Citrus Sinensis ID: 021438
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 312 | ||||||
| 224135681 | 311 | predicted protein [Populus trichocarpa] | 0.990 | 0.993 | 0.841 | 1e-147 | |
| 351724605 | 313 | transcription initiation factor IIB [Gly | 0.993 | 0.990 | 0.767 | 1e-142 | |
| 449465789 | 312 | PREDICTED: transcription initiation fact | 0.990 | 0.990 | 0.770 | 1e-142 | |
| 255544920 | 312 | transcription initiation factor iib, put | 0.990 | 0.990 | 0.770 | 1e-142 | |
| 317106705 | 312 | JHL06B08.6 [Jatropha curcas] | 0.990 | 0.990 | 0.774 | 1e-142 | |
| 225464249 | 312 | PREDICTED: transcription initiation fact | 0.990 | 0.990 | 0.774 | 1e-142 | |
| 225441886 | 312 | PREDICTED: transcription initiation fact | 0.990 | 0.990 | 0.770 | 1e-142 | |
| 225436547 | 314 | PREDICTED: transcription initiation fact | 0.993 | 0.987 | 0.771 | 1e-141 | |
| 297829558 | 312 | transcription initiation factor IIB-2 [A | 0.993 | 0.993 | 0.755 | 1e-141 | |
| 255588003 | 312 | transcription initiation factor iib, put | 0.990 | 0.990 | 0.770 | 1e-141 |
| >gi|224135681|ref|XP_002322134.1| predicted protein [Populus trichocarpa] gi|222869130|gb|EEF06261.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 525 bits (1353), Expect = e-147, Method: Compositional matrix adjust.
Identities = 261/310 (84%), Positives = 285/310 (91%), Gaps = 1/310 (0%)
Query: 1 MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVG 60
M DSYC DCKRLTE+VFDHSAGDTICSECGL+LEA+SVDETSEWR F+NESSDHDP RVG
Sbjct: 1 MEDSYCPDCKRLTEIVFDHSAGDTICSECGLILEAHSVDETSEWRTFSNESSDHDPNRVG 60
Query: 61 GPLNPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRL 120
GPLNPLL+ GGLST I+K T GGS ELLS SLGK Q+R ++PDRN IQAFKSI+AM+DRL
Sbjct: 61 GPLNPLLADGGLSTTISK-TNGGSNELLSCSLGKWQSRGANPDRNRIQAFKSIAAMADRL 119
Query: 121 GLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTT 180
GLVTTIKDRANEIYKKVEDQKPL+GRNQ+AI+AACLYIACRQENK RTVKE CSV NGTT
Sbjct: 120 GLVTTIKDRANEIYKKVEDQKPLKGRNQDAILAACLYIACRQENKARTVKEICSVVNGTT 179
Query: 181 KKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED 240
KKEIGRAKEFIVKHLE EMG S+EMGTIHA+DYLRRFCSNLGMTNQAVKAA EAVQKSE+
Sbjct: 180 KKEIGRAKEFIVKHLEVEMGHSMEMGTIHAADYLRRFCSNLGMTNQAVKAAHEAVQKSEE 239
Query: 241 LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDW 300
LDIRRSPIS+AAAVIYII QLS+D KPLK+IS+VT+VAEGTIKN YKDL PHL++IIP W
Sbjct: 240 LDIRRSPISIAAAVIYIIIQLSDDKKPLKDISVVTQVAEGTIKNSYKDLSPHLSQIIPSW 299
Query: 301 FANEEDIKNL 310
FA EEDIKNL
Sbjct: 300 FAKEEDIKNL 309
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|351724605|ref|NP_001238343.1| transcription initiation factor IIB [Glycine max] gi|1351222|sp|P48513.1|TF2B_SOYBN RecName: Full=Transcription initiation factor IIB; AltName: Full=General transcription factor TFIIB gi|945087|gb|AAB09756.1| transcription factor TFIIB [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449465789|ref|XP_004150610.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis sativus] gi|449529834|ref|XP_004171903.1| PREDICTED: transcription initiation factor IIB-2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|255544920|ref|XP_002513521.1| transcription initiation factor iib, putative [Ricinus communis] gi|223547429|gb|EEF48924.1| transcription initiation factor iib, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|317106705|dbj|BAJ53205.1| JHL06B08.6 [Jatropha curcas] | Back alignment and taxonomy information |
|---|
| >gi|225464249|ref|XP_002269045.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera] gi|296088031|emb|CBI35314.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225441886|ref|XP_002284342.1| PREDICTED: transcription initiation factor IIB-2 [Vitis vinifera] gi|297739630|emb|CBI29812.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225436547|ref|XP_002277679.1| PREDICTED: transcription initiation factor IIB [Vitis vinifera] gi|297734946|emb|CBI17180.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297829558|ref|XP_002882661.1| transcription initiation factor IIB-2 [Arabidopsis lyrata subsp. lyrata] gi|297328501|gb|EFH58920.1| transcription initiation factor IIB-2 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|255588003|ref|XP_002534470.1| transcription initiation factor iib, putative [Ricinus communis] gi|223525233|gb|EEF27913.1| transcription initiation factor iib, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 312 | ||||||
| TAIR|locus:2076259 | 312 | AT3G10330 [Arabidopsis thalian | 0.993 | 0.993 | 0.665 | 4.3e-109 | |
| TAIR|locus:2062703 | 312 | TFIIB "transcription factor II | 0.990 | 0.990 | 0.629 | 2e-102 | |
| TAIR|locus:2093852 | 336 | pBRP2 "plant-specific TFIIB-re | 0.980 | 0.910 | 0.391 | 7.2e-52 | |
| FB|FBgn0004915 | 315 | TfIIB "Transcription factor II | 0.897 | 0.888 | 0.418 | 9.2e-52 | |
| ZFIN|ZDB-GENE-030131-3544 | 316 | gtf2b "general transcription f | 0.926 | 0.914 | 0.399 | 1.3e-50 | |
| UNIPROTKB|F1NXP2 | 306 | GTF2B "Uncharacterized protein | 0.926 | 0.944 | 0.392 | 2e-49 | |
| MGI|MGI:2385191 | 316 | Gtf2b "general transcription f | 0.926 | 0.914 | 0.385 | 4.7e-48 | |
| RGD|619735 | 316 | Gtf2b "general transcription f | 0.926 | 0.914 | 0.385 | 4.7e-48 | |
| UNIPROTKB|F2Z4J6 | 316 | LOC786656 "Uncharacterized pro | 0.926 | 0.914 | 0.385 | 6e-48 | |
| UNIPROTKB|E2RPG1 | 316 | GTF2B "Uncharacterized protein | 0.926 | 0.914 | 0.385 | 6e-48 |
| TAIR|locus:2076259 AT3G10330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1078 (384.5 bits), Expect = 4.3e-109, P = 4.3e-109
Identities = 207/311 (66%), Positives = 243/311 (78%)
Query: 1 MADSYCADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVX 60
M+D++C+DCKR TEVVFDHSAGDT+CSECGLVLE++S+DETSEWR FANES D+DPVRV
Sbjct: 1 MSDAFCSDCKRHTEVVFDHSAGDTVCSECGLVLESHSIDETSEWRTFANESGDNDPVRVG 60
Query: 61 XXXXXXXXXXXXXTVIAKPTAXXXXXXXXXXXXXXQARSSHPDRNLIQAFKSISAMSDRL 120
TVI+KP Q R S+PDR LI AFK+I+ M+DRL
Sbjct: 61 GPTNPLLADGGLTTVISKPNGSSGDFLSSSLGRW-QNRGSNPDRGLIVAFKTIATMADRL 119
Query: 121 GLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTT 180
GLV TIKDRANEIYK+VEDQK RGRNQ+A++AACLYIACRQE+KPRTVKE CSVANG T
Sbjct: 120 GLVATIKDRANEIYKRVEDQKSSRGRNQDALLAACLYIACRQEDKPRTVKEICSVANGAT 179
Query: 181 KKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNXXXXXXXXXXXXSED 240
KKEIGRAKE+IVK L E GQ VEMGTIHA D++RRFCSNLGMTN SE+
Sbjct: 180 KKEIGRAKEYIVKQLGLETGQLVEMGTIHAGDFMRRFCSNLGMTNQTVKAAQESVQKSEE 239
Query: 241 LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDW 300
DIRRSPIS+AAAVIYIITQLS++ KPL++IS+ T VAEGTI+N YKDL+PHL++IIP W
Sbjct: 240 FDIRRSPISIAAAVIYIITQLSDEKKPLRDISVATGVAEGTIRNSYKDLYPHLSKIIPAW 299
Query: 301 FANEEDIKNLK 311
+A EED+KNL+
Sbjct: 300 YAKEEDLKNLQ 310
|
|
| TAIR|locus:2062703 TFIIB "transcription factor IIB" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2093852 pBRP2 "plant-specific TFIIB-related protein 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0004915 TfIIB "Transcription factor IIB" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3544 gtf2b "general transcription factor IIB" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NXP2 GTF2B "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2385191 Gtf2b "general transcription factor IIB" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|619735 Gtf2b "general transcription factor IIB" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z4J6 LOC786656 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RPG1 GTF2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| fgenesh4_pg.C_LG_XV000426 | hypothetical protein (311 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| GTF902 | • | • | • | • | 0.839 | ||||||
| GTF901 | • | • | • | • | 0.835 | ||||||
| estExt_Genewise1_v1.C_LG_I4990 | • | • | • | • | 0.635 | ||||||
| gw1.IX.2304.1 | • | • | • | • | 0.633 | ||||||
| gw1.IV.3113.1 | • | • | • | • | 0.530 | ||||||
| estExt_Genewise1_v1.C_LG_IV3101 | • | • | • | 0.504 | |||||||
| grail3.2024000101 | • | 0.451 | |||||||||
| estExt_fgenesh4_pg.C_LG_XII1303 | • | 0.441 | |||||||||
| estExt_Genewise1_v1.C_LG_XV2760 | • | 0.439 | |||||||||
| gw1.I.2689.1 | • | • | • | 0.436 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 312 | |||
| COG1405 | 285 | COG1405, SUA7, Transcription initiation factor TFI | 8e-71 | |
| PRK00423 | 310 | PRK00423, tfb, transcription initiation factor IIB | 3e-60 | |
| pfam00382 | 71 | pfam00382, TFIIB, Transcription factor TFIIB repea | 3e-19 | |
| cd00043 | 88 | cd00043, CYCLIN, Cyclin box fold | 3e-13 | |
| pfam00382 | 71 | pfam00382, TFIIB, Transcription factor TFIIB repea | 1e-10 | |
| smart00385 | 83 | smart00385, CYCLIN, domain present in cyclins, TFI | 3e-10 | |
| pfam08271 | 40 | pfam08271, TF_Zn_Ribbon, TFIIB zinc-binding | 3e-09 | |
| smart00385 | 83 | smart00385, CYCLIN, domain present in cyclins, TFI | 5e-08 | |
| cd00043 | 88 | cd00043, CYCLIN, Cyclin box fold | 4e-07 | |
| COG5333 | 297 | COG5333, CCL1, Cdk activating kinase (CAK)/RNA pol | 6e-06 | |
| pfam00134 | 127 | pfam00134, Cyclin_N, Cyclin, N-terminal domain | 0.003 |
| >gnl|CDD|224323 COG1405, SUA7, Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] | Back alignment and domain information |
|---|
Score = 220 bits (563), Expect = 8e-71
Identities = 106/299 (35%), Positives = 161/299 (53%), Gaps = 22/299 (7%)
Query: 6 CADCKRLTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNP 65
C +C T ++ D+ G+ +C++CGLVLE +D EWR F RVG PL P
Sbjct: 4 CPECGS-TNIITDYERGEIVCADCGLVLEDSLIDPGPEWRAFDERHER----RVGAPLTP 58
Query: 66 LLSGGGLSTVIAKPTAGGSTELLSGSLGKLQAR---SSHPDRNLIQAFKSISAMSDRLGL 122
+ GLST+I G + L K Q R SS +RNLI A + + ++ LGL
Sbjct: 59 SIHDKGLSTII-----GWGDKDKMYRLRKWQIRIRVSSAKERNLITALEELERIASALGL 113
Query: 123 VTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKK 182
++++ A IY+K D+ LRGR+ E++ AAC+Y ACR PRT+ E G +KK
Sbjct: 114 PESVRETAARIYRKAVDKGLLRGRSIESVAAACIYAACRINGVPRTLDEIAKAL-GVSKK 172
Query: 183 EIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED-- 240
EIGR +V+ L +++ + SDY+ RF S LG++++ + A E V+K++
Sbjct: 173 EIGRTYRLLVREL------KLKIPPVDPSDYIPRFASKLGLSDEVRRKAIEIVKKAKRAG 226
Query: 241 LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPD 299
L +SP +AAA IY+ + L + + KE++ V V E TI+N YK+L L +
Sbjct: 227 LTAGKSPAGLAAAAIYLASLLLGERRTQKEVAKVAGVTEVTIRNRYKELADALDIEVTV 285
|
Length = 285 |
| >gnl|CDD|234758 PRK00423, tfb, transcription initiation factor IIB; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|109440 pfam00382, TFIIB, Transcription factor TFIIB repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238003 cd00043, CYCLIN, Cyclin box fold | Back alignment and domain information |
|---|
| >gnl|CDD|109440 pfam00382, TFIIB, Transcription factor TFIIB repeat | Back alignment and domain information |
|---|
| >gnl|CDD|214641 smart00385, CYCLIN, domain present in cyclins, TFIIB and Retinoblastoma | Back alignment and domain information |
|---|
| >gnl|CDD|203895 pfam08271, TF_Zn_Ribbon, TFIIB zinc-binding | Back alignment and domain information |
|---|
| >gnl|CDD|214641 smart00385, CYCLIN, domain present in cyclins, TFIIB and Retinoblastoma | Back alignment and domain information |
|---|
| >gnl|CDD|238003 cd00043, CYCLIN, Cyclin box fold | Back alignment and domain information |
|---|
| >gnl|CDD|227640 COG5333, CCL1, Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|215740 pfam00134, Cyclin_N, Cyclin, N-terminal domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 312 | |||
| KOG1597 | 308 | consensus Transcription initiation factor TFIIB [T | 100.0 | |
| PRK00423 | 310 | tfb transcription initiation factor IIB; Reviewed | 100.0 | |
| COG1405 | 285 | SUA7 Transcription initiation factor TFIIIB, Brf1 | 100.0 | |
| KOG1598 | 521 | consensus Transcription initiation factor TFIIIB, | 100.0 | |
| KOG0835 | 367 | consensus Cyclin L [General function prediction on | 99.8 | |
| PF00382 | 71 | TFIIB: Transcription factor TFIIB repeat; InterPro | 99.77 | |
| KOG0834 | 323 | consensus CDK9 kinase-activating protein cyclin T | 99.74 | |
| PF00382 | 71 | TFIIB: Transcription factor TFIIB repeat; InterPro | 99.69 | |
| TIGR00569 | 305 | ccl1 cyclin ccl1. University). | 99.69 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 99.62 | |
| COG5333 | 297 | CCL1 Cdk activating kinase (CAK)/RNA polymerase II | 99.54 | |
| PRK00423 | 310 | tfb transcription initiation factor IIB; Reviewed | 99.53 | |
| KOG0794 | 264 | consensus CDK8 kinase-activating protein cyclin C | 99.39 | |
| COG1405 | 285 | SUA7 Transcription initiation factor TFIIIB, Brf1 | 99.3 | |
| KOG1597 | 308 | consensus Transcription initiation factor TFIIB [T | 99.28 | |
| cd00043 | 88 | CYCLIN Cyclin box fold. Protein binding domain fun | 99.19 | |
| smart00385 | 83 | CYCLIN domain present in cyclins, TFIIB and Retino | 99.09 | |
| cd00043 | 88 | CYCLIN Cyclin box fold. Protein binding domain fun | 99.08 | |
| smart00385 | 83 | CYCLIN domain present in cyclins, TFIIB and Retino | 99.07 | |
| KOG0656 | 335 | consensus G1/S-specific cyclin D [Cell cycle contr | 98.98 | |
| COG5024 | 440 | Cyclin [Cell division and chromosome partitioning] | 98.45 | |
| KOG2496 | 325 | consensus Cdk activating kinase (CAK)/RNA polymera | 98.36 | |
| KOG0653 | 391 | consensus Cyclin B and related kinase-activating p | 98.36 | |
| PF00134 | 127 | Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR | 98.33 | |
| KOG1598 | 521 | consensus Transcription initiation factor TFIIIB, | 98.21 | |
| PF02984 | 118 | Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR | 98.1 | |
| KOG4557 | 262 | consensus Origin recognition complex, subunit 6 [R | 98.08 | |
| PF01857 | 135 | RB_B: Retinoblastoma-associated protein B domain; | 97.77 | |
| KOG0655 | 408 | consensus G1/S-specific cyclin E [Cell cycle contr | 97.53 | |
| PF11781 | 36 | RRN7: RNA polymerase I-specific transcription init | 97.29 | |
| PHA00626 | 59 | hypothetical protein | 96.77 | |
| PF08792 | 33 | A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: I | 96.75 | |
| KOG0835 | 367 | consensus Cyclin L [General function prediction on | 96.74 | |
| PRK00415 | 59 | rps27e 30S ribosomal protein S27e; Reviewed | 96.73 | |
| COG2051 | 67 | RPS27A Ribosomal protein S27E [Translation, riboso | 96.67 | |
| PF14803 | 34 | Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C. | 96.64 | |
| PF02984 | 118 | Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR | 96.48 | |
| PF01667 | 55 | Ribosomal_S27e: Ribosomal protein S27; InterPro: I | 96.47 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 96.11 | |
| smart00778 | 37 | Prim_Zn_Ribbon Zinc-binding domain of primase-heli | 96.07 | |
| PLN00209 | 86 | ribosomal protein S27; Provisional | 96.03 | |
| PF01857 | 135 | RB_B: Retinoblastoma-associated protein B domain; | 95.99 | |
| PRK00420 | 112 | hypothetical protein; Validated | 95.98 | |
| PF02150 | 35 | RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; I | 95.92 | |
| PTZ00083 | 85 | 40S ribosomal protein S27; Provisional | 95.92 | |
| PRK00398 | 46 | rpoP DNA-directed RNA polymerase subunit P; Provis | 95.87 | |
| PF13240 | 23 | zinc_ribbon_2: zinc-ribbon domain | 95.8 | |
| PF00134 | 127 | Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR | 95.75 | |
| PF08274 | 30 | PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR01 | 95.71 | |
| PRK10220 | 111 | hypothetical protein; Provisional | 95.68 | |
| TIGR01206 | 54 | lysW lysine biosynthesis protein LysW. This very s | 95.49 | |
| PRK00432 | 50 | 30S ribosomal protein S27ae; Validated | 95.36 | |
| KOG0834 | 323 | consensus CDK9 kinase-activating protein cyclin T | 95.2 | |
| PRK11827 | 60 | hypothetical protein; Provisional | 95.18 | |
| TIGR00569 | 305 | ccl1 cyclin ccl1. University). | 95.01 | |
| PF10571 | 26 | UPF0547: Uncharacterised protein family UPF0547; I | 94.9 | |
| PF09538 | 108 | FYDLN_acid: Protein of unknown function (FYDLN_aci | 94.87 | |
| PF08613 | 149 | Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eu | 94.82 | |
| COG2835 | 60 | Uncharacterized conserved protein [Function unknow | 94.71 | |
| KOG0654 | 359 | consensus G2/Mitotic-specific cyclin A [Cell cycle | 94.66 | |
| COG2824 | 112 | PhnA Uncharacterized Zn-ribbon-containing protein | 94.6 | |
| COG1997 | 89 | RPL43A Ribosomal protein L37AE/L43A [Translation, | 94.52 | |
| TIGR02098 | 38 | MJ0042_CXXC MJ0042 family finger-like domain. This | 94.45 | |
| PF08273 | 40 | Prim_Zn_Ribbon: Zinc-binding domain of primase-hel | 94.43 | |
| COG1998 | 51 | RPS31 Ribosomal protein S27AE [Translation, riboso | 94.29 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 94.29 | |
| PF03966 | 68 | Trm112p: Trm112p-like protein; InterPro: IPR005651 | 94.25 | |
| smart00661 | 52 | RPOL9 RNA polymerase subunit 9. | 94.1 | |
| PF14354 | 61 | Lar_restr_allev: Restriction alleviation protein L | 94.06 | |
| TIGR02300 | 129 | FYDLN_acid conserved hypothetical protein TIGR0230 | 93.98 | |
| TIGR02393 | 238 | RpoD_Cterm RNA polymerase sigma factor RpoD, C-ter | 93.95 | |
| PRK00464 | 154 | nrdR transcriptional regulator NrdR; Validated | 93.87 | |
| KOG4164 | 497 | consensus Cyclin ik3-1/CABLES [Cell cycle control, | 93.58 | |
| PF13404 | 42 | HTH_AsnC-type: AsnC-type helix-turn-helix domain; | 93.46 | |
| TIGR03655 | 53 | anti_R_Lar restriction alleviation protein, Lar fa | 93.05 | |
| PRK07408 | 256 | RNA polymerase sigma factor SigF; Reviewed | 93.04 | |
| TIGR00686 | 109 | phnA alkylphosphonate utilization operon protein P | 92.84 | |
| PF09297 | 32 | zf-NADH-PPase: NADH pyrophosphatase zinc ribbon do | 92.79 | |
| COG1594 | 113 | RPB9 DNA-directed RNA polymerase, subunit M/Transc | 92.73 | |
| PF06677 | 41 | Auto_anti-p27: Sjogren's syndrome/scleroderma auto | 92.71 | |
| TIGR00244 | 147 | transcriptional regulator NrdR. Members of this al | 92.58 | |
| PF12760 | 46 | Zn_Tnp_IS1595: Transposase zinc-ribbon domain; Int | 92.49 | |
| PRK14892 | 99 | putative transcription elongation factor Elf1; Pro | 92.45 | |
| PF13719 | 37 | zinc_ribbon_5: zinc-ribbon domain | 92.25 | |
| PF13730 | 55 | HTH_36: Helix-turn-helix domain | 92.16 | |
| PF13613 | 53 | HTH_Tnp_4: Helix-turn-helix of DDE superfamily end | 92.01 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 91.92 | |
| PF09862 | 113 | DUF2089: Protein of unknown function (DUF2089); In | 91.85 | |
| PF13412 | 48 | HTH_24: Winged helix-turn-helix DNA-binding; PDB: | 91.84 | |
| PF08613 | 149 | Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eu | 91.7 | |
| PF04545 | 50 | Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 | 91.58 | |
| KOG1779 | 84 | consensus 40s ribosomal protein S27 [Translation, | 91.49 | |
| COG4888 | 104 | Uncharacterized Zn ribbon-containing protein [Gene | 91.35 | |
| PF08279 | 55 | HTH_11: HTH domain; InterPro: IPR013196 Winged hel | 91.3 | |
| KOG4557 | 262 | consensus Origin recognition complex, subunit 6 [R | 91.13 | |
| PF01325 | 60 | Fe_dep_repress: Iron dependent repressor, N-termin | 91.07 | |
| PF01780 | 90 | Ribosomal_L37ae: Ribosomal L37ae protein family; I | 90.9 | |
| PRK05657 | 325 | RNA polymerase sigma factor RpoS; Validated | 90.85 | |
| smart00834 | 41 | CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C | 90.85 | |
| PRK09210 | 367 | RNA polymerase sigma factor RpoD; Validated | 90.8 | |
| PF07282 | 69 | OrfB_Zn_ribbon: Putative transposase DNA-binding d | 90.59 | |
| PRK12495 | 226 | hypothetical protein; Provisional | 90.54 | |
| PF13936 | 44 | HTH_38: Helix-turn-helix domain; PDB: 2W48_A. | 90.5 | |
| PF01096 | 39 | TFIIS_C: Transcription factor S-II (TFIIS); InterP | 90.22 | |
| TIGR01384 | 104 | TFS_arch transcription factor S, archaeal. There h | 90.13 | |
| KOG1010 | 920 | consensus Rb (Retinoblastoma tumor suppressor)-rel | 90.09 | |
| PF13384 | 50 | HTH_23: Homeodomain-like domain; PDB: 2X48_C. | 89.61 | |
| smart00440 | 40 | ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding mo | 89.6 | |
| PTZ00255 | 90 | 60S ribosomal protein L37a; Provisional | 89.38 | |
| COG3478 | 68 | Predicted nucleic-acid-binding protein containing | 89.36 | |
| TIGR02394 | 285 | rpoS_proteo RNA polymerase sigma factor RpoS. A si | 89.25 | |
| PF10668 | 60 | Phage_terminase: Phage terminase small subunit; In | 89.17 | |
| PF05129 | 81 | Elf1: Transcription elongation factor Elf1 like; I | 89.01 | |
| COG2888 | 61 | Predicted Zn-ribbon RNA-binding protein with a fun | 88.84 | |
| PF00356 | 46 | LacI: Bacterial regulatory proteins, lacI family; | 88.72 | |
| smart00659 | 44 | RPOLCX RNA polymerase subunit CX. present in RNA p | 88.61 | |
| PRK00135 | 188 | scpB segregation and condensation protein B; Revie | 88.49 | |
| COG5333 | 297 | CCL1 Cdk activating kinase (CAK)/RNA polymerase II | 88.43 | |
| PRK12286 | 57 | rpmF 50S ribosomal protein L32; Reviewed | 88.4 | |
| PF05460 | 353 | ORC6: Origin recognition complex subunit 6 (ORC6); | 88.35 | |
| PF00196 | 58 | GerE: Bacterial regulatory proteins, luxR family; | 88.25 | |
| PF03119 | 28 | DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc f | 88.13 | |
| PF13545 | 76 | HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: | 88.01 | |
| PRK05901 | 509 | RNA polymerase sigma factor; Provisional | 87.98 | |
| cd00092 | 67 | HTH_CRP helix_turn_helix, cAMP Regulatory protein | 87.95 | |
| smart00421 | 58 | HTH_LUXR helix_turn_helix, Lux Regulon. lux regulo | 87.94 | |
| TIGR00280 | 91 | L37a ribosomal protein L37a. This model finds euka | 87.9 | |
| COG5349 | 126 | Uncharacterized protein conserved in bacteria [Fun | 87.88 | |
| PF03604 | 32 | DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa | 87.88 | |
| PF01371 | 87 | Trp_repressor: Trp repressor protein; InterPro: IP | 87.85 | |
| smart00342 | 84 | HTH_ARAC helix_turn_helix, arabinose operon contro | 87.8 | |
| PRK05978 | 148 | hypothetical protein; Provisional | 87.77 | |
| PRK11169 | 164 | leucine-responsive transcriptional regulator; Prov | 87.7 | |
| PF02796 | 45 | HTH_7: Helix-turn-helix domain of resolvase; Inter | 87.59 | |
| PRK07406 | 373 | RNA polymerase sigma factor RpoD; Validated | 87.51 | |
| PF05191 | 36 | ADK_lid: Adenylate kinase, active site lid; InterP | 87.39 | |
| smart00419 | 48 | HTH_CRP helix_turn_helix, cAMP Regulatory protein. | 87.21 | |
| PF04967 | 53 | HTH_10: HTH DNA binding domain; InterPro: IPR00705 | 87.19 | |
| COG4640 | 465 | Predicted membrane protein [Function unknown] | 87.19 | |
| PF01022 | 47 | HTH_5: Bacterial regulatory protein, arsR family; | 87.02 | |
| PRK09678 | 72 | DNA-binding transcriptional regulator; Provisional | 87.01 | |
| PRK07405 | 317 | RNA polymerase sigma factor SigD; Validated | 86.87 | |
| smart00345 | 60 | HTH_GNTR helix_turn_helix gluconate operon transcr | 86.84 | |
| PRK11179 | 153 | DNA-binding transcriptional regulator AsnC; Provis | 86.81 | |
| TIGR03879 | 73 | near_KaiC_dom probable regulatory domain. This mod | 86.73 | |
| COG1725 | 125 | Predicted transcriptional regulators [Transcriptio | 86.71 | |
| PRK03976 | 90 | rpl37ae 50S ribosomal protein L37Ae; Reviewed | 86.7 | |
| COG4068 | 64 | Uncharacterized protein containing a Zn-ribbon [Fu | 86.46 | |
| PF01783 | 56 | Ribosomal_L32p: Ribosomal L32p protein family; Int | 86.37 | |
| PHA02591 | 83 | hypothetical protein; Provisional | 86.34 | |
| PRK05911 | 257 | RNA polymerase sigma factor sigma-28; Reviewed | 86.33 | |
| PRK08402 | 355 | replication factor A; Reviewed | 86.18 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 86.09 | |
| cd06571 | 90 | Bac_DnaA_C C-terminal domain of bacterial DnaA pro | 86.06 | |
| PF08281 | 54 | Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013 | 86.01 | |
| PF09855 | 64 | DUF2082: Nucleic-acid-binding protein containing Z | 86.01 | |
| PF13542 | 52 | HTH_Tnp_ISL3: Helix-turn-helix domain of transposa | 86.01 | |
| PF13717 | 36 | zinc_ribbon_4: zinc-ribbon domain | 85.93 | |
| KOG2496 | 325 | consensus Cdk activating kinase (CAK)/RNA polymera | 85.57 | |
| PF08220 | 57 | HTH_DeoR: DeoR-like helix-turn-helix domain; Inter | 85.49 | |
| cd06170 | 57 | LuxR_C_like C-terminal DNA-binding domain of LuxR- | 85.27 | |
| TIGR01031 | 55 | rpmF_bact ribosomal protein L32. This protein desc | 85.06 | |
| TIGR03697 | 193 | NtcA_cyano global nitrogen regulator NtcA, cyanoba | 84.94 | |
| PF14255 | 52 | Cys_rich_CPXG: Cysteine-rich CPXCG | 84.57 | |
| PRK09710 | 64 | lar restriction alleviation and modification prote | 84.54 | |
| PRK06266 | 178 | transcription initiation factor E subunit alpha; V | 84.49 | |
| TIGR02443 | 59 | conserved hypothetical metal-binding protein. Memb | 84.46 | |
| KOG2906 | 105 | consensus RNA polymerase III subunit C11 [Transcri | 84.36 | |
| PF00325 | 32 | Crp: Bacterial regulatory proteins, crp family; In | 84.0 | |
| TIGR02605 | 52 | CxxC_CxxC_SSSS putative regulatory protein, FmdB f | 83.95 | |
| PF04161 | 208 | Arv1: Arv1-like family ; InterPro: IPR007290 Arv1 | 83.94 | |
| PF08646 | 146 | Rep_fac-A_C: Replication factor-A C terminal domai | 83.92 | |
| smart00342 | 84 | HTH_ARAC helix_turn_helix, arabinose operon contro | 83.88 | |
| PRK04217 | 110 | hypothetical protein; Provisional | 83.71 | |
| TIGR01321 | 94 | TrpR trp operon repressor, proteobacterial. This m | 83.51 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 83.32 | |
| PF00392 | 64 | GntR: Bacterial regulatory proteins, gntR family; | 83.11 | |
| TIGR01610 | 95 | phage_O_Nterm phage replication protein O, N-termi | 83.06 | |
| PF09723 | 42 | Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR0134 | 82.98 | |
| COG1996 | 49 | RPC10 DNA-directed RNA polymerase, subunit RPC10 ( | 82.94 | |
| TIGR00122 | 69 | birA_repr_reg BirA biotin operon repressor domain. | 82.88 | |
| PF08280 | 59 | HTH_Mga: M protein trans-acting positive regulator | 82.74 | |
| PF10122 | 51 | Mu-like_Com: Mu-like prophage protein Com; InterPr | 82.73 | |
| PRK02935 | 110 | hypothetical protein; Provisional | 82.68 | |
| PF02082 | 83 | Rrf2: Transcriptional regulator; InterPro: IPR0009 | 82.26 | |
| COG1326 | 201 | Uncharacterized archaeal Zn-finger protein [Genera | 82.11 | |
| PF14122 | 87 | YokU: YokU-like protein | 82.08 | |
| COG1522 | 154 | Lrp Transcriptional regulators [Transcription] | 82.0 | |
| PRK05949 | 327 | RNA polymerase sigma factor; Validated | 81.93 | |
| COG1327 | 156 | Predicted transcriptional regulator, consists of a | 81.49 | |
| PF02042 | 52 | RWP-RK: RWP-RK domain; InterPro: IPR003035 This do | 81.27 | |
| PF01726 | 65 | LexA_DNA_bind: LexA DNA binding domain; InterPro: | 81.23 | |
| PHA02942 | 383 | putative transposase; Provisional | 81.07 | |
| PF05876 | 557 | Terminase_GpA: Phage terminase large subunit (GpA) | 81.05 | |
| TIGR02479 | 224 | FliA_WhiG RNA polymerase sigma factor, FliA/WhiG f | 80.96 | |
| COG1191 | 247 | FliA DNA-directed RNA polymerase specialized sigma | 80.95 | |
| PF12773 | 50 | DZR: Double zinc ribbon | 80.93 | |
| PRK11337 | 292 | DNA-binding transcriptional repressor RpiR; Provis | 80.93 | |
| TIGR02395 | 429 | rpoN_sigma RNA polymerase sigma-54 factor. A sigma | 80.56 | |
| smart00344 | 108 | HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto | 80.37 | |
| PF10058 | 54 | DUF2296: Predicted integral membrane metal-binding | 80.13 | |
| PRK13130 | 56 | H/ACA RNA-protein complex component Nop10p; Review | 80.09 | |
| PF05225 | 45 | HTH_psq: helix-turn-helix, Psq domain; InterPro: I | 80.02 |
| >KOG1597 consensus Transcription initiation factor TFIIB [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-76 Score=507.69 Aligned_cols=301 Identities=58% Similarity=0.902 Sum_probs=281.3
Q ss_pred CCCCCCCCCCc-eeeeCCCCceEcCCCcccccCcccccccccccccCCCCCCCCCccCCCCCCcccCCCcceEEecCCCC
Q 021438 4 SYCADCKRLTE-VVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANESSDHDPVRVGGPLNPLLSGGGLSTVIAKPTAG 82 (312)
Q Consensus 4 ~~Cp~Cg~~~~-ii~D~~~G~~vC~~CG~Vv~e~~id~~~ewr~f~~~~~~~~~~r~G~~~~~~~~~~~~~t~i~~~~~~ 82 (312)
+.||+|+..+. +++|+.+|++||..||+|+++++||.++|||+|++|+++.||+|||++.||++.++++.|+|+++. +
T Consensus 1 ~~c~~C~~~~~~~V~d~~~gdtvC~~CGlVl~~r~Id~~sEwrtfsnd~~~~DPsrvG~~sNPlL~~g~L~T~I~~g~-g 79 (308)
T KOG1597|consen 1 MTCPDCKRHPENLVEDHSAGDTVCSECGLVLEDRIIDEGSEWRTFSNDDSDADPSRVGASSNPLLDGGDLSTFISKGT-G 79 (308)
T ss_pred CCCCCCCCCCCCeeeeccCCceecccCCeeeccccccccccccccccCCCCCCccccCCCCCCCCCCCCcceeeecCC-C
Confidence 47999998665 999999999999999999999999999999999999989999999999999999999999999987 4
Q ss_pred CCcccccccchhcccc--CCcchhhHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHHHH
Q 021438 83 GSTELLSGSLGKLQAR--SSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIAC 160 (312)
Q Consensus 83 ~~~~~~~~~l~~~~~~--~~~~e~~l~~~~~~I~~~~~~L~Lp~~v~~~A~~i~~~~~~~~~~~gr~~~~iaaAcly~ac 160 (312)
.++.+++ .|.+||++ +++.|+.+..+|..|..||+.++||..+.+.|.++|+++.+.+.++||+.++++|||||+||
T Consensus 80 ~~s~~~s-~l~~~Q~~~sm~~~d~~~~~a~~~I~~m~d~~~Lp~~I~d~A~~ifk~v~~~k~lrGks~eai~AAclyiAC 158 (308)
T KOG1597|consen 80 TSSSFAS-SLGKAQNRNSMSNSDRVLKAAFKEITAMCDRLSLPATIKDRANEIFKLVEDSKLLRGKSVEALAAACLYIAC 158 (308)
T ss_pred CCHHHHH-HHHHHhcccccCCccHHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHHHhhhhcCccHHHHHHHHHHHHH
Confidence 4444443 38899985 56889999999999999999999999999999999999999999999999999999999999
Q ss_pred HHhCCCCCHHHHHHHhcCCCHHHHHHHHHHHHHHHhhhhccccccCCCCHHHHHHHHHhhcCCCHHHHHHHHHHHHHhhh
Q 021438 161 RQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED 240 (312)
Q Consensus 161 r~~~~p~tl~dia~~~~~v~~~~i~~~~~~l~~~l~~~~~~~~~~~~~~p~~~i~r~~~~L~l~~~v~~~A~~i~~~~~~ 240 (312)
|+++.|||++||+.++ +++.++|++.++.|.+.|+.. .+....+..+||+|||+.|+|+.+++..|.++++.+.+
T Consensus 159 Rq~~~pRT~kEI~~~a-nv~kKEIgr~~K~i~~~l~~s----~~~~s~~t~~~m~RFCs~L~L~~~~q~aA~e~a~ka~~ 233 (308)
T KOG1597|consen 159 RQEDVPRTFKEISAVA-NVSKKEIGRCVKLIGEALETS----VDLISISTGDFMPRFCSNLGLPKSAQEAATEIAEKAEE 233 (308)
T ss_pred HhcCCCchHHHHHHHH-cCCHHHHHHHHHHHHHHHhcc----chhhhhhHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHH
Confidence 9999999999999999 699999999999999998862 23335568999999999999999999999999999998
Q ss_pred --ccCCCChHHHHHHHHHHHHHhcCCCCCHHHHHHHhCcchhHHHHHHHHHHhhhcccCCccccccccccccC
Q 021438 241 --LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDIKNLK 311 (312)
Q Consensus 241 --l~~Gr~P~~iaaAaiyla~~~~~~~~~~~~Ia~~~~vs~~ti~~~~kel~~~~~~~~p~~~~~~~~~~~l~ 311 (312)
+..||+|.+||||+|||+++++..+++++||..++||+++|||+.||+||+++..|+|.||.+++++|+||
T Consensus 234 ~~~~~gRsPiSIAAa~IYmisqls~~kkt~keI~~vtgVaE~TIr~sYK~Lyp~~~~liP~~~a~~~~lk~Lp 306 (308)
T KOG1597|consen 234 MDIRAGRSPISIAAAAIYMISQLSDEKKTQKEIGEVTGVAEVTIRNSYKDLYPHADKLIPSWYANAVPLKNLP 306 (308)
T ss_pred hccccCCCchhHHHHHHHHHHHhccCcccHHHHHHHhhhhHHHHHHHHHHHhhchhhhChhhhccccchhhcC
Confidence 67899999999999999999999999999999999999999999999999999999999999999999998
|
|
| >PRK00423 tfb transcription initiation factor IIB; Reviewed | Back alignment and domain information |
|---|
| >COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] | Back alignment and domain information |
|---|
| >KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG0835 consensus Cyclin L [General function prediction only] | Back alignment and domain information |
|---|
| >PF00382 TFIIB: Transcription factor TFIIB repeat; InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) | Back alignment and domain information |
|---|
| >KOG0834 consensus CDK9 kinase-activating protein cyclin T [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00382 TFIIB: Transcription factor TFIIB repeat; InterPro: IPR013150 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) | Back alignment and domain information |
|---|
| >TIGR00569 ccl1 cyclin ccl1 | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5333 CCL1 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00423 tfb transcription initiation factor IIB; Reviewed | Back alignment and domain information |
|---|
| >KOG0794 consensus CDK8 kinase-activating protein cyclin C [Transcription] | Back alignment and domain information |
|---|
| >COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription] | Back alignment and domain information |
|---|
| >KOG1597 consensus Transcription initiation factor TFIIB [Transcription] | Back alignment and domain information |
|---|
| >cd00043 CYCLIN Cyclin box fold | Back alignment and domain information |
|---|
| >smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma | Back alignment and domain information |
|---|
| >cd00043 CYCLIN Cyclin box fold | Back alignment and domain information |
|---|
| >smart00385 CYCLIN domain present in cyclins, TFIIB and Retinoblastoma | Back alignment and domain information |
|---|
| >KOG0656 consensus G1/S-specific cyclin D [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG5024 Cyclin [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2496 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0653 consensus Cyclin B and related kinase-activating proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00134 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) | Back alignment and domain information |
|---|
| >KOG1598 consensus Transcription initiation factor TFIIIB, Brf1 subunit [Transcription] | Back alignment and domain information |
|---|
| >PF02984 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR004367 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) | Back alignment and domain information |
|---|
| >KOG4557 consensus Origin recognition complex, subunit 6 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF01857 RB_B: Retinoblastoma-associated protein B domain; InterPro: IPR002719 Retinoblastoma-like and retinoblastoma-associated proteins may have a function in cell cycle regulation | Back alignment and domain information |
|---|
| >KOG0655 consensus G1/S-specific cyclin E [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] | Back alignment and domain information |
|---|
| >PHA00626 hypothetical protein | Back alignment and domain information |
|---|
| >PF08792 A2L_zn_ribbon: A2L zinc ribbon domain; InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors [] | Back alignment and domain information |
|---|
| >KOG0835 consensus Cyclin L [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00415 rps27e 30S ribosomal protein S27e; Reviewed | Back alignment and domain information |
|---|
| >COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14803 Nudix_N_2: Nudix N-terminal; PDB: 3CNG_C | Back alignment and domain information |
|---|
| >PF02984 Cyclin_C: Cyclin, C-terminal domain; InterPro: IPR004367 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) | Back alignment and domain information |
|---|
| >PF01667 Ribosomal_S27e: Ribosomal protein S27; InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase | Back alignment and domain information |
|---|
| >PLN00209 ribosomal protein S27; Provisional | Back alignment and domain information |
|---|
| >PF01857 RB_B: Retinoblastoma-associated protein B domain; InterPro: IPR002719 Retinoblastoma-like and retinoblastoma-associated proteins may have a function in cell cycle regulation | Back alignment and domain information |
|---|
| >PRK00420 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF02150 RNA_POL_M_15KD: RNA polymerases M/15 Kd subunit; InterPro: IPR001529 DNA-directed RNA polymerases 2 | Back alignment and domain information |
|---|
| >PTZ00083 40S ribosomal protein S27; Provisional | Back alignment and domain information |
|---|
| >PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional | Back alignment and domain information |
|---|
| >PF13240 zinc_ribbon_2: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF00134 Cyclin_N: Cyclin, N-terminal domain; InterPro: IPR006671 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) | Back alignment and domain information |
|---|
| >PF08274 PhnA_Zn_Ribbon: PhnA Zinc-Ribbon ; InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues | Back alignment and domain information |
|---|
| >PRK10220 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01206 lysW lysine biosynthesis protein LysW | Back alignment and domain information |
|---|
| >PRK00432 30S ribosomal protein S27ae; Validated | Back alignment and domain information |
|---|
| >KOG0834 consensus CDK9 kinase-activating protein cyclin T [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11827 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00569 ccl1 cyclin ccl1 | Back alignment and domain information |
|---|
| >PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines | Back alignment and domain information |
|---|
| >PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues | Back alignment and domain information |
|---|
| >PF08613 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) | Back alignment and domain information |
|---|
| >COG2835 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0654 consensus G2/Mitotic-specific cyclin A [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain | Back alignment and domain information |
|---|
| >PF08273 Prim_Zn_Ribbon: Zinc-binding domain of primase-helicase; InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4 | Back alignment and domain information |
|---|
| >COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF03966 Trm112p: Trm112p-like protein; InterPro: IPR005651 This family of short proteins have no known function | Back alignment and domain information |
|---|
| >smart00661 RPOL9 RNA polymerase subunit 9 | Back alignment and domain information |
|---|
| >PF14354 Lar_restr_allev: Restriction alleviation protein Lar | Back alignment and domain information |
|---|
| >TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 | Back alignment and domain information |
|---|
| >TIGR02393 RpoD_Cterm RNA polymerase sigma factor RpoD, C-terminal domain | Back alignment and domain information |
|---|
| >PRK00464 nrdR transcriptional regulator NrdR; Validated | Back alignment and domain information |
|---|
| >KOG4164 consensus Cyclin ik3-1/CABLES [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B | Back alignment and domain information |
|---|
| >TIGR03655 anti_R_Lar restriction alleviation protein, Lar family | Back alignment and domain information |
|---|
| >PRK07408 RNA polymerase sigma factor SigF; Reviewed | Back alignment and domain information |
|---|
| >TIGR00686 phnA alkylphosphonate utilization operon protein PhnA | Back alignment and domain information |
|---|
| >PF09297 zf-NADH-PPase: NADH pyrophosphatase zinc ribbon domain; InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains | Back alignment and domain information |
|---|
| >COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription] | Back alignment and domain information |
|---|
| >PF06677 Auto_anti-p27: Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27); InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27) | Back alignment and domain information |
|---|
| >TIGR00244 transcriptional regulator NrdR | Back alignment and domain information |
|---|
| >PF12760 Zn_Tnp_IS1595: Transposase zinc-ribbon domain; InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc | Back alignment and domain information |
|---|
| >PRK14892 putative transcription elongation factor Elf1; Provisional | Back alignment and domain information |
|---|
| >PF13719 zinc_ribbon_5: zinc-ribbon domain | Back alignment and domain information |
|---|
| >PF13730 HTH_36: Helix-turn-helix domain | Back alignment and domain information |
|---|
| >PF13613 HTH_Tnp_4: Helix-turn-helix of DDE superfamily endonuclease | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >PF09862 DUF2089: Protein of unknown function (DUF2089); InterPro: IPR018658 This family consists of various hypothetical prokaryotic proteins | Back alignment and domain information |
|---|
| >PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A | Back alignment and domain information |
|---|
| >PF08613 Cyclin: Cyclin; InterPro: IPR013922 Cyclins are eukaryotic proteins that play an active role in controlling nuclear cell division cycles [], and regulate cyclin dependent kinases (CDKs) | Back alignment and domain information |
|---|
| >PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >KOG1779 consensus 40s ribosomal protein S27 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets | Back alignment and domain information |
|---|
| >KOG4557 consensus Origin recognition complex, subunit 6 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family | Back alignment and domain information |
|---|
| >PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PRK05657 RNA polymerase sigma factor RpoS; Validated | Back alignment and domain information |
|---|
| >smart00834 CxxC_CXXC_SSSS Putative regulatory protein | Back alignment and domain information |
|---|
| >PRK09210 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >PF07282 OrfB_Zn_ribbon: Putative transposase DNA-binding domain; InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins | Back alignment and domain information |
|---|
| >PRK12495 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13936 HTH_38: Helix-turn-helix domain; PDB: 2W48_A | Back alignment and domain information |
|---|
| >PF01096 TFIIS_C: Transcription factor S-II (TFIIS); InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR01384 TFS_arch transcription factor S, archaeal | Back alignment and domain information |
|---|
| >KOG1010 consensus Rb (Retinoblastoma tumor suppressor)-related protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13384 HTH_23: Homeodomain-like domain; PDB: 2X48_C | Back alignment and domain information |
|---|
| >smart00440 ZnF_C2C2 C2C2 Zinc finger | Back alignment and domain information |
|---|
| >PTZ00255 60S ribosomal protein L37a; Provisional | Back alignment and domain information |
|---|
| >COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02394 rpoS_proteo RNA polymerase sigma factor RpoS | Back alignment and domain information |
|---|
| >PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes | Back alignment and domain information |
|---|
| >PF05129 Elf1: Transcription elongation factor Elf1 like; InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines | Back alignment and domain information |
|---|
| >COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF00356 LacI: Bacterial regulatory proteins, lacI family; InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >smart00659 RPOLCX RNA polymerase subunit CX | Back alignment and domain information |
|---|
| >PRK00135 scpB segregation and condensation protein B; Reviewed | Back alignment and domain information |
|---|
| >COG5333 CCL1 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12286 rpmF 50S ribosomal protein L32; Reviewed | Back alignment and domain information |
|---|
| >PF05460 ORC6: Origin recognition complex subunit 6 (ORC6); InterPro: IPR008721 The Origin Recognition Complex (ORC) is a six-subunit ATP-dependent DNA-binding complex encoded in yeast by ORC1-6 [] | Back alignment and domain information |
|---|
| >PF00196 GerE: Bacterial regulatory proteins, luxR family; InterPro: IPR000792 This domain is a DNA-binding, helix-turn-helix (HTH) domain of about 65 amino acids, present in transcription regulators of the LuxR/FixJ family of response regulators | Back alignment and domain information |
|---|
| >PF03119 DNA_ligase_ZBD: NAD-dependent DNA ligase C4 zinc finger domain; InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A | Back alignment and domain information |
|---|
| >PRK05901 RNA polymerase sigma factor; Provisional | Back alignment and domain information |
|---|
| >cd00092 HTH_CRP helix_turn_helix, cAMP Regulatory protein C-terminus; DNA binding domain of prokaryotic regulatory proteins belonging to the catabolite activator protein family | Back alignment and domain information |
|---|
| >smart00421 HTH_LUXR helix_turn_helix, Lux Regulon | Back alignment and domain information |
|---|
| >TIGR00280 L37a ribosomal protein L37a | Back alignment and domain information |
|---|
| >COG5349 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF03604 DNA_RNApol_7kD: DNA directed RNA polymerase, 7 kDa subunit; InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates | Back alignment and domain information |
|---|
| >PF01371 Trp_repressor: Trp repressor protein; InterPro: IPR000831 The Trp repressor (TrpR) binds to at least five operators in the Escherichia coli genome, repressing gene expression | Back alignment and domain information |
|---|
| >smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein | Back alignment and domain information |
|---|
| >PRK05978 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11169 leucine-responsive transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PF02796 HTH_7: Helix-turn-helix domain of resolvase; InterPro: IPR006120 Site-specific recombination plays an important role in DNA rearrangement in prokaryotic organisms | Back alignment and domain information |
|---|
| >PRK07406 RNA polymerase sigma factor RpoD; Validated | Back alignment and domain information |
|---|
| >PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 | Back alignment and domain information |
|---|
| >smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein | Back alignment and domain information |
|---|
| >PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >COG4640 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >PF01022 HTH_5: Bacterial regulatory protein, arsR family; InterPro: IPR001845 Bacterial transcription regulatory proteins that bind DNA via a helix-turn-helix (HTH) motif can be grouped into families on the basis of sequence similarities | Back alignment and domain information |
|---|
| >PRK09678 DNA-binding transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK07405 RNA polymerase sigma factor SigD; Validated | Back alignment and domain information |
|---|
| >smart00345 HTH_GNTR helix_turn_helix gluconate operon transcriptional repressor | Back alignment and domain information |
|---|
| >PRK11179 DNA-binding transcriptional regulator AsnC; Provisional | Back alignment and domain information |
|---|
| >TIGR03879 near_KaiC_dom probable regulatory domain | Back alignment and domain information |
|---|
| >COG1725 Predicted transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed | Back alignment and domain information |
|---|
| >COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown] | Back alignment and domain information |
|---|
| >PF01783 Ribosomal_L32p: Ribosomal L32p protein family; InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >PHA02591 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05911 RNA polymerase sigma factor sigma-28; Reviewed | Back alignment and domain information |
|---|
| >PRK08402 replication factor A; Reviewed | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >cd06571 Bac_DnaA_C C-terminal domain of bacterial DnaA proteins | Back alignment and domain information |
|---|
| >PF08281 Sigma70_r4_2: Sigma-70, region 4; InterPro: IPR013249 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription | Back alignment and domain information |
|---|
| >PF09855 DUF2082: Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082); InterPro: IPR018652 This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins | Back alignment and domain information |
|---|
| >PF13542 HTH_Tnp_ISL3: Helix-turn-helix domain of transposase family ISL3 | Back alignment and domain information |
|---|
| >PF13717 zinc_ribbon_4: zinc-ribbon domain | Back alignment and domain information |
|---|
| >KOG2496 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism | Back alignment and domain information |
|---|
| >cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins | Back alignment and domain information |
|---|
| >TIGR01031 rpmF_bact ribosomal protein L32 | Back alignment and domain information |
|---|
| >TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial | Back alignment and domain information |
|---|
| >PF14255 Cys_rich_CPXG: Cysteine-rich CPXCG | Back alignment and domain information |
|---|
| >PRK09710 lar restriction alleviation and modification protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06266 transcription initiation factor E subunit alpha; Validated | Back alignment and domain information |
|---|
| >TIGR02443 conserved hypothetical metal-binding protein | Back alignment and domain information |
|---|
| >KOG2906 consensus RNA polymerase III subunit C11 [Transcription] | Back alignment and domain information |
|---|
| >PF00325 Crp: Bacterial regulatory proteins, crp family; InterPro: IPR001808 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif | Back alignment and domain information |
|---|
| >TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family | Back alignment and domain information |
|---|
| >PF04161 Arv1: Arv1-like family ; InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis | Back alignment and domain information |
|---|
| >PF08646 Rep_fac-A_C: Replication factor-A C terminal domain; InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing | Back alignment and domain information |
|---|
| >smart00342 HTH_ARAC helix_turn_helix, arabinose operon control protein | Back alignment and domain information |
|---|
| >PRK04217 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01321 TrpR trp operon repressor, proteobacterial | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >PF00392 GntR: Bacterial regulatory proteins, gntR family; InterPro: IPR000524 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities | Back alignment and domain information |
|---|
| >TIGR01610 phage_O_Nterm phage replication protein O, N-terminal domain | Back alignment and domain information |
|---|
| >PF09723 Zn-ribbon_8: Zinc ribbon domain; InterPro: IPR013429 This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria | Back alignment and domain information |
|---|
| >COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription] | Back alignment and domain information |
|---|
| >TIGR00122 birA_repr_reg BirA biotin operon repressor domain | Back alignment and domain information |
|---|
| >PF08280 HTH_Mga: M protein trans-acting positive regulator (MGA) HTH domain; InterPro: IPR013199 Mga is a DNA-binding protein that activates the expression of several important virulence genes in group A streptococcus in response to changing environmental conditions [] | Back alignment and domain information |
|---|
| >PF10122 Mu-like_Com: Mu-like prophage protein Com; InterPro: IPR019294 Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ] | Back alignment and domain information |
|---|
| >PRK02935 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp | Back alignment and domain information |
|---|
| >COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14122 YokU: YokU-like protein | Back alignment and domain information |
|---|
| >COG1522 Lrp Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >PRK05949 RNA polymerase sigma factor; Validated | Back alignment and domain information |
|---|
| >COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription] | Back alignment and domain information |
|---|
| >PF02042 RWP-RK: RWP-RK domain; InterPro: IPR003035 This domain is named RWP-RK after a conserved motif at the C terminus of the domain | Back alignment and domain information |
|---|
| >PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria | Back alignment and domain information |
|---|
| >PHA02942 putative transposase; Provisional | Back alignment and domain information |
|---|
| >PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA | Back alignment and domain information |
|---|
| >TIGR02479 FliA_WhiG RNA polymerase sigma factor, FliA/WhiG family | Back alignment and domain information |
|---|
| >COG1191 FliA DNA-directed RNA polymerase specialized sigma subunit [Transcription] | Back alignment and domain information |
|---|
| >PF12773 DZR: Double zinc ribbon | Back alignment and domain information |
|---|
| >PRK11337 DNA-binding transcriptional repressor RpiR; Provisional | Back alignment and domain information |
|---|
| >TIGR02395 rpoN_sigma RNA polymerase sigma-54 factor | Back alignment and domain information |
|---|
| >smart00344 HTH_ASNC helix_turn_helix ASNC type | Back alignment and domain information |
|---|
| >PF10058 DUF2296: Predicted integral membrane metal-binding protein (DUF2296); InterPro: IPR019273 This domain, found mainly in the eukaryotic lunapark proteins, has no known function [] | Back alignment and domain information |
|---|
| >PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed | Back alignment and domain information |
|---|
| >PF05225 HTH_psq: helix-turn-helix, Psq domain; InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 312 | ||||
| 1c9b_A | 207 | Crystal Structure Of A Human Tbp Core Domain-Human | 5e-38 | ||
| 2phg_A | 206 | Model For Vp16 Binding To Tfiib Length = 206 | 2e-37 | ||
| 1tfb_A | 208 | Nmr Studies Of Human General Transcription Factor T | 3e-37 | ||
| 1vol_A | 204 | Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEME | 3e-35 | ||
| 3k7a_M | 345 | Crystal Structure Of An Rna Polymerase Ii-Tfiib Com | 2e-26 | ||
| 1d3u_B | 201 | Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BBRE+T | 1e-19 | ||
| 1ais_B | 200 | Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BTATA- | 1e-19 | ||
| 1rly_A | 60 | Rdc-Derived Models Of The Zinc Ribbon Domain Of Hum | 9e-05 | ||
| 1dl6_A | 58 | Solution Structure Of Human Tfiib N-Terminal Domain | 1e-04 | ||
| 3k1f_M | 197 | Crystal Structure Of Rna Polymerase Ii In Complex W | 2e-04 |
| >pdb|1C9B|A Chain A, Crystal Structure Of A Human Tbp Core Domain-Human Tfiib Core Domain Complex Bound To An Extended, Modified Adenoviral Major Late Promoter (Admlp) Length = 207 | Back alignment and structure |
|
| >pdb|2PHG|A Chain A, Model For Vp16 Binding To Tfiib Length = 206 | Back alignment and structure |
| >pdb|1TFB|A Chain A, Nmr Studies Of Human General Transcription Factor Tfiib: Dynamics And Interaction With Vp16 Activation Domain, 20 Structures Length = 208 | Back alignment and structure |
| >pdb|1VOL|A Chain A, Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEMENT Ternary Complex Length = 204 | Back alignment and structure |
| >pdb|3K7A|M Chain M, Crystal Structure Of An Rna Polymerase Ii-Tfiib Complex Length = 345 | Back alignment and structure |
| >pdb|1D3U|B Chain B, Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BBRE+TATA- Box Complex From Pyrococcus Woesei Length = 201 | Back alignment and structure |
| >pdb|1AIS|B Chain B, Tata-Binding ProteinTRANSCRIPTION FACTOR (II)BTATA-Box Complex From Pyrococcus Woesei Length = 200 | Back alignment and structure |
| >pdb|1RLY|A Chain A, Rdc-Derived Models Of The Zinc Ribbon Domain Of Human General Transcription Tfiib (Zinc Bound Structures) Length = 60 | Back alignment and structure |
| >pdb|1DL6|A Chain A, Solution Structure Of Human Tfiib N-Terminal Domain Length = 58 | Back alignment and structure |
| >pdb|3K1F|M Chain M, Crystal Structure Of Rna Polymerase Ii In Complex With Tfiib Length = 197 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 312 | |||
| 3k7a_M | 345 | Transcription initiation factor IIB; RNA polymeras | 5e-73 | |
| 1c9b_A | 207 | General transcription factor IIB; protein-DNA comp | 1e-58 | |
| 1ais_B | 200 | TFB TFIIB, protein (transcription initiation facto | 4e-55 | |
| 1ais_B | 200 | TFB TFIIB, protein (transcription initiation facto | 7e-11 | |
| 1ais_B | 200 | TFB TFIIB, protein (transcription initiation facto | 8e-06 | |
| 3k1f_M | 197 | Transcription initiation factor IIB; RNA polymeras | 8e-24 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 9e-13 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 6e-12 | |
| 1zp2_A | 235 | RNA polymerase II holoenzyme cyclin-like subunit; | 6e-07 | |
| 2i53_A | 258 | Cyclin K; cell cycle, transcription, cyclin BOX, C | 9e-07 | |
| 2ivx_A | 257 | Cyclin-T2; transcription regulation, cell division | 2e-06 | |
| 2b9r_A | 269 | Human cyclin B1; cell cycle; 2.90A {Homo sapiens} | 2e-05 | |
| 2pk2_A | 358 | Cyclin-T1, protein TAT; TAR, twinning, transcripti | 4e-05 | |
| 2cch_B | 260 | Cyclin A2, cyclin-A; complex(transferase/cell divi | 8e-05 | |
| 3g33_B | 306 | CCND3 protein; Ser/Thr protein kinase, cell cycle, | 8e-04 |
| >3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} Length = 345 | Back alignment and structure |
|---|
Score = 227 bits (580), Expect = 5e-73
Identities = 98/317 (30%), Positives = 148/317 (46%), Gaps = 13/317 (4%)
Query: 6 CADCKRL-TEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANE-SSDHDPVRVGGPL 63
C +CK ++V S GD +C+ CGLVL VD SEWR F+N+ + DP RVG
Sbjct: 24 CPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEAS 83
Query: 64 NPLLSGGGLSTVIAKPTAGGSTELLSGSLGKLQARSSHPDRNLIQAFKSISAMSDRLGLV 123
NPLL G LST I K + + + D + AF I+ + D L
Sbjct: 84 NPLLDGNNLSTRIGKGETTDMRFTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELP 143
Query: 124 TTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYIACRQENKPRTVKEFCSVANGTTKKE 183
+KD A E YK D+K L+G++ E+I+AA + I CR+ RT KE S+ + KE
Sbjct: 144 KIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILIGCRRAEVARTFKEIQSLIH-VKTKE 202
Query: 184 IGRAKEFIVKHLE------AEMGQSVEMGTIHASDYLRRFCSNLGMTNQAVKAAQEAVQK 237
G+ + L + M Y+ RFCS+LG+ Q +A+ +K
Sbjct: 203 FGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAEYTAKK 262
Query: 238 SEDLDI--RRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLAR 295
+++ +SPI++A IY+ L ++ +V EGTIK+ YK L+ H +
Sbjct: 263 CKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIKSGYKILYEHRDK 322
Query: 296 IIPDWFANEE--DIKNL 310
++ + NL
Sbjct: 323 LVDPQLIANGVVSLDNL 339
|
| >1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* Length = 207 | Back alignment and structure |
|---|
| >1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 | Back alignment and structure |
|---|
| >1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 | Back alignment and structure |
|---|
| >1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* Length = 200 | Back alignment and structure |
|---|
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197 | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A Length = 58 | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 Length = 50 | Back alignment and structure |
|---|
| >1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} Length = 235 | Back alignment and structure |
|---|
| >2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 Length = 258 | Back alignment and structure |
|---|
| >2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* Length = 257 | Back alignment and structure |
|---|
| >2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* Length = 269 | Back alignment and structure |
|---|
| >2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C Length = 358 | Back alignment and structure |
|---|
| >2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... Length = 260 | Back alignment and structure |
|---|
| >3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 312 | |||
| 4bbr_M | 345 | Transcription initiation factor IIB; RNA polymeras | 100.0 | |
| 3k7a_M | 345 | Transcription initiation factor IIB; RNA polymeras | 100.0 | |
| 1c9b_A | 207 | General transcription factor IIB; protein-DNA comp | 100.0 | |
| 1ais_B | 200 | TFB TFIIB, protein (transcription initiation facto | 100.0 | |
| 1zp2_A | 235 | RNA polymerase II holoenzyme cyclin-like subunit; | 99.94 | |
| 2ivx_A | 257 | Cyclin-T2; transcription regulation, cell division | 99.92 | |
| 2i53_A | 258 | Cyclin K; cell cycle, transcription, cyclin BOX, C | 99.92 | |
| 2b9r_A | 269 | Human cyclin B1; cell cycle; 2.90A {Homo sapiens} | 99.91 | |
| 3rgf_B | 285 | Cyclin-C; protein kinase complex, transferase,tran | 99.9 | |
| 2cch_B | 260 | Cyclin A2, cyclin-A; complex(transferase/cell divi | 99.89 | |
| 2w96_A | 271 | G1/S-specific cyclin-D1; serine/threonine-protein | 99.88 | |
| 2pk2_A | 358 | Cyclin-T1, protein TAT; TAR, twinning, transcripti | 99.88 | |
| 1jkw_A | 323 | Cyclin H; cell cycle, cell division, nuclear prote | 99.85 | |
| 1g3n_C | 257 | V-cyclin; cyclin-dependent kinase, INK4 inhibitor, | 99.85 | |
| 2f2c_A | 254 | Cyclin homolog, V-cyclin; small molecule inhibitor | 99.84 | |
| 1w98_B | 283 | Cyclin E, G1/S-specific cyclin E1; cell cycle, tra | 99.81 | |
| 3g33_B | 306 | CCND3 protein; Ser/Thr protein kinase, cell cycle, | 99.79 | |
| 3k1f_M | 197 | Transcription initiation factor IIB; RNA polymeras | 99.79 | |
| 1dl6_A | 58 | Transcription factor II B (TFIIB); zinc ribbon, ge | 99.73 | |
| 1pft_A | 50 | TFIIB, PFTFIIBN; N-terminal domain, transcription | 99.58 | |
| 1f5q_B | 252 | Gamma herpesvirus cyclin; herpesviral cyclin, cycl | 99.52 | |
| 1ais_B | 200 | TFB TFIIB, protein (transcription initiation facto | 99.51 | |
| 1c9b_A | 207 | General transcription factor IIB; protein-DNA comp | 99.32 | |
| 4bbr_M | 345 | Transcription initiation factor IIB; RNA polymeras | 99.0 | |
| 3k7a_M | 345 | Transcription initiation factor IIB; RNA polymeras | 98.89 | |
| 1zp2_A | 235 | RNA polymerase II holoenzyme cyclin-like subunit; | 98.1 | |
| 3h4c_A | 260 | Transcription factor TFIIB-like; cyclin, transcrip | 97.81 | |
| 2cch_B | 260 | Cyclin A2, cyclin-A; complex(transferase/cell divi | 97.56 | |
| 2b9r_A | 269 | Human cyclin B1; cell cycle; 2.90A {Homo sapiens} | 97.53 | |
| 2i53_A | 258 | Cyclin K; cell cycle, transcription, cyclin BOX, C | 97.52 | |
| 3rgf_B | 285 | Cyclin-C; protein kinase complex, transferase,tran | 97.48 | |
| 2ivx_A | 257 | Cyclin-T2; transcription regulation, cell division | 97.46 | |
| 1jkw_A | 323 | Cyclin H; cell cycle, cell division, nuclear prote | 97.44 | |
| 3m03_A | 95 | ORC6, origin recognition complex subunit 6; helix | 97.28 | |
| 2pk2_A | 358 | Cyclin-T1, protein TAT; TAR, twinning, transcripti | 97.14 | |
| 2f2c_A | 254 | Cyclin homolog, V-cyclin; small molecule inhibitor | 97.0 | |
| 2w96_A | 271 | G1/S-specific cyclin-D1; serine/threonine-protein | 96.98 | |
| 1g3n_C | 257 | V-cyclin; cyclin-dependent kinase, INK4 inhibitor, | 96.89 | |
| 2js4_A | 70 | UPF0434 protein BB2007; NESG, northeast structural | 96.87 | |
| 2jr6_A | 68 | UPF0434 protein NMA0874; solution, structural geno | 96.8 | |
| 2jny_A | 67 | Uncharacterized BCR; structure, CGR1, NESG, struct | 96.77 | |
| 2pk7_A | 69 | Uncharacterized protein; NESG, PLR1, putative tetr | 96.65 | |
| 1qxf_A | 66 | GR2, 30S ribosomal protein S27E; structural genomi | 96.64 | |
| 2hf1_A | 68 | Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A | 96.6 | |
| 1w98_B | 283 | Cyclin E, G1/S-specific cyclin E1; cell cycle, tra | 96.55 | |
| 3j20_W | 63 | 30S ribosomal protein S27E; archaea, archaeal, KIN | 96.54 | |
| 1vq8_Z | 83 | 50S ribosomal protein L37AE; ribosome 50S, protein | 96.48 | |
| 2xzm_6 | 81 | RPS27E; ribosome, translation; 3.93A {Tetrahymena | 96.21 | |
| 2r7g_A | 347 | PP110, retinoblastoma-associated protein, P105-RB, | 96.13 | |
| 3u5c_b | 82 | RP61, YS20, 40S ribosomal protein S27-A; translati | 96.12 | |
| 3g33_B | 306 | CCND3 protein; Ser/Thr protein kinase, cell cycle, | 96.12 | |
| 4ell_A | 411 | Retinoblastoma-associated protein; cyclin fold, tu | 96.12 | |
| 2akl_A | 138 | PHNA-like protein PA0128; two domains, Zn binding | 95.94 | |
| 3iz6_X | 86 | 40S ribosomal protein S27 (S27E); eukaryotic ribos | 95.87 | |
| 2qdj_A | 304 | Retinoblastoma-associated protein; cyclin fold, cy | 95.82 | |
| 3m03_A | 95 | ORC6, origin recognition complex subunit 6; helix | 95.74 | |
| 3j20_Y | 50 | 30S ribosomal protein S27AE; archaea, archaeal, KI | 95.64 | |
| 4elj_A | 656 | Retinoblastoma-associated protein; cyclin fold, tu | 95.53 | |
| 2k4x_A | 55 | 30S ribosomal protein S27AE; metal-binding, ribonu | 95.11 | |
| 2kpi_A | 56 | Uncharacterized protein SCO3027; zinc finger, PSI- | 94.39 | |
| 2r7g_A | 347 | PP110, retinoblastoma-associated protein, P105-RB, | 93.42 | |
| 4elj_A | 656 | Retinoblastoma-associated protein; cyclin fold, tu | 93.22 | |
| 2k5r_A | 97 | Uncharacterized protein XF2673; solution structure | 93.03 | |
| 1twf_I | 122 | B12.6, DNA-directed RNA polymerase II 14.2 kDa pol | 93.0 | |
| 2pmi_B | 293 | PHO85 cyclin PHO80, aminoglycoside anti; cyclin-de | 92.9 | |
| 2jt1_A | 77 | PEFI protein; solution structure, winged helix-tur | 92.34 | |
| 1k81_A | 36 | EIF-2-beta, probable translation initiation factor | 92.26 | |
| 3h0g_I | 113 | DNA-directed RNA polymerases I, II, and III subuni | 92.26 | |
| 6rxn_A | 46 | Rubredoxin; electron transfer(iron-sulfur protein) | 91.59 | |
| 1nui_A | 255 | DNA primase/helicase; zinc-biding domain, toprim f | 91.53 | |
| 2jpc_A | 61 | SSRB; DNA binding protein, structural genomics, PS | 91.16 | |
| 1qyp_A | 57 | RNA polymerase II; transcription, RPB9, Zn ribbon, | 90.92 | |
| 3j21_i | 83 | 50S ribosomal protein L37AE; archaea, archaeal, KI | 90.68 | |
| 1twf_L | 70 | ABC10-alpha, DNA-directed RNA polymerases I, II, a | 90.58 | |
| 4rxn_A | 54 | Rubredoxin; electron transfer(iron-sulfur protein) | 90.45 | |
| 3jyw_9 | 72 | 60S ribosomal protein L43; eukaryotic ribosome, RA | 90.42 | |
| 3h4c_A | 260 | Transcription factor TFIIB-like; cyclin, transcrip | 90.3 | |
| 1jhg_A | 101 | Trp operon repressor; complex (regulatory protein- | 90.06 | |
| 1e8j_A | 52 | Rubredoxin; iron-sulfur-protein, zinc-substitution | 90.05 | |
| 1t6s_A | 162 | Conserved hypothetical protein; A winged helix-tur | 90.0 | |
| 2w7n_A | 101 | TRFB transcriptional repressor protein; INCP, plas | 89.91 | |
| 1je8_A | 82 | Nitrate/nitrite response regulator protein NARL; p | 89.86 | |
| 3iz5_m | 92 | 60S ribosomal protein L43 (L37AE); eukaryotic ribo | 89.85 | |
| 2p7v_B | 68 | Sigma-70, RNA polymerase sigma factor RPOD; RSD, r | 89.84 | |
| 2lnb_A | 80 | Z-DNA-binding protein 1; structural genomics, nort | 89.79 | |
| 1ffk_W | 73 | Ribosomal protein L37AE; ribosome assembly, RNA-RN | 89.79 | |
| 3cc2_Z | 116 | 50S ribosomal protein L37AE, 50S ribosomal protein | 89.78 | |
| 3izc_m | 92 | 60S ribosomal protein RPL43 (L37AE); eukaryotic ri | 89.47 | |
| 3ulq_B | 90 | Transcriptional regulatory protein COMA; tetratric | 89.16 | |
| 1fse_A | 74 | GERE; helix-turn-helix DNA-binding protein transcr | 89.03 | |
| 1tc3_C | 51 | Protein (TC3 transposase); DNA binding, helix-turn | 88.91 | |
| 4a17_Y | 103 | RPL37A, 60S ribosomal protein L32; eukaryotic ribo | 88.63 | |
| 1f5q_B | 252 | Gamma herpesvirus cyclin; herpesviral cyclin, cycl | 88.58 | |
| 2o8x_A | 70 | Probable RNA polymerase sigma-C factor; promoter r | 88.44 | |
| 2qdj_A | 304 | Retinoblastoma-associated protein; cyclin fold, cy | 88.22 | |
| 1x3u_A | 79 | Transcriptional regulatory protein FIXJ; helix-tur | 87.97 | |
| 3qt1_I | 133 | DNA-directed RNA polymerases I, II, and III subun; | 87.68 | |
| 3u50_C | 172 | Telomerase-associated protein 82; TEB1, processivi | 87.61 | |
| 1wii_A | 85 | Hypothetical UPF0222 protein MGC4549; domain of un | 87.4 | |
| 4ell_A | 411 | Retinoblastoma-associated protein; cyclin fold, tu | 87.19 | |
| 1tty_A | 87 | Sigma-A, RNA polymerase sigma factor RPOD; helix-t | 87.19 | |
| 3hug_A | 92 | RNA polymerase sigma factor; ECF sigma factor, zin | 87.18 | |
| 2pmi_B | 293 | PHO85 cyclin PHO80, aminoglycoside anti; cyclin-de | 87.14 | |
| 1ku3_A | 73 | Sigma factor SIGA; helix-turn-helix, transcription | 87.05 | |
| 3c57_A | 95 | Two component transcriptional regulatory protein; | 86.74 | |
| 2rnj_A | 91 | Response regulator protein VRAR; HTH LUXR-type dom | 86.01 | |
| 1gnf_A | 46 | Transcription factor GATA-1; zinc finger, transcri | 85.59 | |
| 1dxg_A | 36 | Desulforedoxin; non-heme iron protein, rubredoxin | 85.26 | |
| 3ga8_A | 78 | HTH-type transcriptional regulator MQSA (YGIT/B30; | 84.94 | |
| 2x48_A | 55 | CAG38821; archeal virus, viral protein; 2.60A {Sul | 84.83 | |
| 1p4w_A | 99 | RCSB; solution structure, DNA binding domain, DNA | 84.57 | |
| 1uxc_A | 65 | FRUR (1-57), fructose repressor; DNA-binding prote | 84.54 | |
| 1qbj_A | 81 | Protein (double-stranded RNA specific adenosine D | 84.48 | |
| 1gh9_A | 71 | 8.3 kDa protein (gene MTH1184); beta+alpha complex | 84.25 | |
| 2v3b_B | 55 | Rubredoxin 2, rubredoxin; alkane degradation, iron | 84.1 | |
| 1tfi_A | 50 | Transcriptional elongation factor SII; transcripti | 83.95 | |
| 3j21_g | 51 | 50S ribosomal protein L40E; archaea, archaeal, KIN | 83.51 | |
| 1qgp_A | 77 | Protein (double stranded RNA adenosine deaminase); | 83.05 | |
| 3i4p_A | 162 | Transcriptional regulator, ASNC family; PSI, struc | 82.9 | |
| 1j1v_A | 94 | Chromosomal replication initiator protein DNAA, 5' | 82.81 | |
| 2heo_A | 67 | Z-DNA binding protein 1; protein DLM1-Z-DNA comple | 82.32 | |
| 2htj_A | 81 | P fimbrial regulatory protein KS71A; winged helix- | 82.16 | |
| 4ham_A | 134 | LMO2241 protein; structural genomics, PSI-biology, | 81.71 | |
| 3neu_A | 125 | LIN1836 protein; structural genomics, PSI-2, prote | 81.63 | |
| 1dx8_A | 70 | Rubredoxin; electron transport, zinc-substitution; | 81.56 | |
| 2vut_I | 43 | AREA, nitrogen regulatory protein AREA; transcript | 81.49 | |
| 1oyi_A | 82 | Double-stranded RNA-binding protein; (alpha+beta) | 81.07 | |
| 1q1h_A | 110 | TFE, transcription factor E, TFE; TFIIE, transcrip | 80.98 | |
| 2apo_B | 60 | Ribosome biogenesis protein NOP10; protein-protein | 80.59 | |
| 2o3f_A | 111 | Putative HTH-type transcriptional regulator YBBH; | 80.52 | |
| 2kn9_A | 81 | Rubredoxin; metalloprotein, ssgcid, structural gen | 80.5 | |
| 2cg4_A | 152 | Regulatory protein ASNC; DNA binding, FFRP, LRP fa | 80.1 | |
| 2e9h_A | 157 | EIF-5, eukaryotic translation initiation factor 5; | 80.09 |
| >4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M | Back alignment and structure |
|---|
Probab=100.00 E-value=9.9e-77 Score=546.87 Aligned_cols=307 Identities=34% Similarity=0.533 Sum_probs=174.4
Q ss_pred CCCCCCCCC-CCceeeeCCCCceEcCCCcccccCcccccccccccccCCC-CCCCCCccCCCCCCcccCCCcceEEecCC
Q 021438 3 DSYCADCKR-LTEVVFDHSAGDTICSECGLVLEAYSVDETSEWRIFANES-SDHDPVRVGGPLNPLLSGGGLSTVIAKPT 80 (312)
Q Consensus 3 ~~~Cp~Cg~-~~~ii~D~~~G~~vC~~CG~Vv~e~~id~~~ewr~f~~~~-~~~~~~r~G~~~~~~~~~~~~~t~i~~~~ 80 (312)
...||+||+ .+++++|+.+|++||++||+|++|++||+|||||+|++|+ ++.|++|+|+|.|+++||+|++|.|+++.
T Consensus 21 ~~~Cp~C~~~~~~lv~D~~~G~~vC~~CGlVl~e~~iD~g~EWR~f~~d~~~~~d~sRvG~~~~~~~~~~glsT~I~~~~ 100 (345)
T 4bbr_M 21 VLTCPECKVYPPKIVERFSEGDVVCALCGLVLSDKLVDTRSEWRTFSNDDHNGDDPSRVGEASNPLLDGNNLSTRIGKGE 100 (345)
T ss_dssp -CCCSSCCCSSCCEEEEGGGTEEEETTTCBEEESCCBCHHHHHTTTSCSCSSSCCSSCCEEEECHHHHCSCCCCEEECCS
T ss_pred CCcCCCCCCCCCceeEECCCCcEEeCCCCCCccCcccccCccccCCCcccccCCCcCCCCCCCCccccCCCcceeecCCC
Confidence 458999997 4589999999999999999999999999999999999775 36889999999999999999999999765
Q ss_pred CCCCcccccccchhcccc--CCcchhhHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHhCCCCCCCCHHHHHHHHHHH
Q 021438 81 AGGSTELLSGSLGKLQAR--SSHPDRNLIQAFKSISAMSDRLGLVTTIKDRANEIYKKVEDQKPLRGRNQEAIVAACLYI 158 (312)
Q Consensus 81 ~~~~~~~~~~~l~~~~~~--~~~~e~~l~~~~~~I~~~~~~L~Lp~~v~~~A~~i~~~~~~~~~~~gr~~~~iaaAcly~ 158 (312)
++++. .+..|++||++ .+++|++|.+|+..|+++|++|+||+.+.++|..||+++++.++++||+.+.++|||||+
T Consensus 101 -~~~~~-~~~~L~r~q~r~~~~~~er~L~~a~~~I~~~~~~L~Lp~~v~d~A~~lyk~a~~~~~~rGrs~e~vaAAclYi 178 (345)
T 4bbr_M 101 -TTDMR-FTKELNKAQGKNVMDKKDNEVQAAFAKITMLCDAAELPKIVKDCAKEAYKLCHDEKTLKGKSMESIMAASILI 178 (345)
T ss_dssp -SCCHH-HHHHHHHHHHHTCCCCSSSSTTHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHTTCTTTTTCCHHHHHHHHHHH
T ss_pred -Ccchh-hHHHHHHHHHhhhcChHHHHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhcCCccCCCHHHHHHHHHHH
Confidence 33311 23458899987 578999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhCCCCCHHHHHHHhcCCCHHHHHHHHHHHHHHHhhhhcc------ccccCCCCHHHHHHHHHhhcCCCHHHHHHHH
Q 021438 159 ACRQENKPRTVKEFCSVANGTTKKEIGRAKEFIVKHLEAEMGQ------SVEMGTIHASDYLRRFCSNLGMTNQAVKAAQ 232 (312)
Q Consensus 159 acr~~~~p~tl~dia~~~~~v~~~~i~~~~~~l~~~l~~~~~~------~~~~~~~~p~~~i~r~~~~L~l~~~v~~~A~ 232 (312)
|||+++.|+|++||++++ ++++++|+++|+.|.+.|++.... ++.+++.+|++||+|||++|+|++++.+.|+
T Consensus 179 ACR~~~~prtl~eI~~~~-~v~~keigr~~k~l~~~L~l~~~~~~~~~~~~~~~~~~p~~~i~Rf~s~L~l~~~v~~~A~ 257 (345)
T 4bbr_M 179 GCRRAEVARTFKEIQSLI-HVKTKEFGKTLNIMKNILRGKSEDGFLKIDTDNMSGAQNLTYIPRFCSHLGLPMQVTTSAE 257 (345)
T ss_dssp HHHHTCCBCCHHHHHHHH-TCCTTHHHHHHHHHHHCC-------------------------------------------
T ss_pred HHHhcCCCccHHHHHHHh-CCCHHHHHHHHHHHHHHhCccccccccccccccCCCCCHHHHHHHHHHHcCCcHHHHHHHH
Confidence 999999999999999999 799999999999999999974211 1236788999999999999999999999999
Q ss_pred HHHHHhhh--ccCCCChHHHHHHHHHHHHHhcCCCCCHHHHHHHhCcchhHHHHHHHHHHhhhcccCCccc-cc-ccccc
Q 021438 233 EAVQKSED--LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWF-AN-EEDIK 308 (312)
Q Consensus 233 ~i~~~~~~--l~~Gr~P~~iaaAaiyla~~~~~~~~~~~~Ia~~~~vs~~ti~~~~kel~~~~~~~~p~~~-~~-~~~~~ 308 (312)
+|++.+.+ +..||+|.+|||||||+|++++|.++|++|||+++|||++|||++||||+++++.|+|+|| .+ .++++
T Consensus 258 ~i~~~~~~~~i~~GR~P~~IAAAaIylAa~l~g~~~t~~eIa~v~~Vse~TIr~rykel~~~~~~l~~~~~~~~~~~~~~ 337 (345)
T 4bbr_M 258 YTAKKCKEIKEIAGKSPITIAVVSIYLNILLFQIPITAAKVGQTLQVTEGTIKSGYKILYEHRDKLVDPQLIANGVVSLD 337 (345)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred HHHHHHHhcccccCCChHHHHHHHHHHHHHHhCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHhhcCHHHhhcccCchh
Confidence 99999998 8899999999999999999999999999999999999999999999999999999996665 43 48999
Q ss_pred ccCC
Q 021438 309 NLKL 312 (312)
Q Consensus 309 ~l~~ 312 (312)
+||.
T Consensus 338 ~l~~ 341 (345)
T 4bbr_M 338 NLPG 341 (345)
T ss_dssp ----
T ss_pred hCCC
Confidence 9994
|
| >3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* | Back alignment and structure |
|---|
| >1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* | Back alignment and structure |
|---|
| >1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* | Back alignment and structure |
|---|
| >2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 | Back alignment and structure |
|---|
| >2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* | Back alignment and structure |
|---|
| >3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... | Back alignment and structure |
|---|
| >2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A | Back alignment and structure |
|---|
| >2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C | Back alignment and structure |
|---|
| >1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A | Back alignment and structure |
|---|
| >1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 | Back alignment and structure |
|---|
| >2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A | Back alignment and structure |
|---|
| >1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 | Back alignment and structure |
|---|
| >3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1dl6_A Transcription factor II B (TFIIB); zinc ribbon, gene regulation; NMR {Homo sapiens} SCOP: g.41.3.1 PDB: 1rly_A 1ro4_A | Back alignment and structure |
|---|
| >1pft_A TFIIB, PFTFIIBN; N-terminal domain, transcription initiation factor; NMR {Pyrococcus furiosus} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 | Back alignment and structure |
|---|
| >1ais_B TFB TFIIB, protein (transcription initiation factor IIB); hyperthermophIle, ribosome binding, complex (ribosome binding/ DNA); HET: DNA 5IU; 2.10A {Pyrococcus woesei} SCOP: a.74.1.2 a.74.1.2 PDB: 1d3u_B* | Back alignment and structure |
|---|
| >1c9b_A General transcription factor IIB; protein-DNA complex, cyclin-like fold, helix-turn-helix, transcription/DNA complex; 2.65A {Homo sapiens} SCOP: a.74.1.2 a.74.1.2 PDB: 1tfb_A 2phg_A 1vol_A* | Back alignment and structure |
|---|
| >4bbr_M Transcription initiation factor IIB; RNA polymerase, TFIIB; 3.40A {Saccharomyces cerevisiae} PDB: 3k7a_M 4bbs_M | Back alignment and structure |
|---|
| >3k7a_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, DNA-binding, DNA- directed RNA polymerase, isopeptide bond, magnesium; 3.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zp2_A RNA polymerase II holoenzyme cyclin-like subunit; cyclin repeat domains, transcription-cell cycle complex; 3.00A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3h4c_A Transcription factor TFIIB-like; cyclin, transcription factor TFIIB repeat; 2.30A {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2cch_B Cyclin A2, cyclin-A; complex(transferase/cell division), ATP-binding, CDK2, cell cycle, cyclin, mitosis, nuclear protein; HET: TPO ATP; 1.7A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1fvv_B* 1jsu_B* 1okv_B 1okw_B* 1ol1_B* 1ol2_B* 1urc_B 1fin_B* 2c5p_B* 2c5o_B* 2i40_B* 2wev_B* 2wfy_B 2whb_B* 3eid_B* 3ej1_B* 3eoc_B* 2wha_B* 2x1n_B* 1vyw_B* ... | Back alignment and structure |
|---|
| >2b9r_A Human cyclin B1; cell cycle; 2.90A {Homo sapiens} PDB: 2jgz_B* | Back alignment and structure |
|---|
| >2i53_A Cyclin K; cell cycle, transcription, cyclin BOX, CDK9, positive transcription elongation factor, P-TEFB; 1.50A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 | Back alignment and structure |
|---|
| >3rgf_B Cyclin-C; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2ivx_A Cyclin-T2; transcription regulation, cell division, phosphorylation, NU protein, cell cycle, transcription; 1.8A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_A 3mi9_B* 3mia_B* 3tnh_B* 3tni_B* 3blh_B* 3blq_B* 3blr_B* 3lq5_B* 3my1_B* 3tn8_B* | Back alignment and structure |
|---|
| >1jkw_A Cyclin H; cell cycle, cell division, nuclear protein; 2.60A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 1kxu_A | Back alignment and structure |
|---|
| >3m03_A ORC6, origin recognition complex subunit 6; helix turn helix, DNA binding protein, origin recognition CO DNA replication; HET: MES; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2pk2_A Cyclin-T1, protein TAT; TAR, twinning, transcription regulation P- TEFB, cell cycle; 2.67A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 PDB: 2w2h_C | Back alignment and structure |
|---|
| >2f2c_A Cyclin homolog, V-cyclin; small molecule inhibitor bound between N-terminal and C-TERM domain of kinase, cell cycle-transferase complex; HET: AP9; 2.80A {Herpesvirus saimiri} SCOP: a.74.1.1 a.74.1.1 PDB: 1jow_A* 2euf_A* 1xo2_A* 1bu2_A | Back alignment and structure |
|---|
| >2w96_A G1/S-specific cyclin-D1; serine/threonine-protein kinase, chromosomal rearrangement, ATP-binding, transferase, polymorphism, cell division; 2.30A {Homo sapiens} PDB: 2w99_A 2w9f_A 2w9z_A | Back alignment and structure |
|---|
| >1g3n_C V-cyclin; cyclin-dependent kinase, INK4 inhibitor, viral cyclin, cell cycle, signaling protein; 2.90A {Human herpesvirus 8} SCOP: a.74.1.1 a.74.1.1 | Back alignment and structure |
|---|
| >2js4_A UPF0434 protein BB2007; NESG, northeast structural genomics consortium, beta, PSI-2, protein structure initiative; NMR {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2jny_A Uncharacterized BCR; structure, CGR1, NESG, structural genomics, PSI-2, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >2pk7_A Uncharacterized protein; NESG, PLR1, putative tetraacyldisaccharide-1-P 4-kinase, Q4K structural genomics, PSI-2; 2.20A {Pseudomonas fluorescens} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >1qxf_A GR2, 30S ribosomal protein S27E; structural genomics, beta sheet, PSI, protein structure initiative; NMR {Archaeoglobus fulgidus} SCOP: g.41.8.4 | Back alignment and structure |
|---|
| >2hf1_A Tetraacyldisaccharide-1-P 4-kinase; LPXK, lipid A biosynthes structural genomics, PSI-2, protein structure initiative; 1.90A {Chromobacterium violaceum} SCOP: b.171.1.1 | Back alignment and structure |
|---|
| >1w98_B Cyclin E, G1/S-specific cyclin E1; cell cycle, transferase; HET: TPO; 2.15A {Homo sapiens} SCOP: a.74.1.1 a.74.1.1 | Back alignment and structure |
|---|
| >3j20_W 30S ribosomal protein S27E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... | Back alignment and structure |
|---|
| >2xzm_6 RPS27E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_6 | Back alignment and structure |
|---|
| >2r7g_A PP110, retinoblastoma-associated protein, P105-RB, RB; retinoblastoma protein, E2F displacement, transcription repressor; 1.67A {Homo sapiens} SCOP: a.74.1.3 a.74.1.3 PDB: 1n4m_A 3pom_A 1gh6_B 1gux_A 1o9k_A 1ad6_A 1gux_B 1o9k_B | Back alignment and structure |
|---|
| >3u5c_b RP61, YS20, 40S ribosomal protein S27-A; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_X 3u5g_b | Back alignment and structure |
|---|
| >3g33_B CCND3 protein; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ell_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor, cell cycle; 1.98A {Homo sapiens} | Back alignment and structure |
|---|
| >2akl_A PHNA-like protein PA0128; two domains, Zn binding protein, beta-strand protein, structural genomics, PSI; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.34.11.2 g.41.3.5 | Back alignment and structure |
|---|
| >3iz6_X 40S ribosomal protein S27 (S27E); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >2qdj_A Retinoblastoma-associated protein; cyclin fold, cyclin wedge, antitumor protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m03_A ORC6, origin recognition complex subunit 6; helix turn helix, DNA binding protein, origin recognition CO DNA replication; HET: MES; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3j20_Y 30S ribosomal protein S27AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4elj_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor protein, phosphorylation, cell; HET: TPO; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2k4x_A 30S ribosomal protein S27AE; metal-binding, ribonucleoprotein, zinc, zinc-finger, structural genomics, PSI-2; NMR {Thermoplasma acidophilum} SCOP: g.41.8.8 | Back alignment and structure |
|---|
| >2kpi_A Uncharacterized protein SCO3027; zinc finger, PSI-2, NESG, all beta, structural genomics, protein structure initiative; NMR {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2r7g_A PP110, retinoblastoma-associated protein, P105-RB, RB; retinoblastoma protein, E2F displacement, transcription repressor; 1.67A {Homo sapiens} SCOP: a.74.1.3 a.74.1.3 PDB: 1n4m_A 3pom_A 1gh6_B 1gux_A 1o9k_A 1ad6_A 1gux_B 1o9k_B | Back alignment and structure |
|---|
| >4elj_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor protein, phosphorylation, cell; HET: TPO; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2k5r_A Uncharacterized protein XF2673; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Xylella fastidiosa TEMECULA1} | Back alignment and structure |
|---|
| >1twf_I B12.6, DNA-directed RNA polymerase II 14.2 kDa polypepti; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.3.1 g.41.3.1 PDB: 1i3q_I 1i6h_I 1k83_I* 1nik_I 1nt9_I 1pqv_I 1r5u_I 1r9s_I* 1r9t_I* 1sfo_I* 1twa_I* 1twc_I* 1i50_I* 1twg_I* 1twh_I* 1wcm_I 1y1v_I 1y1w_I 1y1y_I 1y77_I* ... | Back alignment and structure |
|---|
| >2pmi_B PHO85 cyclin PHO80, aminoglycoside anti; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_B* | Back alignment and structure |
|---|
| >2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >1k81_A EIF-2-beta, probable translation initiation factor 2 beta subunit; zinc ribbon; NMR {Methanocaldococcus jannaschii} SCOP: g.59.1.1 | Back alignment and structure |
|---|
| >3h0g_I DNA-directed RNA polymerases I, II, and III subunit rpabc5; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 | Back alignment and structure |
|---|
| >1nui_A DNA primase/helicase; zinc-biding domain, toprim fold, DNA replication, DNA-direct polymerase, primosome, late protein, ATP-binding; HET: DNA; 2.90A {Enterobacteria phage T7} SCOP: e.13.1.2 g.41.3.2 | Back alignment and structure |
|---|
| >2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1qyp_A RNA polymerase II; transcription, RPB9, Zn ribbon, hyperthermophilic, extremophIle; NMR {Thermococcus celer} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1twf_L ABC10-alpha, DNA-directed RNA polymerases I, II, and III 7.7 K polypeptide; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: g.41.9.2 PDB: 1i3q_L 1i6h_L 1k83_L* 1nik_L 1nt9_L 1pqv_L 1r5u_L 1r9s_L* 1r9t_L* 1sfo_L* 1twa_L* 1twc_L* 1i50_L* 1twg_L* 1twh_L* 1wcm_L 1y1v_L 1y1w_L 1y1y_L 1y77_L* ... | Back alignment and structure |
|---|
| >4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... | Back alignment and structure |
|---|
| >3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} | Back alignment and structure |
|---|
| >3h4c_A Transcription factor TFIIB-like; cyclin, transcription factor TFIIB repeat; 2.30A {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >1jhg_A Trp operon repressor; complex (regulatory protein-peptide), DNA-binding regulatory complex (regulatory protein-peptide) complex; HET: TRP; 1.30A {Escherichia coli} SCOP: a.4.12.1 PDB: 1co0_A* 1mi7_R 1p6z_R 1wrp_R* 1zt9_A* 2oz9_R* 3ssw_R 3wrp_A 1rcs_A* 1wrs_R* 1wrt_R 2xdi_A 3ssx_R* 1trr_A* 1tro_A* | Back alignment and structure |
|---|
| >1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A | Back alignment and structure |
|---|
| >1t6s_A Conserved hypothetical protein; A winged helix-turn-helix, structural genomics, BSGC structu by NIH, protein structure initiative, PSI; 1.95A {Chlorobium tepidum tls} SCOP: a.4.5.60 a.4.5.60 | Back alignment and structure |
|---|
| >2w7n_A TRFB transcriptional repressor protein; INCP, plasmid, repressor, DNA-binding, transcription/DNA; HET: BRU; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >1je8_A Nitrate/nitrite response regulator protein NARL; protein-DNA complex, two-component response regulator, helix-turn-helix, DNA bending; 2.12A {Escherichia coli} SCOP: a.4.6.2 PDB: 1zg1_A 1zg5_A | Back alignment and structure |
|---|
| >2p7v_B Sigma-70, RNA polymerase sigma factor RPOD; RSD, regulator of sigma 70, sigma 70 domain 4, transcription, regulation, helix-turn-helix; 2.60A {Escherichia coli} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >2lnb_A Z-DNA-binding protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* | Back alignment and structure |
|---|
| >3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z | Back alignment and structure |
|---|
| >3ulq_B Transcriptional regulatory protein COMA; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} PDB: 2krf_A | Back alignment and structure |
|---|
| >1fse_A GERE; helix-turn-helix DNA-binding protein transcriptional regulat transcription; 2.05A {Bacillus subtilis} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 | Back alignment and structure |
|---|
| >4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y | Back alignment and structure |
|---|
| >1f5q_B Gamma herpesvirus cyclin; herpesviral cyclin, cyclin dependent kinase. protein/protein complex, transferase; 2.50A {Murid herpesvirus 4} SCOP: a.74.1.1 a.74.1.1 | Back alignment and structure |
|---|
| >2o8x_A Probable RNA polymerase sigma-C factor; promoter recognition, transcription regulation, helix-turn-H motif, transcription; 3.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2qdj_A Retinoblastoma-associated protein; cyclin fold, cyclin wedge, antitumor protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1x3u_A Transcriptional regulatory protein FIXJ; helix-turn-helix; NMR {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3qt1_I DNA-directed RNA polymerases I, II, and III subun; transferase-transcription complex, RNA polymerase II, transc elongation; 4.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wii_A Hypothetical UPF0222 protein MGC4549; domain of unknown function, zinc finger, metal-binding protein, structural genomics; NMR {Mus musculus} SCOP: g.41.3.4 | Back alignment and structure |
|---|
| >4ell_A Retinoblastoma-associated protein; cyclin fold, tumor suppressor, cell cycle; 1.98A {Homo sapiens} | Back alignment and structure |
|---|
| >1tty_A Sigma-A, RNA polymerase sigma factor RPOD; helix-turn-helix, transcription; NMR {Thermotoga maritima} SCOP: a.4.13.2 | Back alignment and structure |
|---|
| >3hug_A RNA polymerase sigma factor; ECF sigma factor, zinc binding anti-sigma factor, oxidative transcription regulation; 2.35A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2pmi_B PHO85 cyclin PHO80, aminoglycoside anti; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_B* | Back alignment and structure |
|---|
| >1ku3_A Sigma factor SIGA; helix-turn-helix, transcription; 1.80A {Thermus aquaticus} SCOP: a.4.13.2 PDB: 1ku7_A 1rio_H 3n97_A* | Back alignment and structure |
|---|
| >3c57_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 1.70A {Mycobacterium tuberculosis} PDB: 1zlk_A 1zlj_A | Back alignment and structure |
|---|
| >2rnj_A Response regulator protein VRAR; HTH LUXR-type domain, DNA binding domain, activator, antibiotic resistance, cytoplasm, DNA-binding; NMR {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
| >1dxg_A Desulforedoxin; non-heme iron protein, rubredoxin type metal center, electron transport; 1.80A {Desulfovibrio gigas} SCOP: g.41.5.2 PDB: 1dcd_A 1dhg_A 1cfw_A 2lk5_A 2lk6_A | Back alignment and structure |
|---|
| >3ga8_A HTH-type transcriptional regulator MQSA (YGIT/B30; helix-turn-helix, Zn-binding protein, DNA-binding, transcrip transcription regulation; HET: PE4; 1.70A {Escherichia coli k-12} PDB: 3hi2_A | Back alignment and structure |
|---|
| >2x48_A CAG38821; archeal virus, viral protein; 2.60A {Sulfolobus islandicus rod-shaped virusorganism_taxid} | Back alignment and structure |
|---|
| >1p4w_A RCSB; solution structure, DNA binding domain, DNA binding protein; NMR {Erwinia amylovora} SCOP: a.4.6.2 | Back alignment and structure |
|---|
| >1uxc_A FRUR (1-57), fructose repressor; DNA-binding protein, LACI family, transc regulation; NMR {Escherichia coli} SCOP: a.35.1.5 PDB: 1uxd_A | Back alignment and structure |
|---|
| >1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A | Back alignment and structure |
|---|
| >1gh9_A 8.3 kDa protein (gene MTH1184); beta+alpha complex structure, structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: g.41.6.1 | Back alignment and structure |
|---|
| >2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1tfi_A Transcriptional elongation factor SII; transcription regulation; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1j1v_A Chromosomal replication initiator protein DNAA, 5'-D(*CP*CP*TP*GP*TP*GP*GP*AP*TP*AP*AP*CP*A)-3'; protein-DNA complex; 2.10A {Escherichia coli} SCOP: a.4.12.2 | Back alignment and structure |
|---|
| >2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A | Back alignment and structure |
|---|
| >2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 | Back alignment and structure |
|---|
| >4ham_A LMO2241 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, winged helix-turn-helix, four helix bundle; 1.91A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3neu_A LIN1836 protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, unknown function; 1.58A {Listeria innocua} | Back alignment and structure |
|---|
| >1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A | Back alignment and structure |
|---|
| >2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* | Back alignment and structure |
|---|
| >1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 | Back alignment and structure |
|---|
| >1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 | Back alignment and structure |
|---|
| >2apo_B Ribosome biogenesis protein NOP10; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: g.41.16.1 PDB: 2aqc_A | Back alignment and structure |
|---|
| >2o3f_A Putative HTH-type transcriptional regulator YBBH; APC85504, putative transcriptional regulator YBBH; HET: MLY; 1.75A {Bacillus subtilis} SCOP: a.4.1.20 | Back alignment and structure |
|---|
| >2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 | Back alignment and structure |
|---|
| >2e9h_A EIF-5, eukaryotic translation initiation factor 5; zinc binding, C4 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 312 | ||||
| d1vola2 | 109 | a.74.1.2 (A:208-316) Transcription factor IIB (TFI | 7e-29 | |
| d1vola2 | 109 | a.74.1.2 (A:208-316) Transcription factor IIB (TFI | 9e-20 | |
| d1aisb1 | 98 | a.74.1.2 (B:1108-1205) Transcription factor IIB (T | 3e-24 | |
| d1aisb1 | 98 | a.74.1.2 (B:1108-1205) Transcription factor IIB (T | 3e-15 | |
| d1vola1 | 95 | a.74.1.2 (A:113-207) Transcription factor IIB (TFI | 2e-22 | |
| d1vola1 | 95 | a.74.1.2 (A:113-207) Transcription factor IIB (TFI | 2e-13 | |
| d1aisb2 | 95 | a.74.1.2 (B:1206-1300) Transcription factor IIB (T | 2e-18 | |
| d1aisb2 | 95 | a.74.1.2 (B:1206-1300) Transcription factor IIB (T | 2e-18 | |
| d1dl6a_ | 58 | g.41.3.1 (A:) Transcription initiation factor TFII | 1e-12 | |
| d1pfta_ | 50 | g.41.3.1 (A:) Transcription initiation factor TFII | 2e-11 | |
| d2cchb1 | 128 | a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [T | 8e-04 | |
| d1jkwa1 | 151 | a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo s | 8e-04 | |
| d2ivxa1 | 143 | a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) | 0.001 | |
| d1g3nc1 | 132 | a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma | 0.001 | |
| d1w98b2 | 140 | a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human | 0.002 | |
| d2i53a1 | 144 | a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) | 0.002 |
| >d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cyclin-like superfamily: Cyclin-like family: Transcription factor IIB (TFIIB), core domain domain: Transcription factor IIB (TFIIB), core domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 104 bits (262), Expect = 7e-29
Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 2/105 (1%)
Query: 208 IHASDYLRRFCSNLGMTNQAVKAAQEAVQKSEDLDIR--RSPISVAAAVIYIITQLSNDT 265
I D++ RFCSNL + Q AA +K+ +LD+ RSPISVAAA IY+ +Q S +
Sbjct: 2 ITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEK 61
Query: 266 KPLKEISIVTRVAEGTIKNVYKDLFPHLARIIPDWFANEEDIKNL 310
+ KEI + VA+ TI+ Y+ ++P + P F + + L
Sbjct: 62 RTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPTDFKFDTPVDKL 106
|
| >d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 98 | Back information, alignment and structure |
|---|
| >d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 98 | Back information, alignment and structure |
|---|
| >d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 95 | Back information, alignment and structure |
|---|
| >d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} Length = 95 | Back information, alignment and structure |
|---|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 50 | Back information, alignment and structure |
|---|
| >d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} Length = 128 | Back information, alignment and structure |
|---|
| >d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} Length = 151 | Back information, alignment and structure |
|---|
| >d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} Length = 143 | Back information, alignment and structure |
|---|
| >d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} Length = 132 | Back information, alignment and structure |
|---|
| >d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 312 | |||
| d1vola2 | 109 | Transcription factor IIB (TFIIB), core domain {Hum | 99.92 | |
| d1aisb2 | 95 | Transcription factor IIB (TFIIB), core domain {Arc | 99.88 | |
| d1vola1 | 95 | Transcription factor IIB (TFIIB), core domain {Hum | 99.87 | |
| d1aisb1 | 98 | Transcription factor IIB (TFIIB), core domain {Arc | 99.87 | |
| d1aisb2 | 95 | Transcription factor IIB (TFIIB), core domain {Arc | 99.82 | |
| d1dl6a_ | 58 | Transcription initiation factor TFIIB, N-terminal | 99.8 | |
| d1vola2 | 109 | Transcription factor IIB (TFIIB), core domain {Hum | 99.8 | |
| d1pfta_ | 50 | Transcription initiation factor TFIIB, N-terminal | 99.78 | |
| d1aisb1 | 98 | Transcription factor IIB (TFIIB), core domain {Arc | 99.73 | |
| d1vola1 | 95 | Transcription factor IIB (TFIIB), core domain {Hum | 99.72 | |
| d2i53a1 | 144 | Cyclin K {Human (Homo sapiens) [TaxId: 9606]} | 98.96 | |
| d2ivxa1 | 143 | Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} | 98.9 | |
| d1jkwa1 | 151 | Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 | 98.76 | |
| d2ivxa2 | 113 | Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} | 98.62 | |
| d2i53a2 | 110 | Cyclin K {Human (Homo sapiens) [TaxId: 9606]} | 98.43 | |
| d2cchb1 | 128 | Cyclin A {Cow (Bos taurus) [TaxId: 9913]} | 98.26 | |
| d1bu2a1 | 127 | Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} | 98.25 | |
| d1g3nc1 | 132 | Viral cyclin {Kaposi's sarcoma-associated herpesvi | 98.2 | |
| d1f5qb1 | 141 | Viral cyclin {Murine herpesvirus 68 [TaxId: 33708] | 98.1 | |
| d1w98b2 | 140 | G1/S-specific cyclin-E1 {Human (Homo sapiens) [Tax | 98.08 | |
| d2cchb2 | 124 | Cyclin A {Cow (Bos taurus) [TaxId: 9913]} | 97.7 | |
| d2ivxa2 | 113 | Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} | 97.11 | |
| d2ivxa1 | 143 | Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} | 97.11 | |
| d2i53a1 | 144 | Cyclin K {Human (Homo sapiens) [TaxId: 9606]} | 97.07 | |
| d2r7ga2 | 142 | Retinoblastoma tumor suppressor domains {Human (Ho | 96.84 | |
| d1qxfa_ | 58 | Ribosomal protein S27e {Archaeon Archaeoglobus ful | 96.73 | |
| d1jkwa1 | 151 | Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 | 96.67 | |
| d2jnya1 | 59 | Uncharacterized protein Cgl1405/cg1592 {Corynebact | 96.31 | |
| d2akla2 | 38 | Hypothetical protein PA0128, N-terminal domain {Ps | 96.23 | |
| d2i53a2 | 110 | Cyclin K {Human (Homo sapiens) [TaxId: 9606]} | 96.2 | |
| d2pk7a1 | 59 | Uncharacterized protein PFL1779 {Pseudomonas fluor | 96.02 | |
| d2hf1a1 | 59 | Hypothetical protein CV3345 {Chromobacterium viola | 95.76 | |
| d1jkwa2 | 126 | Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 | 95.57 | |
| d2cchb1 | 128 | Cyclin A {Cow (Bos taurus) [TaxId: 9913]} | 94.95 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 94.88 | |
| d1bu2a1 | 127 | Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} | 94.86 | |
| d1f5qb1 | 141 | Viral cyclin {Murine herpesvirus 68 [TaxId: 33708] | 94.68 | |
| d1w98b2 | 140 | G1/S-specific cyclin-E1 {Human (Homo sapiens) [Tax | 94.16 | |
| d2r7ga2 | 142 | Retinoblastoma tumor suppressor domains {Human (Ho | 93.99 | |
| d1g3nc1 | 132 | Viral cyclin {Kaposi's sarcoma-associated herpesvi | 93.97 | |
| d1neea2 | 37 | Zinc-binding domain of translation initiation fact | 93.88 | |
| d1k81a_ | 36 | Zinc-binding domain of translation initiation fact | 93.46 | |
| d1nuia2 | 54 | Zinc-binding domain of primase-helicase {Bacteriop | 93.18 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 93.15 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 93.02 | |
| d1y0ja1 | 39 | Erythroid transcription factor GATA-1 {Mouse (Mus | 92.56 | |
| d1jkwa2 | 126 | Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606 | 92.32 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 92.07 | |
| d1hw1a1 | 74 | Fatty acid responsive transcription factor FadR, N | 91.67 | |
| d1l3la1 | 65 | Quorum-sensing transcription factor TraR, C-termin | 91.54 | |
| d1fsea_ | 67 | Germination protein GerE {Bacillus subtilis [TaxId | 91.33 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 91.19 | |
| d1biaa1 | 63 | Biotin repressor, N-terminal domain {Escherichia c | 90.76 | |
| d1jj2y_ | 73 | Ribosomal protein L37ae {Archaeon Haloarcula maris | 90.57 | |
| d2cchb2 | 124 | Cyclin A {Cow (Bos taurus) [TaxId: 9913]} | 90.31 | |
| d1yioa1 | 70 | Response regulatory protein StyR, C-terminal domai | 90.29 | |
| d2k4xa1 | 55 | Ribosomal protein S27ae {Thermoplasma acidophilum | 90.18 | |
| d1vqoz1 | 73 | Ribosomal protein L37ae {Archaeon Haloarcula maris | 90.16 | |
| d1u5ka2 | 157 | Recombinational repair protein RecO, C-terminal do | 89.92 | |
| d1a04a1 | 67 | Nitrate/nitrite response regulator (NarL) {Escheri | 89.75 | |
| d2gaua1 | 81 | Transcriptional regulator PG0396, C-terminal domai | 89.48 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 89.02 | |
| d1or7a1 | 68 | SigmaE factor (RpoE) {Escherichia coli [TaxId: 562 | 88.89 | |
| d1rp3a2 | 71 | Sigma factor sigma-28 (FliA) {Aquifex aeolicus [Ta | 88.88 | |
| d1efaa1 | 59 | Lac repressor (LacR), N-terminal domain {Escherich | 88.83 | |
| d1j5ya1 | 65 | Putative transcriptional regulator TM1602, N-termi | 88.09 | |
| d2hs5a1 | 69 | Putative transcriptional regulator RHA1_ro03477 {R | 88.04 | |
| d1z05a1 | 71 | Transcriptional regulator VC2007 N-terminal domain | 87.98 | |
| d2hsga1 | 57 | Glucose-resistance amylase regulator CcpA, N-termi | 87.68 | |
| d2ev0a1 | 61 | Manganese transport regulator MntR {Bacillus subti | 87.64 | |
| d2vuti1 | 42 | Erythroid transcription factor GATA-1 {Emericella | 87.6 | |
| d1i5za1 | 69 | Catabolite gene activator protein (CAP), C-termina | 87.4 | |
| d2o3fa1 | 83 | Putative transcriptional regulator YbbH {Bacillus | 87.27 | |
| d3bwga1 | 78 | Transcriptional regulator YydK {Bacillus subtilis | 87.19 | |
| d2dsxa1 | 52 | Rubredoxin {Desulfovibrio gigas [TaxId: 879]} | 87.03 | |
| d1uxda_ | 59 | Fructose repressor (FruR), N-terminal domain {Esch | 87.0 | |
| d1jhfa1 | 71 | LexA repressor, N-terminal DNA-binding domain {Esc | 86.5 | |
| d1qpza1 | 57 | Purine repressor (PurR), N-terminal domain {Escher | 86.38 | |
| d1rqga3 | 35 | Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyro | 86.37 | |
| d1twfi2 | 72 | RBP9 subunit of RNA polymerase II {Baker's yeast ( | 86.04 | |
| d2ak3a2 | 37 | Microbial and mitochondrial ADK, insert "zinc fing | 86.02 | |
| d1ft9a1 | 80 | CO-sensing protein CooA, C-terminal domain {Rhodos | 85.98 | |
| d2isya1 | 63 | Iron-dependent regulator IdeR {Mycobacterium tuber | 85.41 | |
| d1iroa_ | 53 | Rubredoxin {Clostridium pasteurianum [TaxId: 1501] | 85.32 | |
| d2j0151 | 59 | Ribosomal protein L32p {Thermus thermophilus [TaxI | 85.27 | |
| d3gata_ | 66 | Erythroid transcription factor GATA-1 {Chicken (Ga | 85.05 | |
| d1l1oc_ | 178 | Replication protein A 70 KDa subunit (RPA70) {Huma | 84.74 | |
| d2ct7a1 | 73 | Ring finger protein 31 {Human (Homo sapiens) [TaxI | 84.68 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 84.67 | |
| d1zina2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 84.27 | |
| d1zyba1 | 73 | Probable transcription regulator BT4300, C-termina | 83.8 | |
| d1s3ga2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 83.29 | |
| d2j9ub1 | 47 | Vacuolar protein-sorting-associated protein 36, VP | 83.28 | |
| d1akya2 | 38 | Microbial and mitochondrial ADK, insert "zinc fing | 83.09 | |
| d1bl0a1 | 54 | MarA {Escherichia coli [TaxId: 562]} | 82.98 | |
| d3e5ua1 | 80 | Chlorophenol reduction protein CprK {Desulfitobact | 82.39 | |
| d2hoea1 | 62 | N-acetylglucosamine kinase {Thermotoga maritima [T | 82.31 | |
| d1e4va2 | 35 | Microbial and mitochondrial ADK, insert "zinc fing | 82.2 | |
| d1p4wa_ | 87 | Transcriptional regulator RcsB {Erwinia amylovora | 82.12 | |
| d1z0xa1 | 68 | Transcriptional regulator EF0787 {Enterococcus fae | 82.07 | |
| d1d5ya1 | 54 | Rob transcription factor, N-terminal domain {Esche | 81.92 | |
| d6rxna_ | 45 | Rubredoxin {Desulfovibrio desulfuricans, strain 27 | 81.64 | |
| d1ku9a_ | 151 | DNA-binding protein Mj223 {Archaeon Methanococcus | 81.14 | |
| d1z6ra1 | 70 | Mlc protein N-terminal domain {Escherichia coli [T | 81.09 | |
| d1qypa_ | 57 | RBP9 subunit of RNA polymerase II {Archaeon Thermo | 80.82 | |
| d1ijwc_ | 47 | HIN recombinase (DNA-binding domain) {Synthetic} | 80.47 | |
| d1hlva1 | 66 | DNA-binding domain of centromere binding protein B | 80.22 | |
| d2zcwa1 | 82 | Transcriptional regulator TTHA1359, C-terminal dom | 80.01 |
| >d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cyclin-like superfamily: Cyclin-like family: Transcription factor IIB (TFIIB), core domain domain: Transcription factor IIB (TFIIB), core domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.92 E-value=1.4e-25 Score=171.20 Aligned_cols=105 Identities=36% Similarity=0.565 Sum_probs=101.9
Q ss_pred CCHHHHHHHHHhhcCCCHHHHHHHHHHHHHhhh--ccCCCChHHHHHHHHHHHHHhcCCCCCHHHHHHHhCcchhHHHHH
Q 021438 208 IHASDYLRRFCSNLGMTNQAVKAAQEAVQKSED--LDIRRSPISVAAAVIYIITQLSNDTKPLKEISIVTRVAEGTIKNV 285 (312)
Q Consensus 208 ~~p~~~i~r~~~~L~l~~~v~~~A~~i~~~~~~--l~~Gr~P~~iaaAaiyla~~~~~~~~~~~~Ia~~~~vs~~ti~~~ 285 (312)
++|.+||+|||++|+|++++.+.|.++++.+.+ +..||+|.++|||+||+||+.+|.+++++|||+++||++.||+++
T Consensus 2 i~~~d~i~Rf~s~L~L~~~i~~~A~~i~~~~~~~~~~~Gr~p~~iaAa~iY~a~r~~~~~~t~~eIa~~~~vs~~tI~k~ 81 (109)
T d1vola2 2 ITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQS 81 (109)
T ss_dssp CCGGGTHHHHHHHHTCCHHHHHHHHHHHHHHHHTTCSTTCCHHHHHHHHHHHHHHTSSSCCCHHHHHHHHTCCHHHHHHH
T ss_pred CCHHHHHHHHHHHcCcCHHHHHHHHHHHHHHHHcCCcCCCCHHHHHHHHHHHHHHHcCCCCCHHHHHHHHCCCHHHHHHH
Confidence 578999999999999999999999999999987 889999999999999999999999999999999999999999999
Q ss_pred HHHHHhhhcccCCccccccccccccCC
Q 021438 286 YKDLFPHLARIIPDWFANEEDIKNLKL 312 (312)
Q Consensus 286 ~kel~~~~~~~~p~~~~~~~~~~~l~~ 312 (312)
||+|++++..++|.|+..+.+++.||.
T Consensus 82 yk~l~~~~~~lip~~~~~~~~~~~lP~ 108 (109)
T d1vola2 82 YRLIYPRAPDLFPTDFKFDTPVDKLPQ 108 (109)
T ss_dssp HHHHGGGHHHHSCSSCCCSSCGGGSCC
T ss_pred HHHHHHHHHHhCChhhcccCCHHHcCC
Confidence 999999999999999999999999994
|
| >d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1aisb2 a.74.1.2 (B:1206-1300) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1dl6a_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vola2 a.74.1.2 (A:208-316) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1aisb1 a.74.1.2 (B:1108-1205) Transcription factor IIB (TFIIB), core domain {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1vola1 a.74.1.2 (A:113-207) Transcription factor IIB (TFIIB), core domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} | Back information, alignment and structure |
|---|
| >d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} | Back information, alignment and structure |
|---|
| >d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cchb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i53a1 a.74.1.1 (A:14-157) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r7ga2 a.74.1.3 (A:644-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qxfa_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jkwa1 a.74.1.1 (A:11-161) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jnya1 b.171.1.1 (A:1-59) Uncharacterized protein Cgl1405/cg1592 {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d2akla2 g.41.3.5 (A:3-40) Hypothetical protein PA0128, N-terminal domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2i53a2 a.74.1.1 (A:158-267) Cyclin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pk7a1 b.171.1.1 (A:3-61) Uncharacterized protein PFL1779 {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2hf1a1 b.171.1.1 (A:2-60) Hypothetical protein CV3345 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d1jkwa2 a.74.1.1 (A:162-287) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cchb1 a.74.1.1 (B:181-308) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bu2a1 a.74.1.1 (A:22-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]} | Back information, alignment and structure |
|---|
| >d1f5qb1 a.74.1.1 (B:6-146) Viral cyclin {Murine herpesvirus 68 [TaxId: 33708]} | Back information, alignment and structure |
|---|
| >d1w98b2 a.74.1.1 (B:88-227) G1/S-specific cyclin-E1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r7ga2 a.74.1.3 (A:644-785) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g3nc1 a.74.1.1 (C:16-147) Viral cyclin {Kaposi's sarcoma-associated herpesvirus [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1neea2 g.59.1.1 (A:99-135) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1k81a_ g.59.1.1 (A:) Zinc-binding domain of translation initiation factor 2 beta {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nuia2 g.41.3.2 (A:10-63) Zinc-binding domain of primase-helicase {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jkwa2 a.74.1.1 (A:162-287) Cyclin H (mcs2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1hw1a1 a.4.5.6 (A:5-78) Fatty acid responsive transcription factor FadR, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l3la1 a.4.6.2 (A:170-234) Quorum-sensing transcription factor TraR, C-terminal domain {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1fsea_ a.4.6.2 (A:) Germination protein GerE {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2cchb2 a.74.1.1 (B:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1yioa1 a.4.6.2 (A:131-200) Response regulatory protein StyR, C-terminal domain {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2k4xa1 g.41.8.8 (A:1-55) Ribosomal protein S27ae {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1a04a1 a.4.6.2 (A:150-216) Nitrate/nitrite response regulator (NarL) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gaua1 a.4.5.4 (A:152-232) Transcriptional regulator PG0396, C-terminal domain {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d1or7a1 a.4.13.2 (A:120-187) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rp3a2 a.4.13.2 (A:164-234) Sigma factor sigma-28 (FliA) {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1efaa1 a.35.1.5 (A:2-60) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2hs5a1 a.4.5.6 (A:25-93) Putative transcriptional regulator RHA1_ro03477 {Rhodococcus sp. RHA1 [TaxId: 101510]} | Back information, alignment and structure |
|---|
| >d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2hsga1 a.35.1.5 (A:2-58) Glucose-resistance amylase regulator CcpA, N-terminal domain {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2vuti1 g.39.1.1 (I:671-712) Erythroid transcription factor GATA-1 {Emericella nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1i5za1 a.4.5.4 (A:138-206) Catabolite gene activator protein (CAP), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o3fa1 a.4.1.20 (A:1-83) Putative transcriptional regulator YbbH {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3bwga1 a.4.5.6 (A:5-82) Transcriptional regulator YydK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1uxda_ a.35.1.5 (A:) Fructose repressor (FruR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qpza1 a.35.1.5 (A:2-58) Purine repressor (PurR), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rqga3 g.41.1.1 (A:139-173) Methionyl-tRNA synthetase (MetRS), Zn-domain {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1twfi2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ft9a1 a.4.5.4 (A:134-213) CO-sensing protein CooA, C-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d2j0151 g.41.8.5 (5:2-60) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3gata_ g.39.1.1 (A:) Erythroid transcription factor GATA-1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1l1oc_ b.40.4.3 (C:) Replication protein A 70 KDa subunit (RPA70) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ct7a1 g.44.1.4 (A:8-80) Ring finger protein 31 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1zyba1 a.4.5.4 (A:148-220) Probable transcription regulator BT4300, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2j9ub1 g.41.11.1 (B:115-161) Vacuolar protein-sorting-associated protein 36, VPS36 {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bl0a1 a.4.1.8 (A:9-62) MarA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3e5ua1 a.4.5.4 (A:148-227) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d2hoea1 a.4.5.63 (A:10-71) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p4wa_ a.4.6.2 (A:) Transcriptional regulator RcsB {Erwinia amylovora [TaxId: 552]} | Back information, alignment and structure |
|---|
| >d1z0xa1 a.4.1.9 (A:4-71) Transcriptional regulator EF0787 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1d5ya1 a.4.1.8 (A:3-56) Rob transcription factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qypa_ g.41.3.1 (A:) RBP9 subunit of RNA polymerase II {Archaeon Thermococcus celer [TaxId: 2264]} | Back information, alignment and structure |
|---|
| >d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} | Back information, alignment and structure |
|---|
| >d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|