known function [] Back     alignment and domain information
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed Back     alignment and domain information
>PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
1c9b_A207 Crystal Structure Of A Human Tbp Core Domain-Human 5e-38
2phg_A206 Model For Vp16 Binding To Tfiib Length = 206 2e-37
1tfb_A208 Nmr Studies Of Human General Transcription Factor T 3e-37
1vol_A204 Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEME 3e-35
3k7a_M345 Crystal Structure Of An Rna Polymerase Ii-Tfiib Com 2e-26
1d3u_B201 Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BBRE+T 1e-19
1ais_B200 Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BTATA- 1e-19
1rly_A60 Rdc-Derived Models Of The Zinc Ribbon Domain Of Hum 9e-05
1dl6_A58 Solution Structure Of Human Tfiib N-Terminal Domain 1e-04
3k1f_M197 Crystal Structure Of Rna Polymerase Ii In Complex W 2e-04
>pdb|1C9B|A Chain A, Crystal Structure Of A Human Tbp Core Domain-Human Tfiib Core Domain Complex Bound To An Extended, Modified Adenoviral Major Late Promoter (Admlp) Length = 207 Back     alignment and structure

Iteration: 1

Score = 154 bits (390), Expect = 5e-38, Method: Compositional matrix adjust. Identities = 87/210 (41%), Positives = 125/210 (59%), Gaps = 9/210 (4%) Query: 103 DRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQ 162 DR ++ AFK I+ M+DR+ L I DR N ++K+V +QK L+GR +AI +ACLYIACRQ Sbjct: 2 DRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQ 61 Query: 163 ENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLG 222 E PRT KE C+V+ +KKEIGR + I+K LE SV++ I D++ RFCSNL Sbjct: 62 EGVPRTFKEICAVSR-ISKKEIGRCFKLILKALET----SVDL--ITTGDFMSRFCSNLC 114 Query: 223 MTNXXXXXXXXXXXXSEDLDI--RRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEG 280 + + +LD+ RSPISVAAA IY+ +Q S + + KEI + VA+ Sbjct: 115 LPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADV 174 Query: 281 TIKNVYKDLFPHLARIIPDWFANEEDIKNL 310 TI+ Y+ ++P + P F + + L Sbjct: 175 TIRQSYRLIYPRAPDLFPTDFKFDTPVDKL 204
>pdb|2PHG|A Chain A, Model For Vp16 Binding To Tfiib Length = 206 Back     alignment and structure
>pdb|1TFB|A Chain A, Nmr Studies Of Human General Transcription Factor Tfiib: Dynamics And Interaction With Vp16 Activation Domain, 20 Structures Length = 208 Back     alignment and structure
>pdb|1VOL|A Chain A, Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEMENT Ternary Complex Length = 204 Back     alignment and structure
>pdb|3K7A|M Chain M, Crystal Structure Of An Rna Polymerase Ii-Tfiib Complex Length = 345 Back     alignment and structure
>pdb|1D3U|B Chain B, Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BBRE+TATA- Box Complex From Pyrococcus Woesei Length = 201 Back     alignment and structure
>pdb|1AIS|B Chain B, Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BTATA-Box Complex From Pyrococcus Woesei Length = 200 Back     alignment and structure
>pdb|1RLY|A Chain A, Rdc-Derived Models Of The Zinc Ribbon Domain Of Human General Transcription Tfiib (Zinc Bound Structures) Length = 60 Back     alignment and structure
>pdb|1DL6|A Chain A, Solution Structure Of Human Tfiib N-Terminal Domain Length = 58 Back     alignment and structure
>pdb|3K1F|M Chain M, Crystal Structure Of Rna Polymerase Ii In Complex With Tfiib Length = 197 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query312
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 5e-73
1c9b_A207 General transcription factor IIB; protein-DNA comp 1e-58
1ais_B200 TFB TFIIB, protein (transcription initiation facto 4e-55
1ais_B200 TFB TFIIB, protein (transcription initiation facto 7e-11
1ais_B200 TFB TFIIB, protein (transcription initiation facto 8e-06
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 8e-24
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 9e-13
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 6e-12
1zp2_A235 RNA polymerase II holoenzyme cyclin-like subunit; 6e-07
2i53_A258 Cyclin K; cell cycle, transcription, cyclin BOX, C 9e-07
2ivx_A257 Cyclin-T2; transcription regulation, cell division 2e-06
2b9r_A269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 2e-05
2pk2_A358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 4e-05
2cch_B260 Cyclin A2, cyclin-A; complex(transferase/cell divi 8e-05
3g33_B306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 8e-04
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Length = 345 Back     alignment and structure
 Score =  227 bits (580), Expect = 5e-73
 Identities = 98/317 (30%), Positives = 148/317 (46%), Gaps = 13/317 (4%)

Query: 6   CADCKRL-TEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANE-SSDHDPVRVGGPL 63
           C +CK    ++V   S GD +C+ CGLVL    VD  SEWR F+N+  +  DP RVG   
Sbjct: 24  CPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEAS 83

Query: 64  NPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRLGLV 123
           NPLL G  LST I K            +  + +      D  +  AF  I+ + D   L 
Sbjct: 84  NPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELP 143

Query: 124 TTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKE 183
             +KD A E YK   D+K L+G++ E+I+AA + I CR+    RT KE  S+ +    KE
Sbjct: 144 KIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIH-VKTKE 202

Query: 184 IGRAKEFIVKHLE------AEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQK 237
            G+    +   L            +  M       Y+ RFCS+LG+  Q   +A+   +K
Sbjct: 203 FGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKK 262

Query: 238 SEDLDI--RRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLAR 295
            +++     +SPI++A   IY+   L        ++    +V EGTIK+ YK L+ H  +
Sbjct: 263 CKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIKSGYKILYEHRDK 322

Query: 296 IIPDWFANEE--DIKNL 310
           ++           + NL
Sbjct: 323 LVDPQLIANGVVSLDNL 339


>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Length = 207 Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Length = 58 Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Length = 50 Back     alignment and structure
>1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Length = 235 Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Length = 258 Back     alignment and structure
>2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Length = 257 Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Length = 269 Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Length = 358 Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Length = 260 Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 306 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
4bbr_M345 Transcription initiation factor IIB; RNA polymeras 100.0
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 100.0
1c9b_A207 General transcription factor IIB; protein-DNA comp 100.0
1ais_B200 TFB TFIIB, protein (transcription initiation facto 100.0
1zp2_A235 RNA polymerase II holoenzyme cyclin-like subunit; 99.94
2ivx_A257 Cyclin-T2; transcription regulation, cell division 99.92
2i53_A258 Cyclin K; cell cycle, transcription, cyclin BOX, C 99.92
2b9r_A269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 99.91
3rgf_B285 Cyclin-C; protein kinase complex, transferase,tran 99.9
2cch_B260 Cyclin A2, cyclin-A; complex(transferase/cell divi 99.89
2w96_A271 G1/S-specific cyclin-D1; serine/threonine-protein 99.88
2pk2_A358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 99.88
1jkw_A323 Cyclin H; cell cycle, cell division, nuclear prote 99.85
1g3n_C257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 99.85
2f2c_A254 Cyclin homolog, V-cyclin; small molecule inhibitor 99.84
1w98_B283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 99.81
3g33_B306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 99.79
3k1f_M197 Transcription initiation factor IIB; RNA polymeras 99.79
1dl6_A58 Transcription factor II B (TFIIB); zinc ribbon, ge 99.73
1pft_A50 TFIIB, PFTFIIBN; N-terminal domain, transcription 99.58
1f5q_B252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 99.52
1ais_B200 TFB TFIIB, protein (transcription initiation facto 99.51
1c9b_A207 General transcription factor IIB; protein-DNA comp 99.32
4bbr_M 345 Transcription initiation factor IIB; RNA polymeras 99.0
3k7a_M345 Transcription initiation factor IIB; RNA polymeras 98.89
1zp2_A235 RNA polymerase II holoenzyme cyclin-like subunit; 98.1
3h4c_A260 Transcription factor TFIIB-like; cyclin, transcrip 97.81
2cch_B260 Cyclin A2, cyclin-A; complex(transferase/cell divi 97.56
2b9r_A269 Human cyclin B1; cell cycle; 2.90A {Homo sapiens} 97.53
2i53_A258 Cyclin K; cell cycle, transcription, cyclin BOX, C 97.52
3rgf_B285 Cyclin-C; protein kinase complex, transferase,tran 97.48
2ivx_A 257 Cyclin-T2; transcription regulation, cell division 97.46
1jkw_A 323 Cyclin H; cell cycle, cell division, nuclear prote 97.44
3m03_A95 ORC6, origin recognition complex subunit 6; helix 97.28
2pk2_A 358 Cyclin-T1, protein TAT; TAR, twinning, transcripti 97.14
2f2c_A254 Cyclin homolog, V-cyclin; small molecule inhibitor 97.0
2w96_A 271 G1/S-specific cyclin-D1; serine/threonine-protein 96.98
1g3n_C257 V-cyclin; cyclin-dependent kinase, INK4 inhibitor, 96.89
2js4_A70 UPF0434 protein BB2007; NESG, northeast structural 96.87
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 96.8
2jny_A67 Uncharacterized BCR; structure, CGR1, NESG, struct 96.77
2pk7_A69 Uncharacterized protein; NESG, PLR1, putative tetr 96.65
1qxf_A66 GR2, 30S ribosomal protein S27E; structural genomi 96.64
2hf1_A68 Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A 96.6
1w98_B 283 Cyclin E, G1/S-specific cyclin E1; cell cycle, tra 96.55
3j20_W63 30S ribosomal protein S27E; archaea, archaeal, KIN 96.54
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 96.48
2xzm_681 RPS27E; ribosome, translation; 3.93A {Tetrahymena 96.21
2r7g_A347 PP110, retinoblastoma-associated protein, P105-RB, 96.13
3u5c_b82 RP61, YS20, 40S ribosomal protein S27-A; translati 96.12
3g33_B306 CCND3 protein; Ser/Thr protein kinase, cell cycle, 96.12
4ell_A411 Retinoblastoma-associated protein; cyclin fold, tu 96.12
2akl_A138 PHNA-like protein PA0128; two domains, Zn binding 95.94
3iz6_X86 40S ribosomal protein S27 (S27E); eukaryotic ribos 95.87
2qdj_A304 Retinoblastoma-associated protein; cyclin fold, cy 95.82
3m03_A95 ORC6, origin recognition complex subunit 6; helix 95.74
3j20_Y50 30S ribosomal protein S27AE; archaea, archaeal, KI 95.64
4elj_A656 Retinoblastoma-associated protein; cyclin fold, tu 95.53
2k4x_A55 30S ribosomal protein S27AE; metal-binding, ribonu 95.11
2kpi_A56 Uncharacterized protein SCO3027; zinc finger, PSI- 94.39
2r7g_A347 PP110, retinoblastoma-associated protein, P105-RB, 93.42
4elj_A 656 Retinoblastoma-associated protein; cyclin fold, tu 93.22
2k5r_A97 Uncharacterized protein XF2673; solution structure 93.03
1twf_I122 B12.6, DNA-directed RNA polymerase II 14.2 kDa pol 93.0
2pmi_B293 PHO85 cyclin PHO80, aminoglycoside anti; cyclin-de 92.9
2jt1_A77 PEFI protein; solution structure, winged helix-tur 92.34
1k81_A36 EIF-2-beta, probable translation initiation factor 92.26
3h0g_I113 DNA-directed RNA polymerases I, II, and III subuni 92.26
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 91.59
1nui_A255 DNA primase/helicase; zinc-biding domain, toprim f 91.53
2jpc_A61 SSRB; DNA binding protein, structural genomics, PS 91.16
1qyp_A57 RNA polymerase II; transcription, RPB9, Zn ribbon, 90.92
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 90.68
1twf_L70 ABC10-alpha, DNA-directed RNA polymerases I, II, a 90.58
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 90.45
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 90.42
3h4c_A 260 Transcription factor TFIIB-like; cyclin, transcrip 90.3
1jhg_A101 Trp operon repressor; complex (regulatory protein- 90.06
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 90.05
1t6s_A162 Conserved hypothetical protein; A winged helix-tur 90.0
2w7n_A101 TRFB transcriptional repressor protein; INCP, plas 89.91
1je8_A82 Nitrate/nitrite response regulator protein NARL; p 89.86
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 89.85
2p7v_B68 Sigma-70, RNA polymerase sigma factor RPOD; RSD, r 89.84
2lnb_A80 Z-DNA-binding protein 1; structural genomics, nort 89.79
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 89.79
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 89.78
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 89.47
3ulq_B90 Transcriptional regulatory protein COMA; tetratric 89.16
1fse_A74 GERE; helix-turn-helix DNA-binding protein transcr 89.03
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 88.91
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 88.63
1f5q_B252 Gamma herpesvirus cyclin; herpesviral cyclin, cycl 88.58
2o8x_A70 Probable RNA polymerase sigma-C factor; promoter r 88.44
2qdj_A 304 Retinoblastoma-associated protein; cyclin fold, cy 88.22
1x3u_A79 Transcriptional regulatory protein FIXJ; helix-tur 87.97
3qt1_I133 DNA-directed RNA polymerases I, II, and III subun; 87.68
3u50_C172 Telomerase-associated protein 82; TEB1, processivi 87.61
1wii_A85 Hypothetical UPF0222 protein MGC4549; domain of un 87.4
4ell_A411 Retinoblastoma-associated protein; cyclin fold, tu 87.19
1tty_A87 Sigma-A, RNA polymerase sigma factor RPOD; helix-t 87.19
3hug_A92 RNA polymerase sigma factor; ECF sigma factor, zin 87.18
2pmi_B 293 PHO85 cyclin PHO80, aminoglycoside anti; cyclin-de 87.14
1ku3_A73 Sigma factor SIGA; helix-turn-helix, transcription 87.05
3c57_A95 Two component transcriptional regulatory protein; 86.74
2rnj_A91 Response regulator protein VRAR; HTH LUXR-type dom 86.01
1gnf_A46 Transcription factor GATA-1; zinc finger, transcri 85.59
1dxg_A36 Desulforedoxin; non-heme iron protein, rubredoxin 85.26
3ga8_A78 HTH-type transcriptional regulator MQSA (YGIT/B30; 84.94
2x48_A55 CAG38821; archeal virus, viral protein; 2.60A {Sul 84.83
1p4w_A99 RCSB; solution structure, DNA binding domain, DNA 84.57
1uxc_A65 FRUR (1-57), fructose repressor; DNA-binding prote 84.54
1qbj_A81 Protein (double-stranded RNA specific adenosine D 84.48
1gh9_A71 8.3 kDa protein (gene MTH1184); beta+alpha complex 84.25
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 84.1
1tfi_A50 Transcriptional elongation factor SII; transcripti 83.95
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 83.51
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 83.05
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 82.9
1j1v_A94 Chromosomal replication initiator protein DNAA, 5' 82.81
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 82.32
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 82.16
4ham_A134 LMO2241 protein; structural genomics, PSI-biology, 81.71
3neu_A125 LIN1836 protein; structural genomics, PSI-2, prote 81.63
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 81.56
2vut_I43 AREA, nitrogen regulatory protein AREA; transcript 81.49
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 81.07
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 80.98
2apo_B60 Ribosome biogenesis protein NOP10; protein-protein 80.59
2o3f_A111 Putative HTH-type transcriptional regulator YBBH; 80.52
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 80.5
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 80.1
2e9h_A157 EIF-5, eukaryotic translation initiation factor 5; 80.09
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
Probab=100.00  E-value=9.9e-77  Score=546.87  Aligned_cols=307  Identities=34%  Similarity=0.533  Sum_probs=174.4

Q ss_pred             CCCCCCCCC-CCceeeeCCCCceEcCCCcccccCcccccccccccccCCC-CCCCCCccCCCCCCcccCCCcceEEecCC
Q 021438            3 DSYCADCKR-LTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANES-SDHDPVRVGGPLNPLLSGGGLSTVIAKPT   80 (312)
Q Consensus         3 ~~~Cp~Cg~-~~~ii~D~~~G~~vC~~CG~Vv~e~~id~~~ewr~f~~~~-~~~~~~r~G~~~~~~~~~~~~~t~i~~~~   80 (312)
                      ...||+||+ .+++++|+.+|++||++||+|++|++||+|||||+|++|+ ++.|++|+|+|.|+++||+|++|.|+++.
T Consensus        21 ~~~Cp~C~~~~~~lv~D~~~G~~vC~~CGlVl~e~~iD~g~EWR~f~~d~~~~~d~sRvG~~~~~~~~~~glsT~I~~~~  100 (345)
T 4bbr_M           21 VLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE  100 (345)
T ss_dssp             -CCCSSCCCSSCCEEEEGGGTEEEETTTCBEEESCCBCHHHHHTTTSCSCSSSCCSSCCEEEECHHHHCSCCCCEEECCS
T ss_pred             CCcCCCCCCCCCceeEECCCCcEEeCCCCCCccCcccccCccccCCCcccccCCCcCCCCCCCCccccCCCcceeecCCC
Confidence            458999997 4589999999999999999999999999999999999775 36889999999999999999999999765


Q ss_pred             CCCCcccccccchhcccc--CCcchhhHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHH
Q 021438           81 AGGSTELLSGSLGKLQAR--SSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYI  158 (312)
Q Consensus        81 ~~~~~~~~~~~l~~~~~~--~~~~e~~l~~~~~~I~~~~~~L~Lp~~v~~~A~~i~~~~~~~~~~~gr~~~~iaaAcly~  158 (312)
                       ++++. .+..|++||++  .+++|++|.+|+..|+++|++|+||+.+.++|..||+++++.++++||+.+.++|||||+
T Consensus       101 -~~~~~-~~~~L~r~q~r~~~~~~er~L~~a~~~I~~~~~~L~Lp~~v~d~A~~lyk~a~~~~~~rGrs~e~vaAAclYi  178 (345)
T 4bbr_M          101 -TTDMR-FTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILI  178 (345)
T ss_dssp             -SCCHH-HHHHHHHHHHHTCCCCSSSSTTHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHTTCTTTTTCCHHHHHHHHHHH
T ss_pred             -Ccchh-hHHHHHHHHHhhhcChHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCCccCCCHHHHHHHHHHH
Confidence             33311 23458899987  578999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhCCCCCHHHHHHHhcCCCHHHHHHHHHHHHHHHhhhhcc------ccccCCCCHHHHHHHHHhhcCCCHHHHHHHH
Q 021438          159 ACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQ------SVEMGTIHASDYLRRFCSNLGMTNQAVKAAQ  232 (312)
Q Consensus       159 acr~~~~p~tl~dia~~~~~v~~~~i~~~~~~l~~~l~~~~~~------~~~~~~~~p~~~i~r~~~~L~l~~~v~~~A~  232 (312)
                      |||+++.|+|++||++++ ++++++|+++|+.|.+.|++....      ++.+++.+|++||+|||++|+|++++.+.|+
T Consensus       179 ACR~~~~prtl~eI~~~~-~v~~keigr~~k~l~~~L~l~~~~~~~~~~~~~~~~~~p~~~i~Rf~s~L~l~~~v~~~A~  257 (345)
T 4bbr_M          179 GCRRAEVARTFKEIQSLI-HVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAE  257 (345)
T ss_dssp             HHHHTCCBCCHHHHHHHH-TCCTTHHHHHHHHHHHCC-------------------------------------------
T ss_pred             HHHhcCCCccHHHHHHHh-CCCHHHHHHHHHHHHHHhCccccccccccccccCCCCCHHHHHHHHHHHcCCcHHHHHHHH
Confidence            999999999999999999 799999999999999999974211      1236788999999999999999999999999


Q ss_pred             HHHHHhhh--ccCCCChHHHHHHHHHHHHHhcCCCCCHHHHHHHhCcchhHHHHHHHHHHhhhcccCCccc-cc-ccccc
Q 021438          233 EAVQKSED--LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWF-AN-EEDIK  308 (312)
Q Consensus       233 ~i~~~~~~--l~~Gr~P~~iaaAaiyla~~~~~~~~~~~~Ia~~~~vs~~ti~~~~kel~~~~~~~~p~~~-~~-~~~~~  308 (312)
                      +|++.+.+  +..||+|.+|||||||+|++++|.++|++|||+++|||++|||++||||+++++.|+|+|| .+ .++++
T Consensus       258 ~i~~~~~~~~i~~GR~P~~IAAAaIylAa~l~g~~~t~~eIa~v~~Vse~TIr~rykel~~~~~~l~~~~~~~~~~~~~~  337 (345)
T 4bbr_M          258 YTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLD  337 (345)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHhcccccCCChHHHHHHHHHHHHHHhCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHhhcCHHHhhcccCchh
Confidence            99999998  8899999999999999999999999999999999999999999999999999999996665 43 48999


Q ss_pred             ccCC
Q 021438          309 NLKL  312 (312)
Q Consensus       309 ~l~~  312 (312)
                      +||.
T Consensus       338 ~l~~  341 (345)
T 4bbr_M          338 NLPG  341 (345)
T ss_dssp             ----
T ss_pred             hCCC
Confidence            9994



>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Back     alignment and structure
>1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Back     alignment and structure
>2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Back     alignment and structure
>3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure
>1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Back     alignment and structure
>1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Back     alignment and structure
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Back     alignment and structure
>1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Back     alignment and structure
>4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M Back     alignment and structure
>3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Back     alignment and structure
>3h4c_A Transcription factor TFIIB-like; cyclin, transcription factor TFIIB repeat; 2.30A {Trypanosoma brucei brucei} Back     alignment and structure
>2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Back     alignment and structure
>2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Back     alignment and structure
>2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Back     alignment and structure
>1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A Back     alignment and structure
>3m03_A ORC6, origin recognition complex subunit 6; helix turn helix, DNA binding protein, origin recognition CO DNA replication; HET: MES; 2.50A {Homo sapiens} Back     alignment and structure
>2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Back     alignment and structure
>2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A Back     alignment and structure
>2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A Back     alignment and structure
>1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure
>2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 Back     alignment and structure
>2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 Back     alignment and structure
>1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 Back     alignment and structure
>2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 Back     alignment and structure
>1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 Back     alignment and structure
>2r7g_A PP110, retinoblastoma-associated protein, P105-RB, RB; retinoblastoma protein, E2F displacement, transcription repressor; 1.67A {Homo sapiens} SCOP: a.74.1.3 a.74.1.3 PDB: 1n4m_A 3pom_A 1gh6_B 1gux_A 1o9k_A 1ad6_A 1gux_B 1o9k_B Back     alignment and structure
>3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b Back     alignment and structure
>3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>4ell_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor, cell cycle; 1.98A {Homo sapiens} Back     alignment and structure
>2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 Back     alignment and structure
>3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2qdj_A Retinoblastoma-associated protein; cyclin fold, cyclin wedge, antitumor protein; 2.00A {Homo sapiens} Back     alignment and structure
>3m03_A ORC6, origin recognition complex subunit 6; helix turn helix, DNA binding protein, origin recognition CO DNA replication; HET: MES; 2.50A {Homo sapiens} Back     alignment and structure
>3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>4elj_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor protein, phosphorylation, cell; HET: TPO; 2.70A {Homo sapiens} Back     alignment and structure
>2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 Back     alignment and structure
>2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} Back     alignment and structure
>2r7g_A PP110, retinoblastoma-associated protein, P105-RB, RB; retinoblastoma protein, E2F displacement, transcription repressor; 1.67A {Homo sapiens} SCOP: a.74.1.3 a.74.1.3 PDB: 1n4m_A 3pom_A 1gh6_B 1gux_A 1o9k_A 1ad6_A 1gux_B 1o9k_B Back     alignment and structure
>4elj_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor protein, phosphorylation, cell; HET: TPO; 2.70A {Homo sapiens} Back     alignment and structure
>2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} Back     alignment and structure
>1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... Back     alignment and structure
>2pmi_B PHO85 cyclin PHO80, aminoglycoside anti; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_B* Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 Back     alignment and structure
>3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 Back     alignment and structure
>2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Back     alignment and structure
>1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>3h4c_A Transcription factor TFIIB-like; cyclin, transcription factor TFIIB repeat; 2.30A {Trypanosoma brucei brucei} Back     alignment and structure
>1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>1t6s_A Conserved hypothetical protein; A winged helix-turn-helix, structural genomics, BSGC structu by NIH, protein structure initiative, PSI; 1.95A {Chlorobium tepidum tls} SCOP: a.4.5.60 a.4.5.60 Back     alignment and structure
>2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} Back     alignment and structure
>1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A Back     alignment and structure
>2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 Back     alignment and structure
>2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A Back     alignment and structure
>1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 Back     alignment and structure
>2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2qdj_A Retinoblastoma-associated protein; cyclin fold, cyclin wedge, antitumor protein; 2.00A {Homo sapiens} Back     alignment and structure
>1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} Back     alignment and structure
>3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 Back     alignment and structure
>4ell_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor, cell cycle; 1.98A {Homo sapiens} Back     alignment and structure
>1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 Back     alignment and structure
>3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2pmi_B PHO85 cyclin PHO80, aminoglycoside anti; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_B* Back     alignment and structure
>1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* Back     alignment and structure
>3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A Back     alignment and structure
>2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} Back     alignment and structure
>1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A Back     alignment and structure
>1dxg_A Desulforedoxin; non-heme iron protein, rubredoxin type metal center, electron transport; 1.80A {Desulfovibrio gigas} SCOP: g.41.5.2 PDB: 1dcd_A 1dhg_A 1cfw_A 2lk5_A 2lk6_A Back     alignment and structure
>3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A Back     alignment and structure
>2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} Back     alignment and structure
>1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 Back     alignment and structure
>1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} Back     alignment and structure
>3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A Back     alignment and structure
>2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2e9h_A EIF-5, eukaryotic translation initiation factor 5; zinc binding, C4 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 312
d1vola2109 a.74.1.2 (A:208-316) Transcription factor IIB (TFI 7e-29
d1vola2109 a.74.1.2 (A:208-316) Transcription factor IIB (TFI 9e-20
d1aisb198 a.74.1.2 (B:1108-1205) Transcription factor IIB (T 3e-24
d1aisb198 a.74.1.2 (B:1108-1205) Transcription factor IIB (T 3e-15
d1vola195 a.74.1.2 (A:113-207) Transcription factor IIB (TFI 2e-22
d1vola195 a.74.1.2 (A:113-207) Transcription factor IIB (TFI 2e-13
d1aisb295 a.74.1.2 (B:1206-1300) Transcription factor IIB (T 2e-18
d1aisb295 a.74.1.2 (B:1206-1300) Transcription factor IIB (T 2e-18
d1dl6a_58 g.41.3.1 (A:) Transcription initiation factor TFII 1e-12
d1pfta_50 g.41.3.1 (A:) Transcription initiation factor TFII 2e-11
d2cchb1128 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [T 8e-04
d1jkwa1151 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo s 8e-04
d2ivxa1143 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) 0.001
d1g3nc1132 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma 0.001
d1w98b2140 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human 0.002
d2i53a1144 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) 0.002
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure

class: All alpha proteins
fold: Cyclin-like
superfamily: Cyclin-like
family: Transcription factor IIB (TFIIB), core domain
domain: Transcription factor IIB (TFIIB), core domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  104 bits (262), Expect = 7e-29
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 2/105 (1%)

Query: 208 IHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIR--RSPISVAAAVIYIITQLSNDT 265
           I   D++ RFCSNL +  Q   AA    +K+ +LD+   RSPISVAAA IY+ +Q S + 
Sbjct: 2   ITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEK 61

Query: 266 KPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDIKNL 310
           +  KEI  +  VA+ TI+  Y+ ++P    + P  F  +  +  L
Sbjct: 62  RTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKL 106


>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 98 Back     information, alignment and structure
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 98 Back     information, alignment and structure
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 95 Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 95 Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 50 Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Length = 128 Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Length = 132 Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Length = 144 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query312
d1vola2109 Transcription factor IIB (TFIIB), core domain {Hum 99.92
d1aisb295 Transcription factor IIB (TFIIB), core domain {Arc 99.88
d1vola195 Transcription factor IIB (TFIIB), core domain {Hum 99.87
d1aisb198 Transcription factor IIB (TFIIB), core domain {Arc 99.87
d1aisb295 Transcription factor IIB (TFIIB), core domain {Arc 99.82
d1dl6a_58 Transcription initiation factor TFIIB, N-terminal 99.8
d1vola2109 Transcription factor IIB (TFIIB), core domain {Hum 99.8
d1pfta_50 Transcription initiation factor TFIIB, N-terminal 99.78
d1aisb198 Transcription factor IIB (TFIIB), core domain {Arc 99.73
d1vola195 Transcription factor IIB (TFIIB), core domain {Hum 99.72
d2i53a1144 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 98.96
d2ivxa1143 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1jkwa1151 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 98.76
d2ivxa2113 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 98.62
d2i53a2110 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2cchb1128 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 98.26
d1bu2a1127 Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} 98.25
d1g3nc1132 Viral cyclin {Kaposi's sarcoma-associated herpesvi 98.2
d1f5qb1141 Viral cyclin {Murine herpesvirus 68 [TaxId: 33708] 98.1
d1w98b2140 G1/S-specific cyclin-E1 {Human (Homo sapiens) [Tax 98.08
d2cchb2124 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 97.7
d2ivxa2113 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 97.11
d2ivxa1143 Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} 97.11
d2i53a1144 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 97.07
d2r7ga2142 Retinoblastoma tumor suppressor domains {Human (Ho 96.84
d1qxfa_58 Ribosomal protein S27e {Archaeon Archaeoglobus ful 96.73
d1jkwa1151 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 96.67
d2jnya159 Uncharacterized protein Cgl1405/cg1592 {Corynebact 96.31
d2akla238 Hypothetical protein PA0128, N-terminal domain {Ps 96.23
d2i53a2110 Cyclin K {Human (Homo sapiens) [TaxId: 9606]} 96.2
d2pk7a159 Uncharacterized protein PFL1779 {Pseudomonas fluor 96.02
d2hf1a159 Hypothetical protein CV3345 {Chromobacterium viola 95.76
d1jkwa2126 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 95.57
d2cchb1128 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 94.95
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 94.88
d1bu2a1127 Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} 94.86
d1f5qb1141 Viral cyclin {Murine herpesvirus 68 [TaxId: 33708] 94.68
d1w98b2140 G1/S-specific cyclin-E1 {Human (Homo sapiens) [Tax 94.16
d2r7ga2142 Retinoblastoma tumor suppressor domains {Human (Ho 93.99
d1g3nc1132 Viral cyclin {Kaposi's sarcoma-associated herpesvi 93.97
d1neea237 Zinc-binding domain of translation initiation fact 93.88
d1k81a_36 Zinc-binding domain of translation initiation fact 93.46
d1nuia254 Zinc-binding domain of primase-helicase {Bacteriop 93.18
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 93.15
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 93.02
d1y0ja139 Erythroid transcription factor GATA-1 {Mouse (Mus 92.56
d1jkwa2126 Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 92.32
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 92.07
d1hw1a174 Fatty acid responsive transcription factor FadR, N 91.67
d1l3la165 Quorum-sensing transcription factor TraR, C-termin 91.54
d1fsea_67 Germination protein GerE {Bacillus subtilis [TaxId 91.33
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 91.19
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 90.76
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 90.57
d2cchb2124 Cyclin A {Cow (Bos taurus) [TaxId: 9913]} 90.31
d1yioa170 Response regulatory protein StyR, C-terminal domai 90.29
d2k4xa155 Ribosomal protein S27ae {Thermoplasma acidophilum 90.18
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 90.16
d1u5ka2157 Recombinational repair protein RecO, C-terminal do 89.92
d1a04a167 Nitrate/nitrite response regulator (NarL) {Escheri 89.75
d2gaua181 Transcriptional regulator PG0396, C-terminal domai 89.48
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 89.02
d1or7a168 SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 88.89
d1rp3a271 Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta 88.88
d1efaa159 Lac repressor (LacR), N-terminal domain {Escherich 88.83
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 88.09
d2hs5a169 Putative transcriptional regulator RHA1_ro03477 {R 88.04
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 87.98
d2hsga157 Glucose-resistance amylase regulator CcpA, N-termi 87.68
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 87.64
d2vuti142 Erythroid transcription factor GATA-1 {Emericella 87.6
d1i5za169 Catabolite gene activator protein (CAP), C-termina 87.4
d2o3fa183 Putative transcriptional regulator YbbH {Bacillus 87.27
d3bwga178 Transcriptional regulator YydK {Bacillus subtilis 87.19
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 87.03
d1uxda_59 Fructose repressor (FruR), N-terminal domain {Esch 87.0
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 86.5
d1qpza157 Purine repressor (PurR), N-terminal domain {Escher 86.38
d1rqga335 Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro 86.37
d1twfi272 RBP9 subunit of RNA polymerase II {Baker's yeast ( 86.04
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 86.02
d1ft9a180 CO-sensing protein CooA, C-terminal domain {Rhodos 85.98
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 85.41
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 85.32
d2j015159 Ribosomal protein L32p {Thermus thermophilus [TaxI 85.27
d3gata_66 Erythroid transcription factor GATA-1 {Chicken (Ga 85.05
d1l1oc_178 Replication protein A 70 KDa subunit (RPA70) {Huma 84.74
d2ct7a173 Ring finger protein 31 {Human (Homo sapiens) [TaxI 84.68
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 84.67
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 84.27
d1zyba173 Probable transcription regulator BT4300, C-termina 83.8
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 83.29
d2j9ub147 Vacuolar protein-sorting-associated protein 36, VP 83.28
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 83.09
d1bl0a154 MarA {Escherichia coli [TaxId: 562]} 82.98
d3e5ua180 Chlorophenol reduction protein CprK {Desulfitobact 82.39
d2hoea162 N-acetylglucosamine kinase {Thermotoga maritima [T 82.31
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 82.2
d1p4wa_87 Transcriptional regulator RcsB {Erwinia amylovora 82.12
d1z0xa168 Transcriptional regulator EF0787 {Enterococcus fae 82.07
d1d5ya154 Rob transcription factor, N-terminal domain {Esche 81.92
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 81.64
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 81.14
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 81.09
d1qypa_57 RBP9 subunit of RNA polymerase II {Archaeon Thermo 80.82
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 80.47
d1hlva166 DNA-binding domain of centromere binding protein B 80.22
d2zcwa182 Transcriptional regulator TTHA1359, C-terminal dom 80.01
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cyclin-like
superfamily: Cyclin-like
family: Transcription factor IIB (TFIIB), core domain
domain: Transcription factor IIB (TFIIB), core domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92  E-value=1.4e-25  Score=171.20  Aligned_cols=105  Identities=36%  Similarity=0.565  Sum_probs=101.9

Q ss_pred             CCHHHHHHHHHhhcCCCHHHHHHHHHHHHHhhh--ccCCCChHHHHHHHHHHHHHhcCCCCCHHHHHHHhCcchhHHHHH
Q 021438          208 IHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED--LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNV  285 (312)
Q Consensus       208 ~~p~~~i~r~~~~L~l~~~v~~~A~~i~~~~~~--l~~Gr~P~~iaaAaiyla~~~~~~~~~~~~Ia~~~~vs~~ti~~~  285 (312)
                      ++|.+||+|||++|+|++++.+.|.++++.+.+  +..||+|.++|||+||+||+.+|.+++++|||+++||++.||+++
T Consensus         2 i~~~d~i~Rf~s~L~L~~~i~~~A~~i~~~~~~~~~~~Gr~p~~iaAa~iY~a~r~~~~~~t~~eIa~~~~vs~~tI~k~   81 (109)
T d1vola2           2 ITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQS   81 (109)
T ss_dssp             CCGGGTHHHHHHHHTCCHHHHHHHHHHHHHHHHTTCSTTCCHHHHHHHHHHHHHHTSSSCCCHHHHHHHHTCCHHHHHHH
T ss_pred             CCHHHHHHHHHHHcCcCHHHHHHHHHHHHHHHHcCCcCCCCHHHHHHHHHHHHHHHcCCCCCHHHHHHHHCCCHHHHHHH
Confidence            578999999999999999999999999999987  889999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhcccCCccccccccccccCC
Q 021438          286 YKDLFPHLARIIPDWFANEEDIKNLKL  312 (312)
Q Consensus       286 ~kel~~~~~~~~p~~~~~~~~~~~l~~  312 (312)
                      ||+|++++..++|.|+..+.+++.||.
T Consensus        82 yk~l~~~~~~lip~~~~~~~~~~~lP~  108 (109)
T d1vola2          82 YRLIYPRAPDLFPTDFKFDTPVDKLPQ  108 (109)
T ss_dssp             HHHHGGGHHHHSCSSCCCSSCGGGSCC
T ss_pred             HHHHHHHHHHhCChhhcccCCHHHcCC
Confidence            999999999999999999999999994



>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Back     information, alignment and structure
>d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cchb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r7ga2 a.74.1.3 (A:644-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d1jkwa2 a.74.1.1 (A:162-287) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} Back     information, alignment and structure
>d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} Back     information, alignment and structure
>d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r7ga2 a.74.1.3 (A:644-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Back     information, alignment and structure
>d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1nuia2 g.41.3.2 (A:10-63) Zinc-binding domain of primase-helicase {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jkwa2 a.74.1.1 (A:162-287) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d2cchb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1l1oc_ b.40.4.3 (C:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2j9ub1 g.41.11.1 (B:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} Back     information, alignment and structure
>d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qypa_ g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer [TaxId: 2264]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure