Citrus Sinensis ID: 021537


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MVCREGGRQGVSTSIVVPIKARVIFNLIEERVKMTIDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRVSEVATRGRKSNSGRDQFRHGHRHKGRDRDNNRHRDRYQDRYNDRSRERTSSQDRDKGMGREYEHVRDHDRDPSRDRFSDEDQGRDLENNDQGHTRIHDPELANWERKSELDMTRDREIDGTDDYHTIVDEGKDHLSRKRDGSTVDDHQLREFSSNSSDDNSDQVKELDRSIQRREELKKEVCPLKFELKEMVHMLFTMS
cccccccccccccccccHHHHHHHHHccccccccccccccEEEEEcccccccHHHHHHHHHcccccEEEEEccccccccccEEEEEEccHHHHHHHHHHccccEEccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
ccHHHHHHHHHHHHccccccccEEEEEcccccccccccccEEEEccccccccHHHHHHHHHHcccEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHcccEEccEEEEEEEccccHHHccHHHHHHHEEEEccccccccHHHHccHccccccEEEEEEEEEEccccccccEEEEEccccHHHHHHHHHHHccHHcccccEEEEEEEEcEEcHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHccccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mvcreggrqgvstsIVVPIKARVIFNLIEERVKmtiddessvyvgglpysanedSVRKVFDKYGSVVAVKIVndrstrgkcygfvtfgnprsavdaindmngrtidgrVVRVSEVatrgrksnsgrdqfrhghrhkgrdrdnnrhrdryqdryndrsrertssqdrdkgmgreyehvrdhdrdpsrdrfsdedqgrdlenndqghtrihdpelanwerkseldmtrdreidgtddyhtivdegkdhlsrkrdgstvddhqlrefssnssddnsdQVKELDRSIQRREELKKEVCPLKFELKEMVHMLFTMS
mvcreggrqgvstsivvpikarVIFNLIEERvkmtiddessvyVGGLPYSANEDSVRKVFDKYGSVVAVkivndrstrgkcygfvtfgnprsavdaindmngrtidgrvvrvsevatrgrksnsgrdqfrhghrhkgrdrdnnrhrdryqdryndrsrertssqdrdkgmgreyehvrdhdrdpsrdrfsdedqgrdlenndqghtrihdpelanwerkselDMTRdreidgtddyhtivdegkdhlsrkrdgstvddhqlrefssnssddnsdqvKELDRsiqrreelkkevcplkfeLKEMVHMLFTMS
MVCREGGRQGVSTSIVVPIKARVIFNLIEERVKMTIDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRVSEVATRGRKSNSGRDQFrhghrhkgrdrdnnrhrdryqdryndrsrERTSSQDRDKGMGREYEHVRDHDRDPSRDRFSDEDQGRDLENNDQGHTRIHDPELANWERKSELDMTRDREIDGTDDYHTIVDEGKDHLSRKRDGSTVDDHQLREFssnssddnsdQVKELDRSIQRREELKKEVCPLKFELKEMVHMLFTMS
**********VSTSIVVPIKARVIFNLIEERVKMTIDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRV************************************************************************************************************************************************************************************VCPLKFELKEMVHMLF***
*****************************************VYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRVSEV*****************************************************************************************************************************************************************************************KEMVHMLFTM*
***********STSIVVPIKARVIFNLIEERVKMTIDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRVSEV****************************RHRDRYQDR*********************************************LENNDQGHTRIHDPELANWERKSELDMTRDREIDGTDDYHTIVDEGKD***********DDHQLREF*****************SIQRREELKKEVCPLKFELKEMVHMLFTMS
**********VSTSIVVPIKARVIFNLIEERVKMTIDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRVSEVATRGRKSNSGRDQFRHGHRHKGRDRDNNRHRDRYQDRYNDRSRERTSSQDRDKGMGREYEHVRDHDRDPSRDRFSDEDQGRDLENNDQGHTRIHDPELANWERKSELDMTRDREIDGTDDYHTIVDEGKDHLSRKRDG***DD******SSNS****SDQVKELDRSIQRREELKKEVCPLKFELKEMVHMLFTMS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVCREGGRQGVSTSIVVPIKARVIFNLIEERVKMTIDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRVSEVATRGRKSNSGRDQFRHGHRHKGRDRDNNRHRDRYQDRYNDRSRERTSSQDRDKGMGREYEHVRDHDRDPSRDRFSDEDQGRDLENNDQGHTRIHDPELANWERKSELDMTRDREIDGTDDYHTIVDEGKDHLSRKRDGSTVDDHQLREFSSNSSDDxxxxxxxxxxxxxxxxxxxxxVCPLKFELKEMVHMLFTMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query311 2.2.26 [Sep-21-2011]
Q28IQ9166 Cold-inducible RNA-bindin yes no 0.266 0.5 0.471 2e-14
Q9DED4166 Cold-inducible RNA-bindin N/A no 0.260 0.487 0.451 2e-14
Q5RF83172 Cold-inducible RNA-bindin yes no 0.254 0.459 0.462 5e-13
Q14011172 Cold-inducible RNA-bindin yes no 0.254 0.459 0.462 5e-13
P60825172 Cold-inducible RNA-bindin yes no 0.254 0.459 0.45 1e-12
P60824172 Cold-inducible RNA-bindin yes no 0.254 0.459 0.45 1e-12
P60826172 Cold-inducible RNA-bindin yes no 0.254 0.459 0.45 1e-12
O93235166 Cold-inducible RNA-bindin N/A no 0.260 0.487 0.426 2e-12
Q03251169 Glycine-rich RNA-binding no no 0.247 0.455 0.423 2e-12
Q9PTX2164 Cold-inducible RNA-bindin N/A no 0.266 0.506 0.448 2e-12
>sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 Back     alignment and function desciption
 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (65%), Gaps = 4/87 (4%)

Query: 38  DESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDR-STRGKCYGFVTFGNPRSAVDA 96
           DE  ++VGGL +   E+S+ +VF KYG V  V +V DR S R + +GFVTF NP  A DA
Sbjct: 4   DEGKLFVGGLNFETTEESLEQVFSKYGQVAEVVVVKDRESKRSRGFGFVTFENPEDAKDA 63

Query: 97  INDMNGRTIDGRVVRVSEVATRGRKSN 123
           +  MNG+++DGR +RV +    G+ SN
Sbjct: 64  MMAMNGKSVDGRQIRVDQA---GKSSN 87




Cold-inducible mRNA binding protein. Acts cooperatively with elavl1/elrA to stabilize AU-rich element (ARE)-containing mRNAs by binding to themm and inhibiting their deadenylation. Essential for embryonic gastrulation and neural development, acting to maintain the expression of a set of adhesion molecules, and cell movement during embryogenesis. Required for pronephros development.
Xenopus tropicalis (taxid: 8364)
>sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 Back     alignment and function description
>sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 Back     alignment and function description
>sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 Back     alignment and function description
>sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 Back     alignment and function description
>sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 Back     alignment and function description
>sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 Back     alignment and function description
>sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 Back     alignment and function description
>sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 Back     alignment and function description
>sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
359484387399 PREDICTED: uncharacterized protein LOC10 0.848 0.661 0.514 3e-62
297738892347 unnamed protein product [Vitis vinifera] 0.836 0.749 0.510 3e-62
147843908216 hypothetical protein VITISV_017075 [Viti 0.684 0.986 0.547 3e-50
224142105353 predicted protein [Populus trichocarpa] 0.694 0.611 0.526 2e-46
449443125346 PREDICTED: uncharacterized protein LOC10 0.790 0.710 0.451 7e-46
18420085337 RNA recognition motif-containing protein 0.803 0.741 0.437 2e-39
21553602337 glycine-rich RNA-binding protein-like [A 0.803 0.741 0.437 4e-39
297808057335 RNA recognition motif-containing protein 0.800 0.743 0.434 3e-38
255576924218 glycine-rich RNA-binding protein, putati 0.675 0.963 0.486 3e-37
449509482195 PREDICTED: uncharacterized LOC101205569 0.575 0.917 0.510 6e-36
>gi|359484387|ref|XP_002281678.2| PREDICTED: uncharacterized protein LOC100245744 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  244 bits (624), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 146/284 (51%), Positives = 198/284 (69%), Gaps = 20/284 (7%)

Query: 33  KMTIDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRS 92
           +MTIDD++S+YVGGLPY+A EDS+RKVF+ YG++VAVKI+N+R   GKCYGFVTF NPRS
Sbjct: 52  EMTIDDDNSIYVGGLPYNATEDSIRKVFNLYGAIVAVKIINERGVGGKCYGFVTFTNPRS 111

Query: 93  AVDAINDMNGRTIDGRVVRVSEVATRGRKSNSGRDQFRHGHRHKGRDRDNNRHRDR-Y-- 149
           A+DAINDMNGR IDGR+V V+EV TRG +SN GR+ FR  +  +G D D  R R+R Y  
Sbjct: 112 AIDAINDMNGRDIDGRIVVVNEVRTRGGRSNFGRESFRR-NSERGMDWDRGRDRERDYGH 170

Query: 150 -QDRYNDRSRERTSSQDRDKGMGREYEHVRDHDRDPSRDRFSD--EDQGRDLENNDQGHT 206
            +D + DR+ +R+   DR++  G  +E  RDHDR  +RDRF D   DQ RD+E+N+Q H+
Sbjct: 171 DKDHFRDRNIDRSRDHDRERERG--HERARDHDR--TRDRFMDRNRDQDRDMEDNEQEHS 226

Query: 207 RIHDPELANWERKSELDMTRDREIDGTDDYHTIVDEGKDHLSRKRDGSTVDDHQLREFSS 266
           R HD    +WER  ++D  RDRE++ T+D+    D  KD  S+KR+G        R  SS
Sbjct: 227 RNHDQ---DWERDHDIDWDRDREMNNTNDHDKSGD--KDEHSKKRNGGW----HSRGLSS 277

Query: 267 NSSDDNSDQVKELDRSIQRREELKKEVCPLKFELKEMVHMLFTM 310
           +S  D  DQV+E+DRSIQRREEL+KE+  ++  L+E   ++  +
Sbjct: 278 DSDGDYHDQVEEVDRSIQRREELQKEISQMEERLEEKQQLVLDL 321




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|297738892|emb|CBI28137.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147843908|emb|CAN83717.1| hypothetical protein VITISV_017075 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224142105|ref|XP_002324399.1| predicted protein [Populus trichocarpa] gi|222865833|gb|EEF02964.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449443125|ref|XP_004139331.1| PREDICTED: uncharacterized protein LOC101205569 [Cucumis sativus] Back     alignment and taxonomy information
>gi|18420085|ref|NP_568388.1| RNA recognition motif-containing protein [Arabidopsis thaliana] gi|20260444|gb|AAM13120.1| glycine-rich RNA-binding protein, putative [Arabidopsis thaliana] gi|28059296|gb|AAO30045.1| glycine-rich RNA-binding protein, putative [Arabidopsis thaliana] gi|332005391|gb|AED92774.1| RNA recognition motif-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21553602|gb|AAM62695.1| glycine-rich RNA-binding protein-like [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297808057|ref|XP_002871912.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317749|gb|EFH48171.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255576924|ref|XP_002529347.1| glycine-rich RNA-binding protein, putative [Ricinus communis] gi|223531167|gb|EEF33014.1| glycine-rich RNA-binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449509482|ref|XP_004163601.1| PREDICTED: uncharacterized LOC101205569 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
TAIR|locus:2147625337 AT5G19960 [Arabidopsis thalian 0.823 0.759 0.381 9.2e-36
UNIPROTKB|Q3SZN4213 CIRBP "Uncharacterized protein 0.270 0.394 0.443 5e-19
ZFIN|ZDB-GENE-030131-5841224 cirbp "cold inducible RNA bind 0.340 0.473 0.394 2.2e-18
UNIPROTKB|F1S6R1172 CIRBP "Uncharacterized protein 0.270 0.488 0.443 4.3e-18
UNIPROTKB|E2R6G2172 CIRBP "Uncharacterized protein 0.270 0.488 0.443 5.5e-18
UNIPROTKB|F6XHA7185 CIRBP "Uncharacterized protein 0.270 0.454 0.443 5.5e-18
UNIPROTKB|H9KZV5190 CIRBP "Uncharacterized protein 0.282 0.463 0.426 1.4e-17
UNIPROTKB|Q28IQ9166 cirbp "Cold-inducible RNA-bind 0.276 0.518 0.466 6.7e-17
UNIPROTKB|Q9DED4166 cirbp-b "Cold-inducible RNA-bi 0.282 0.530 0.434 1.8e-16
ZFIN|ZDB-GENE-050417-329185 zgc:112425 "zgc:112425" [Danio 0.289 0.486 0.413 7.7e-16
TAIR|locus:2147625 AT5G19960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 386 (140.9 bits), Expect = 9.2e-36, P = 9.2e-36
 Identities = 105/275 (38%), Positives = 146/275 (53%)

Query:    34 MTIDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSA 93
             MT+DD +SVYVGGLPY   E++VR+VF  YGSV+ VKIVNDRS RGKCYGFVTF N RSA
Sbjct:     1 MTMDDGNSVYVGGLPYDITEEAVRRVFSIYGSVLTVKIVNDRSVRGKCYGFVTFSNRRSA 60

Query:    94 VDAINDMNGRTIDGRVVRVSEVATRGRKSNSGRDQFXXXXXXXXXXXXXXXXXXXXXXXX 153
              DAI DM+G++I GR VRV++V TRG + N G  +                         
Sbjct:    61 DDAIEDMDGKSIGGRAVRVNDVTTRGGRMNPGPGRLQPHGGWDRSPDRRSDGNYERDRYS 120

Query:   154 XXXXXERTSSQDRDKGMGREYEHVRDHDRDPSRDRFSDEDQGRDLENNDQGHTRIHDPEL 213
                  ER  SQDR K   R  E  R ++     +R +D D    ++ N     R+ D + 
Sbjct:   121 DRSR-ERDRSQDRRKDH-RYIEKERAYEHSHDFERRNDHDM---VDRNGYKE-RVFDGDE 174

Query:   214 ANWER-KSELDMTRDREIDGTDDYHTIVDEGKDHLSRKRDGSTVDDHQLREFXXXXXXXX 272
              +W   +S +D    R I+GT  +     EG+   +++ D + +D  + R+         
Sbjct:   175 GDWRGDRSYVD--NGRGINGTSAH-----EGRSQETKREDSTILDGGRGRDHFSNSSGDH 227

Query:   273 XXQVKE-LDRSIQRREELKKEVCPL--KFELKEMV 304
               QVKE L+  I+ RE L+ EV  +  + E+KE+V
Sbjct:   228 --QVKEDLEALIKMREALRDEVMVMEERLEVKEVV 260




GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|Q3SZN4 CIRBP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5841 cirbp "cold inducible RNA binding protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S6R1 CIRBP "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6G2 CIRBP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XHA7 CIRBP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZV5 CIRBP "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q28IQ9 cirbp "Cold-inducible RNA-binding protein" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q9DED4 cirbp-b "Cold-inducible RNA-binding protein B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-329 zgc:112425 "zgc:112425" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
smart0036073 smart00360, RRM, RNA recognition motif 9e-22
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-21
pfam0007670 pfam00076, RRM_1, RNA recognition motif 9e-21
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 6e-17
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-16
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 6e-16
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 3e-15
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 9e-15
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-14
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 6e-14
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 6e-14
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 8e-14
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-13
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 2e-13
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 3e-13
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 3e-13
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 4e-13
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 5e-13
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 5e-13
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 7e-13
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 9e-13
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 1e-12
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 1e-12
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 1e-12
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-12
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-12
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 2e-12
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-12
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 3e-12
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 5e-12
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 6e-12
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 6e-12
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 6e-12
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 8e-12
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 1e-11
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 1e-11
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 1e-11
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 2e-11
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 6e-11
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 7e-11
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 8e-11
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 9e-11
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 9e-11
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 1e-10
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 1e-10
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 2e-10
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-10
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 2e-10
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 3e-10
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 6e-10
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 6e-10
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 9e-10
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 9e-10
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 9e-10
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-09
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-09
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 1e-09
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-09
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 2e-09
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 4e-09
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 4e-09
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 4e-09
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 5e-09
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 5e-09
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 5e-09
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 6e-09
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 7e-09
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 7e-09
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 8e-09
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-08
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 1e-08
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 2e-08
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 2e-08
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 2e-08
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-08
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 3e-08
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 3e-08
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 3e-08
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 3e-08
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 3e-08
cd1243898 cd12438, RRM_CNOT4, RNA recognition motif in Eukar 4e-08
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 5e-08
pfam1389356 pfam13893, RRM_5, RNA recognition motif 5e-08
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 6e-08
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 6e-08
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 6e-08
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 6e-08
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 6e-08
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 6e-08
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 7e-08
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 7e-08
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 8e-08
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 9e-08
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 9e-08
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 9e-08
cd1228081 cd12280, RRM_FET, RNA recognition motif in the FET 1e-07
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 1e-07
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 1e-07
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 1e-07
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 1e-07
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 1e-07
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-07
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 2e-07
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 2e-07
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 2e-07
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 2e-07
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 2e-07
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 2e-07
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 3e-07
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 3e-07
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 3e-07
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 3e-07
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 3e-07
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 4e-07
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 4e-07
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 4e-07
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 4e-07
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 5e-07
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 5e-07
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 5e-07
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 6e-07
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 6e-07
cd1259474 cd12594, RRM1_SRSF4, RNA recognition motif 1 in ve 7e-07
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 8e-07
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 8e-07
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 9e-07
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 1e-06
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 1e-06
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 1e-06
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 1e-06
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 1e-06
cd1259972 cd12599, RRM1_SF2_plant_like, RNA recognition moti 1e-06
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 2e-06
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 2e-06
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 2e-06
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-06
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 2e-06
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 2e-06
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 2e-06
cd1239491 cd12394, RRM1_RBM34, RNA recognition motif 1 in RN 2e-06
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 2e-06
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 2e-06
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 2e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 2e-06
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 2e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 3e-06
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 3e-06
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 3e-06
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 3e-06
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 3e-06
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 3e-06
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 4e-06
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 4e-06
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 4e-06
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 5e-06
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 5e-06
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 5e-06
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 5e-06
cd1267874 cd12678, RRM_SLTM, RNA recognition motif in Scaffo 5e-06
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 6e-06
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 6e-06
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 8e-06
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 8e-06
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 8e-06
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 9e-06
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 9e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 1e-05
cd1259773 cd12597, RRM1_SRSF1, RNA recognition motif 1 in se 1e-05
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 1e-05
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 1e-05
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 1e-05
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 1e-05
cd1252378 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA 1e-05
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-05
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 2e-05
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 2e-05
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-05
cd1264677 cd12646, RRM_SRSF7, RNA recognition motif in verte 2e-05
cd1259872 cd12598, RRM1_SRSF9, RNA recognition motif 1 in ve 2e-05
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 2e-05
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 3e-05
cd1234875 cd12348, RRM1_SHARP, RNA recognition motif 1 in SM 3e-05
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 3e-05
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 3e-05
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 3e-05
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 4e-05
cd1264581 cd12645, RRM_SRSF3, RNA recognition motif in verte 4e-05
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 4e-05
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 4e-05
cd1240277 cd12402, RRM_eIF4B, RNA recognition motif in eukar 4e-05
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 4e-05
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 5e-05
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 5e-05
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 6e-05
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 6e-05
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 6e-05
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 7e-05
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 8e-05
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 9e-05
PRK12678 672 PRK12678, PRK12678, transcription termination fact 9e-05
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 1e-04
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 1e-04
cd1264796 cd12647, RRM_UHM_SPF45, RNA recognition motif in U 1e-04
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 2e-04
cd1234271 cd12342, RRM_Nab3p, RNA recognition motif in yeast 2e-04
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 2e-04
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 2e-04
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 2e-04
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 2e-04
TIGR01648578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-04
cd1236968 cd12369, RRM4_RBM45, RNA recognition motif 4 in RN 2e-04
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-04
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 3e-04
PRK12678 672 PRK12678, PRK12678, transcription termination fact 3e-04
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 3e-04
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 3e-04
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 3e-04
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 3e-04
cd1227974 cd12279, RRM_TUT1, RNA recognition motif in speckl 3e-04
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 3e-04
PRK12678 672 PRK12678, PRK12678, transcription termination fact 4e-04
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 4e-04
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 4e-04
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 4e-04
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 4e-04
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 5e-04
cd1236481 cd12364, RRM_RDM1, RNA recognition motif of RAD52 6e-04
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 6e-04
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 6e-04
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 7e-04
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 7e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 8e-04
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 8e-04
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 8e-04
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 9e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 0.001
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 0.001
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 0.001
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 0.001
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 0.001
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 0.001
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 0.001
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 0.001
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 0.001
cd1229671 cd12296, RRM1_Prp24, RNA recognition motif 1 in fu 0.001
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 0.001
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 0.001
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 0.001
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 0.002
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.002
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 0.002
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 0.002
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 0.002
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 0.002
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 0.002
cd1253586 cd12535, RRM_FUS_TAF15, RNA recognition motif in v 0.002
cd1246778 cd12467, RRM_Srp1p_like, RNA recognition motif 1 i 0.002
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 0.002
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 0.002
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 0.003
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 0.003
cd1243676 cd12436, RRM1_2_MATR3_like, RNA recognition motif 0.003
cd1255587 cd12555, RRM2_RBM15, RNA recognition motif 2 in ve 0.003
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 0.003
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.003
cd1258771 cd12587, RRM1_PSF, RNA recognition motif 1 in vert 0.003
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 0.004
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 0.004
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
 Score = 86.5 bits (215), Expect = 9e-22
 Identities = 26/73 (35%), Positives = 47/73 (64%), Gaps = 1/73 (1%)

Query: 41  SVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRST-RGKCYGFVTFGNPRSAVDAIND 99
           +++VG LP    E+ +R++F K+G V +V++V D+ T + K + FV F +   A  A+  
Sbjct: 1   TLFVGNLPPDTTEEELRELFSKFGKVESVRLVRDKETGKSKGFAFVEFESEEDAEKALEA 60

Query: 100 MNGRTIDGRVVRV 112
           +NG+ +DGR ++V
Sbjct: 61  LNGKELDGRPLKV 73


Length = 73

>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240884 cd12438, RRM_CNOT4, RNA recognition motif in Eukaryotic CCR4-NOT transcription complex subunit 4 (NOT4) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240726 cd12280, RRM_FET, RNA recognition motif in the FET family of RNA-binding proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241038 cd12594, RRM1_SRSF4, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 4 (SRSF4) Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241043 cd12599, RRM1_SF2_plant_like, RNA recognition motif 1 in plant pre-mRNA-splicing factor SF2 and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240840 cd12394, RRM1_RBM34, RNA recognition motif 1 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241122 cd12678, RRM_SLTM, RNA recognition motif in Scaffold attachment factor (SAF)-like transcription modulator (SLTM) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241041 cd12597, RRM1_SRSF1, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240967 cd12523, RRM2_MRN1, RNA recognition motif 2 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241090 cd12646, RRM_SRSF7, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 7 (SRSF7) Back     alignment and domain information
>gnl|CDD|241042 cd12598, RRM1_SRSF9, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 9 (SRSF9) Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240794 cd12348, RRM1_SHARP, RNA recognition motif 1 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241089 cd12645, RRM_SRSF3, RNA recognition motif in vertebrate serine/arginine-rich splicing factor 3 (SRSF3) Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240848 cd12402, RRM_eIF4B, RNA recognition motif in eukaryotic translation initiation factor 4B (eIF-4B) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241091 cd12647, RRM_UHM_SPF45, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240788 cd12342, RRM_Nab3p, RNA recognition motif in yeast nuclear polyadenylated RNA-binding protein 3 (Nab3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240815 cd12369, RRM4_RBM45, RNA recognition motif 4 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|240725 cd12279, RRM_TUT1, RNA recognition motif in speckle targeted PIP5K1A-regulated poly(A) polymerase (Star-PAP) and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240810 cd12364, RRM_RDM1, RNA recognition motif of RAD52 motif-containing protein 1 (RDM1) and similar proteins Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240742 cd12296, RRM1_Prp24, RNA recognition motif 1 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240979 cd12535, RRM_FUS_TAF15, RNA recognition motif in vertebrate fused in Ewing's sarcoma protein (FUS), TATA-binding protein-associated factor 15 (TAF15) and similar proteins Back     alignment and domain information
>gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240882 cd12436, RRM1_2_MATR3_like, RNA recognition motif 1 and 2 in the matrin 3 family of nuclear proteins Back     alignment and domain information
>gnl|CDD|240999 cd12555, RRM2_RBM15, RNA recognition motif 2 in vertebrate RNA binding motif protein 15 (RBM15) Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|241031 cd12587, RRM1_PSF, RNA recognition motif 1 in vertebrate polypyrimidine tract-binding protein (PTB)-associated-splicing factor (PSF) Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.84
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.82
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.8
KOG4207256 consensus Predicted splicing factor, SR protein su 99.76
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.67
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.67
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.64
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.62
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.61
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.61
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.56
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.55
KOG0122270 consensus Translation initiation factor 3, subunit 99.55
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.54
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.54
PLN03120260 nucleic acid binding protein; Provisional 99.52
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.52
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.48
smart0036272 RRM_2 RNA recognition motif. 99.47
PLN03213 759 repressor of silencing 3; Provisional 99.47
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.47
PLN03121243 nucleic acid binding protein; Provisional 99.46
TIGR01648578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.46
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.45
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.45
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.44
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.44
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.43
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.42
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.42
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.42
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.41
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.4
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.4
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.4
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.4
smart0036071 RRM RNA recognition motif. 99.39
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.37
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.37
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.35
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.33
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.32
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.31
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.29
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.28
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 99.27
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.26
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.26
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.26
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.25
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.25
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.21
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 99.2
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.18
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.18
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.17
smart0036170 RRM_1 RNA recognition motif. 99.16
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.11
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.1
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 99.07
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.07
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.02
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.02
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 98.99
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.99
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.95
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 98.94
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 98.9
KOG0153377 consensus Predicted RNA-binding protein (RRM super 98.88
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.88
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.86
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 98.85
KOG0533243 consensus RRM motif-containing protein [RNA proces 98.84
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.77
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 98.77
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 98.77
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.76
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 98.74
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.72
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 98.71
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 98.7
KOG0151 877 consensus Predicted splicing regulator, contains R 98.61
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.54
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 98.43
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.36
KOG0226290 consensus RNA-binding proteins [General function p 98.34
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.29
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.25
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 98.25
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 98.13
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.13
KOG4210285 consensus Nuclear localization sequence binding pr 98.08
KOG1995351 consensus Conserved Zn-finger protein [General fun 98.05
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.02
KOG2314 698 consensus Translation initiation factor 3, subunit 97.97
KOG1457284 consensus RNA binding protein (contains RRM repeat 97.97
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 97.91
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 97.87
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.85
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 97.84
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 97.83
COG5175480 MOT2 Transcriptional repressor [Transcription] 97.74
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 97.73
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.56
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 97.56
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.51
KOG3152278 consensus TBP-binding protein, activator of basal 97.48
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 97.4
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.4
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 97.38
KOG1548382 consensus Transcription elongation factor TAT-SF1 97.34
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 97.34
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.34
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 97.29
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.25
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 97.19
KOG1855484 consensus Predicted RNA-binding protein [General f 97.14
KOG1996378 consensus mRNA splicing factor [RNA processing and 97.12
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 97.09
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 97.03
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 97.01
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 96.95
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 96.73
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 96.71
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 96.21
KOG2068327 consensus MOT2 transcription factor [Transcription 96.15
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.1
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 95.91
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 95.89
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 95.86
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.83
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 95.51
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 95.34
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.27
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 95.1
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 93.84
KOG2135526 consensus Proteins containing the RNA recognition 93.79
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 93.52
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 92.81
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 92.29
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 92.1
KOG2318 650 consensus Uncharacterized conserved protein [Funct 91.8
KOG4660549 consensus Protein Mei2, essential for commitment t 91.4
KOG4210285 consensus Nuclear localization sequence binding pr 90.97
KOG2591 684 consensus c-Mpl binding protein, contains La domai 89.26
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 88.04
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 87.93
KOG4368757 consensus Predicted RNA binding protein, contains 81.11
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
Probab=99.84  E-value=6.1e-20  Score=152.55  Aligned_cols=81  Identities=32%  Similarity=0.585  Sum_probs=75.3

Q ss_pred             CCCceEEEcCCCCCCcHHHHHHHhhcCCceEEEEEeeCCCCCCceEEEEEeeChHHHHHHHHHcCCCccCCeEEEEEEec
Q 021537           37 DDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRVSEVA  116 (311)
Q Consensus        37 ~~~~~lfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~~~~~~~kg~aFVeF~~~~~A~~Al~~l~g~~i~Gr~l~V~~a~  116 (311)
                      .-.++||||||+..+++.+|+.+|.+||+|..|+|..+    +.|||||+|+++.+|+.|+..|+|..|.|..|.|+++.
T Consensus         8 ~~~~kVYVGnL~~~a~k~eLE~~F~~yG~lrsvWvArn----PPGfAFVEFed~RDA~DAvr~LDG~~~cG~r~rVE~S~   83 (195)
T KOG0107|consen    8 NGNTKVYVGNLGSRATKRELERAFSKYGPLRSVWVARN----PPGFAFVEFEDPRDAEDAVRYLDGKDICGSRIRVELST   83 (195)
T ss_pred             CCCceEEeccCCCCcchHHHHHHHHhcCcceeEEEeec----CCCceEEeccCcccHHHHHhhcCCccccCceEEEEeec
Confidence            34689999999999999999999999999999999887    68899999999999999999999999999999999997


Q ss_pred             cCCCC
Q 021537          117 TRGRK  121 (311)
Q Consensus       117 ~~~~~  121 (311)
                      .....
T Consensus        84 G~~r~   88 (195)
T KOG0107|consen   84 GRPRG   88 (195)
T ss_pred             CCccc
Confidence            76553



>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4368 consensus Predicted RNA binding protein, contains SWAP, RPR and G-patch domains [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 2e-14
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 4e-12
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 3e-11
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 2e-09
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 3e-09
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 8e-09
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 2e-08
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 3e-08
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 2e-07
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 2e-07
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 3e-07
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 5e-07
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 5e-07
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 5e-07
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 7e-07
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 9e-07
2fc9_A101 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 2e-06
2khc_A118 Bruno Rrm3+ Length = 118 2e-06
2i38_A150 Solution Structure Of The Rrm Of Srp20 Length = 150 3e-06
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 3e-06
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 4e-06
2ywk_A95 Crystal Structure Of Rrm-Domain Derived From Human 4e-06
2xs5_A87 Crystal Structure Of The Rrm Domain Of Mouse Delete 4e-06
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 5e-06
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 5e-06
2dgs_A99 Solution Structure Of The Second Rna Binding Domain 5e-06
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 5e-06
2xsf_A89 Crystal Structure Of The Rrm Domain Of Mouse Delete 7e-06
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 7e-06
1x4g_A109 Solution Structure Of Rrm Domain In Nucleolysin Tia 9e-06
2i2y_A150 Solution Structure Of The Rrm Of Srp20 Bound To The 1e-05
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 1e-05
1x4a_A109 Solution Structure Of Rrm Domain In Splicing Factor 1e-05
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 1e-05
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 1e-05
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 1e-05
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 2e-05
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 2e-05
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 2e-05
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 2e-05
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 2e-05
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 3e-05
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 3e-05
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 3e-05
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 3e-05
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 3e-05
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 3e-05
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 3e-05
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 3e-05
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 4e-05
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 4e-05
2do4_A100 Solution Structure Of The Rna Binding Domain Of Squ 4e-05
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 4e-05
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 5e-05
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 5e-05
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 6e-05
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 8e-05
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 8e-05
3nnh_A88 Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuug 2e-04
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 2e-04
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 2e-04
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 2e-04
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 2e-04
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 2e-04
2hvz_A101 Solution Structure Of The Rrm Domain Of Sr Rich Fac 2e-04
1x4e_A85 Solution Structure Of Rrm Domain In Rna Binding Mot 4e-04
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 6e-04
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 6e-04
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 7e-04
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 9e-04
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 2e-14, Method: Compositional matrix adjust. Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 1/80 (1%) Query: 38 DESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRST-RGKCYGFVTFGNPRSAVDA 96 DE ++VGGL + NE S+ +VF KYG + V +V DR T R + +GFVTF N A DA Sbjct: 11 DEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDA 70 Query: 97 INDMNGRTIDGRVVRVSEVA 116 + MNG+++DGR +RV + Sbjct: 71 MMAMNGKSVDGRQIRVDQAG 90
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|2FC9|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 101 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|2I38|A Chain A, Solution Structure Of The Rrm Of Srp20 Length = 150 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|2YWK|A Chain A, Crystal Structure Of Rrm-Domain Derived From Human Putative Rna-Binding Protein 11 Length = 95 Back     alignment and structure
>pdb|2XS5|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Mvh Rna, Uguuc Length = 87 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure
>pdb|2DGS|A Chain A, Solution Structure Of The Second Rna Binding Domain In Daz- Associated Protein 1 Length = 99 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|2XSF|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like Length = 89 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|1X4G|A Chain A, Solution Structure Of Rrm Domain In Nucleolysin Tiar Length = 109 Back     alignment and structure
>pdb|2I2Y|A Chain A, Solution Structure Of The Rrm Of Srp20 Bound To The Rna Cauc Length = 150 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|1X4A|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor Sf2 Length = 109 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|2DO4|A Chain A, Solution Structure Of The Rna Binding Domain Of Squamous Cell Carcinoma Antigen Recognized By T Cells 3 Length = 100 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|3NNH|A Chain A, Crystal Structure Of The Cugbp1 Rrm1 With Guuguuuuguuu Rna Length = 88 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure
>pdb|2HVZ|A Chain A, Solution Structure Of The Rrm Domain Of Sr Rich Factor 9g8 Length = 101 Back     alignment and structure
>pdb|1X4E|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 2 Length = 85 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-30
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 6e-27
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-26
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-26
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-26
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-26
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-26
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 5e-26
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 6e-26
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-25
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 5e-25
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 5e-25
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 6e-25
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 8e-25
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-24
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-24
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-24
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 5e-24
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 5e-24
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 7e-24
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-24
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 9e-24
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-23
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-23
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-23
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-23
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-23
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 9e-18
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-23
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 6e-23
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-22
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-22
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-22
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-22
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 2e-22
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-22
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-19
2cpj_A99 Non-POU domain-containing octamer-binding protein; 2e-22
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-22
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-22
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 5e-22
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-22
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 7e-22
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-22
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 1e-21
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-21
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-21
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-21
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-21
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-21
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-21
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-21
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 5e-21
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 5e-21
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 5e-21
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 7e-21
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-14
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 8e-21
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 8e-21
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 1e-20
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-20
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-20
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-20
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-20
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 8e-20
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 1e-20
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-20
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-20
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-20
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 5e-20
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 5e-20
3p5t_L90 Cleavage and polyadenylation specificity factor S; 7e-20
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 7e-20
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-15
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 8e-20
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-19
2cqd_A116 RNA-binding region containing protein 1; RNA recog 1e-19
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 1e-19
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-19
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-19
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-19
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-19
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 3e-19
2cph_A107 RNA binding motif protein 19; RNA recognition moti 3e-19
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 4e-19
1x5p_A97 Negative elongation factor E; structure genomics, 4e-19
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 5e-19
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-19
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-18
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 7e-19
2i2y_A150 Fusion protein consists of immunoglobin G- binding 7e-19
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 7e-19
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-19
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-18
2div_A99 TRNA selenocysteine associated protein; structural 1e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-18
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-17
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-14
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-18
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-18
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 2e-18
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-18
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-18
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-17
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-14
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 3e-18
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-18
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-15
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-18
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-18
3q2s_C229 Cleavage and polyadenylation specificity factor S; 4e-18
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-18
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 5e-18
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 6e-18
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 6e-18
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 8e-18
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 8e-18
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 2e-17
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 2e-17
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 3e-17
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-17
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 7e-17
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-16
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 5e-09
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 4e-16
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 4e-16
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 5e-16
2f3j_A177 RNA and export factor binding protein 2; RRM domai 9e-16
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-15
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-15
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 5e-15
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-15
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-15
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-14
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 4e-15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-13
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 5e-15
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 9e-15
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 9e-15
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 1e-14
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-14
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-14
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-14
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 4e-14
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 5e-14
2dis_A109 Unnamed protein product; structural genomics, RRM 7e-14
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 7e-14
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 8e-14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-14
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-13
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-13
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-13
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-13
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 9e-12
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 2e-13
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 5e-13
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 5e-13
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-12
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 2e-12
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-12
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-12
2krb_A81 Eukaryotic translation initiation factor 3 subunit 5e-12
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 8e-12
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 8e-12
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 3e-11
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 4e-11
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 4e-11
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 6e-11
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 1e-10
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-10
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 3e-10
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-10
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-10
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 6e-10
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 7e-10
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 7e-10
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 5e-09
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-08
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-08
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 3e-08
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 5e-08
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 6e-08
2dit_A112 HIV TAT specific factor 1 variant; structural geno 1e-07
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 1e-07
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 3e-07
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 3e-07
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 5e-07
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 7e-06
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 1e-04
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 2e-04
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 2e-04
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
 Score =  109 bits (275), Expect = 3e-30
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 34  MTIDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSA 93
           +  D    +++GGL    NE  ++ VF K+G +  V ++ DR+++ + + F+TF NP  A
Sbjct: 2   VEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADA 61

Query: 94  VDAINDMNGRTIDGRVVRVSEVATRGRKSNSGRDQFRH--GHRHKGRDRDNNRH 145
            +A  DMNG+++ G+ ++V +      +S   R            G    ++ H
Sbjct: 62  KNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLEHHHHH 115


>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.9
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.84
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.82
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.81
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.8
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.8
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.8
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.8
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.79
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.79
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.79
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.79
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.79
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.79
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.79
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.79
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.79
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.79
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.79
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.79
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.78
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.78
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.78
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.78
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.78
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.78
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.78
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.78
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.78
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.78
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.78
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.78
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.78
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.77
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.77
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.77
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.77
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.77
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.77
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.77
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.77
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.77
2div_A99 TRNA selenocysteine associated protein; structural 99.77
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.77
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.77
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.77
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.77
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.77
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.77
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.77
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.77
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.76
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.76
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.76
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.76
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.76
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.76
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.76
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.76
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.75
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.75
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.75
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.75
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.75
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.75
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.75
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.75
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.75
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.75
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.75
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.75
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.74
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.74
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.74
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.74
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.74
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.74
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.74
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.74
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.74
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.74
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.74
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.74
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.73
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.73
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.73
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.73
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.73
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.73
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.73
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.73
2dis_A109 Unnamed protein product; structural genomics, RRM 99.73
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.73
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.73
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.73
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.73
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.73
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.73
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.72
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.72
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.72
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.72
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.72
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.72
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.72
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.72
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.72
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.72
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.72
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.72
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.72
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.71
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.71
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.71
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.71
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.71
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.71
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.71
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.71
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.71
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.71
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.71
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.71
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.71
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.7
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.7
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.7
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.7
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.53
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.7
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.7
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.69
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.69
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.69
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.69
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.68
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.68
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.68
1x5p_A97 Negative elongation factor E; structure genomics, 99.68
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.68
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.68
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.67
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.67
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.66
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.66
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.66
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.66
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.66
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.65
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.65
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.65
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.64
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.64
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.64
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.63
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.63
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.63
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.63
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.63
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.62
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.62
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.62
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.62
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.62
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.61
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.61
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.61
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.61
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.6
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.6
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.59
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.59
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.58
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.58
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.58
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.58
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.57
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.56
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.56
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.55
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.55
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.54
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.53
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.53
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.53
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.52
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.5
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.49
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.48
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.48
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.48
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.48
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.48
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.47
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.46
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.46
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.45
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.44
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.42
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.42
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.41
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.38
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.36
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.28
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.19
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.17
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.94
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.93
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.29
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.82
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.64
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.39
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.25
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.24
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.94
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.49
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.07
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 95.84
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 95.3
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 94.48
2i2y_A150 Fusion protein consists of immunoglobin G- binding 94.43
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 87.54
2pnv_A43 Small conductance calcium-activated potassium chan 85.87
2l5g_A38 GPS2 protein, G protein pathway suppressor 2; GPS2 85.01
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 83.87
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 81.98
2ovc_A33 Potassium voltage-gated channel subfamily KQT MEM; 81.59
3bj4_A49 Potassium voltage-gated channel subfamily KQT memb 80.08
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
Probab=99.90  E-value=8.9e-23  Score=197.49  Aligned_cols=84  Identities=25%  Similarity=0.521  Sum_probs=78.2

Q ss_pred             CCCceEEEcCCCCCCcHHHHHHHhhcCCceEEEEEeeCCCC-CCceEEEEEeeChHHHHHHHHHcCCCccCCeEEEEEEe
Q 021537           37 DDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRST-RGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRVSEV  115 (311)
Q Consensus        37 ~~~~~lfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~~~~~-~~kg~aFVeF~~~~~A~~Al~~l~g~~i~Gr~l~V~~a  115 (311)
                      .+.++|||+|||+.||+++|..+|.+||.|..|.|+.+..+ +++|||||+|.+.++|++||..|||+.|+|+.|.|.++
T Consensus       100 ~~~~~lfV~nL~~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~Ai~~lng~~i~gr~i~V~~a  179 (437)
T 3pgw_S          100 DAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVE  179 (437)
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHHcCCeeEEEeeccCCCCCccceEEEeeccHHHHHHHHHHcCCCEECCEEEEEEEe
Confidence            44589999999999999999999999999999999998765 88999999999999999999999999999999999999


Q ss_pred             ccCCC
Q 021537          116 ATRGR  120 (311)
Q Consensus       116 ~~~~~  120 (311)
                      .+...
T Consensus       180 ~~~~~  184 (437)
T 3pgw_S          180 RGRTV  184 (437)
T ss_pred             CCCCC
Confidence            87544



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>2pnv_A Small conductance calcium-activated potassium channel protein 2; leucine zipper, SKCA channel, membrane protein; 2.10A {Rattus norvegicus} Back     alignment and structure
>2l5g_A GPS2 protein, G protein pathway suppressor 2; GPS2, SMRT, TBL1, CO-repressor, transcription regulator; NMR {Homo sapiens} Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2ovc_A Potassium voltage-gated channel subfamily KQT MEM; potassium channel, ION channel assemb coiled-coil, tetramer, transport protein; 2.07A {Homo sapiens} Back     alignment and structure
>3bj4_A Potassium voltage-gated channel subfamily KQT member 1; coiled coil, alternative splicing, deafness, disease mutation, glycoprotein, ION transport; 2.00A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 311
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 1e-16
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-16
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 7e-16
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-15
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-15
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 3e-15
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 5e-15
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-15
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-15
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-14
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 5e-14
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 6e-14
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 8e-14
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-13
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-13
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-13
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 2e-13
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 3e-13
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 4e-13
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 4e-13
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 5e-13
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 6e-13
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-13
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 2e-12
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-12
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-12
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 4e-12
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 4e-12
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 7e-12
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 7e-12
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 7e-12
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 8e-12
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 2e-11
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-11
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 3e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 3e-11
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 4e-11
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 4e-11
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 5e-11
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 5e-11
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 6e-11
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 6e-11
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 8e-11
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 1e-10
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 2e-10
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-10
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-10
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 4e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 4e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-10
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 6e-10
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 6e-10
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 9e-10
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 1e-09
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 1e-09
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-09
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-09
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 3e-09
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 4e-09
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-09
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 6e-09
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 7e-09
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 7e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 8e-09
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-08
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 5e-08
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 5e-08
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 6e-08
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-07
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 1e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 2e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 3e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 4e-06
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 6e-06
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 2e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 5e-05
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 8e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 1e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 0.001
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 0.004
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear factor Aly
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 71.5 bits (175), Expect = 1e-16
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 1/76 (1%)

Query: 42  VYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRSTRGKCYGFVTFGNPRSAVDAINDMN 101
           + V  L +  ++  ++++F ++G++    +  DRS R      V F     A+ A+   N
Sbjct: 3   LLVSNLDFGVSDADIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYN 62

Query: 102 GRTIDGRVVRVSEVAT 117
           G  +DGR + + ++ T
Sbjct: 63  GVPLDGRPMNI-QLVT 77


>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.84
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.84
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.83
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.83
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.83
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.83
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.81
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.81
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.81
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.81
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.81
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.81
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.8
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.8
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.8
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.8
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.8
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.8
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.79
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.79
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.79
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.79
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.79
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.79
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.79
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.79
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.78
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.78
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.78
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.77
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.77
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.77
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.77
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.76
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.76
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.76
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.76
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.76
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.76
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.75
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.75
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.75
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.75
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.75
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.75
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.74
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.74
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.73
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.73
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.73
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.73
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.73
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.73
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.72
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.72
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.72
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.72
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.72
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.72
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.71
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.71
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.71
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.71
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.7
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.7
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.69
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.68
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.68
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.67
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.66
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.64
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.63
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.62
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.6
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.58
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.55
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.55
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.48
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.47
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.41
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.4
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.4
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.34
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.87
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.48
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.02
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 93.92
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: CBP20, 20KDa nuclear cap-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84  E-value=1.1e-20  Score=142.81  Aligned_cols=84  Identities=23%  Similarity=0.423  Sum_probs=78.2

Q ss_pred             CCCCceEEEcCCCCCCcHHHHHHHhhcCCceEEEEEeeCCCC-CCceEEEEEeeChHHHHHHHHHcCCCccCCeEEEEEE
Q 021537           36 IDDESSVYVGGLPYSANEDSVRKVFDKYGSVVAVKIVNDRST-RGKCYGFVTFGNPRSAVDAINDMNGRTIDGRVVRVSE  114 (311)
Q Consensus        36 ~~~~~~lfVgnLp~~~te~~L~~~F~~~G~I~~v~i~~~~~~-~~kg~aFVeF~~~~~A~~Al~~l~g~~i~Gr~l~V~~  114 (311)
                      ...+++|||+|||+++|+++|.++|++||.|..|.|+.++.+ .++|||||+|.+.++|+.||+.|||..|+|++|.|+|
T Consensus         4 ~~~s~tlfV~nlp~~~te~~l~~~F~~~G~i~~v~i~~~~~~~~~kg~afV~f~~~~~A~~Ai~~l~g~~~~gr~i~V~~   83 (93)
T d1h2vz_           4 LKKSCTLYVGNLSFYTTEEQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDW   83 (93)
T ss_dssp             TTTCCEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHTTTSEETTEECEEEE
T ss_pred             cCCCCEEEEeCCCCCCCHHHHHHHHHHHCCcceeccccccccccccceEEEEECCHHHHHHHHHHhCCCEECCEEEEEEE
Confidence            346789999999999999999999999999999999998776 8999999999999999999999999999999999999


Q ss_pred             eccCC
Q 021537          115 VATRG  119 (311)
Q Consensus       115 a~~~~  119 (311)
                      +.+..
T Consensus        84 a~~~~   88 (93)
T d1h2vz_          84 DAGFK   88 (93)
T ss_dssp             ESCCC
T ss_pred             cCCCC
Confidence            87543



>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure