Citrus Sinensis ID: 021570

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MVTSSSLVCSPLTAPLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAWTEK
ccccccccccccccccccccccccHHHHcccccHHHHHHHHHHcccccccccccccEEcccccccccccccccHHcHHHHHHcccccEEccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHcccEEccccccccccHHHHHHcHHHHHHccccccccEEEEccccccccccHHHHHHHcccccEEEEEEEcccccccccccccccccccccccccEEEEEEEccc
ccccHHHHcccccccccccccccccccccccccHHHHHHccccccccccccccccEcccccccccccccccccHHHHHHHHHccccEEEEEcccccccccEEEEEccccHHHEcHHHHHHHHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHcHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccEEEccccccHHHHHHHHHcc
mvtssslvcspltaplciskksslatlklgyisPITAARRLKQNLYkvsykpcnsvvckavsvkpqtgieglnIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEImepccsvkdrigfsMIADAeqkglitpgksilveptsgntgiGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNStpnaymlqqfdnpanpkihyettgpeiwedtrgkvdifiggigtggtisgagrylkeknpniKVIIFVLFIskpylacvpypppslcltcqsesVLKLVAWTEK
mvtssslvcspltaplciskksslatlKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAWTEK
MVTSSSLVCSPLTAPLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDifiggigtggtisgagRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAWTEK
*******VCSPLTAPLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKG**********ILN**PNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAW***
*****S**CSPLTAPL********************************************************NIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKP*****PYPPPSLCLTCQSESVLKLVAWT**
********CSPLTAPLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAWTEK
************T*PLC*************************************SVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAWTEK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTSSSLVCSPLTAPLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLVAWTEK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query311 2.2.26 [Sep-21-2011]
P31300374 Cysteine synthase, chloro N/A no 0.700 0.582 0.886 1e-103
O81155386 Cysteine synthase, chloro N/A no 0.848 0.683 0.744 1e-102
P47999392 Cysteine synthase, chloro yes no 0.758 0.602 0.771 1e-100
P32260383 Cysteine synthase, chloro N/A no 0.810 0.657 0.730 1e-100
Q43725430 Cysteine synthase, mitoch no no 0.694 0.502 0.830 2e-98
Q00834325 Cysteine synthase OS=Spin N/A no 0.639 0.612 0.788 2e-85
O23733322 Cysteine synthase OS=Bras N/A no 0.639 0.618 0.763 2e-82
Q9XEA8325 Cysteine synthase OS=Oryz no no 0.646 0.618 0.761 4e-82
Q43317325 Cysteine synthase OS=Citr N/A no 0.636 0.609 0.767 5e-82
O23735324 Cysteine synthase OS=Bras N/A no 0.643 0.617 0.76 1e-81
>sp|P31300|CYSKP_CAPAN Cysteine synthase, chloroplastic/chromoplastic OS=Capsicum annuum PE=2 SV=1 Back     alignment and function desciption
 Score =  374 bits (959), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/220 (88%), Positives = 209/220 (95%), Gaps = 2/220 (0%)

Query: 55  SVVCKAVSV--KPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCC 112
           SVVCKAVSV  K  T IEGLNIAEDVTQLIG TPMVYLNTIVKGCVANIAAKLEIMEPCC
Sbjct: 46  SVVCKAVSVQTKSPTEIEGLNIAEDVTQLIGNTPMVYLNTIVKGCVANIAAKLEIMEPCC 105

Query: 113 SVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSL 172
           SVKDRIGFSMI+DAE+KGLI+PGK++LVEPTSGNTGIGLAFIAAS+GYKLILTMPASMSL
Sbjct: 106 SVKDRIGFSMISDAEEKGLISPGKTVLVEPTSGNTGIGLAFIAASRGYKLILTMPASMSL 165

Query: 173 ERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGP 232
           ERRV+LKAFGAELVLTD AKGMKGAV KAEEILN+TP+AY+LQQFDNPANPKIHYETTGP
Sbjct: 166 ERRVILKAFGAELVLTDPAKGMKGAVSKAEEILNNTPDAYILQQFDNPANPKIHYETTGP 225

Query: 233 EIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVI 272
           EIWEDT+GK+DI + GIGTGGTISG GRYLKEKNPNIK+I
Sbjct: 226 EIWEDTKGKIDILVAGIGTGGTISGTGRYLKEKNPNIKII 265

Capsicum annuum (taxid: 4072)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 4EC: 7
>sp|O81155|CYSKP_SOLTU Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1 Back     alignment and function description
>sp|P47999|CYSKP_ARATH Cysteine synthase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=OASB PE=1 SV=2 Back     alignment and function description
>sp|P32260|CYSKP_SPIOL Cysteine synthase, chloroplastic/chromoplastic OS=Spinacia oleracea GN=CYSK PE=1 SV=2 Back     alignment and function description
>sp|Q43725|CYSKM_ARATH Cysteine synthase, mitochondrial OS=Arabidopsis thaliana GN=OASC PE=1 SV=3 Back     alignment and function description
>sp|Q00834|CYSK_SPIOL Cysteine synthase OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function description
>sp|O23733|CYSK1_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description
>sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 Back     alignment and function description
>sp|Q43317|CYSK_CITLA Cysteine synthase OS=Citrullus lanatus PE=1 SV=1 Back     alignment and function description
>sp|O23735|CYSK2_BRAJU Cysteine synthase OS=Brassica juncea PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
356500110384 PREDICTED: cysteine synthase, chloroplas 0.723 0.585 0.853 1e-110
356500108394 PREDICTED: cysteine synthase, chloroplas 0.723 0.571 0.853 1e-110
351727959389 OAS-TL4 cysteine synthase [Glycine max] 0.710 0.568 0.864 1e-109
359478205373 PREDICTED: cysteine synthase, chloroplas 0.733 0.611 0.879 1e-106
225434133382 PREDICTED: cysteine synthase, chloroplas 0.733 0.596 0.879 1e-106
255567778408 cysteine synthase, putative [Ricinus com 0.697 0.531 0.921 1e-105
118489469402 unknown [Populus trichocarpa x Populus d 0.874 0.676 0.763 1e-105
255639195389 unknown [Glycine max] 0.710 0.568 0.882 1e-105
224121772336 predicted protein [Populus trichocarpa] 0.697 0.645 0.908 1e-103
12081921376 plastidic cysteine synthase 2 [Solanum t 0.848 0.702 0.755 1e-101
>gi|356500110|ref|XP_003518877.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like isoform 2 [Glycine max] Back     alignment and taxonomy information
 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 193/226 (85%), Positives = 212/226 (93%), Gaps = 1/226 (0%)

Query: 47  KVSYKPCNSVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLE 106
           ++S  P ++VVCKAVSVKPQT  EGLNIA+DVTQLIGKTPMVYLN IVKG VANIAAKLE
Sbjct: 51  RISSSP-STVVCKAVSVKPQTETEGLNIADDVTQLIGKTPMVYLNNIVKGSVANIAAKLE 109

Query: 107 IMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTM 166
           IMEPCCSVKDRIGFSMI DAEQ+G ITPGKSILVEPTSGNTGIGLAFIAAS+GYKLILTM
Sbjct: 110 IMEPCCSVKDRIGFSMINDAEQRGAITPGKSILVEPTSGNTGIGLAFIAASRGYKLILTM 169

Query: 167 PASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIH 226
           PASMSLERRVLLKAFGAELVLTD+AKGM GAVQKAEEIL STPN+YMLQQFDNP+NPK+H
Sbjct: 170 PASMSLERRVLLKAFGAELVLTDAAKGMNGAVQKAEEILKSTPNSYMLQQFDNPSNPKVH 229

Query: 227 YETTGPEIWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVI 272
           YETTGPEIWEDTRGK+DI + GIGTGGT+SGAG++LK++NP I+VI
Sbjct: 230 YETTGPEIWEDTRGKIDILVAGIGTGGTVSGAGQFLKQQNPKIQVI 275

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356500108|ref|XP_003518876.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|351727959|ref|NP_001235131.1| OAS-TL4 cysteine synthase [Glycine max] gi|148562457|gb|ABQ88339.1| OAS-TL4 cysteine synthase [Glycine max] gi|148562460|gb|ABQ88340.1| OAS-TL4 cysteine synthase [Glycine max] Back     alignment and taxonomy information
>gi|359478205|ref|XP_003632085.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225434133|ref|XP_002277485.1| PREDICTED: cysteine synthase, chloroplastic/chromoplastic isoform 1 [Vitis vinifera] gi|296084309|emb|CBI24697.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255567778|ref|XP_002524867.1| cysteine synthase, putative [Ricinus communis] gi|223535830|gb|EEF37491.1| cysteine synthase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|118489469|gb|ABK96537.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|255639195|gb|ACU19896.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224121772|ref|XP_002330649.1| predicted protein [Populus trichocarpa] gi|222872253|gb|EEF09384.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|12081921|dbj|BAB20863.1| plastidic cysteine synthase 2 [Solanum tuberosum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
TAIR|locus:2043964392 OASB "O-acetylserine (thiol) l 0.861 0.683 0.671 2.7e-91
TAIR|locus:2080417433 OASC "O-acetylserine (thiol) l 0.861 0.618 0.648 3.2e-88
TAIR|locus:2130419322 OASA1 "O-acetylserine (thiol) 0.636 0.614 0.696 1.4e-73
TAIR|locus:2096454404 CS26 "cysteine synthase 26" [A 0.652 0.502 0.645 1.3e-66
TAIR|locus:2143814323 CYSD2 "cysteine synthase D2" [ 0.675 0.650 0.597 8.5e-65
TAIR|locus:2114804324 CYSD1 "cysteine synthase D1" [ 0.639 0.614 0.623 2.3e-64
UNIPROTKB|Q76MX2351 PCAS-1 "Bifunctional L-3-cyano 0.652 0.578 0.605 9.7e-64
TAIR|locus:2143754323 DES1 "L-cysteine desulfhydrase 0.643 0.619 0.625 1.2e-63
UNIPROTKB|Q1KLZ2376 CAS1 "L-3-cyanoalanine synthas 0.652 0.539 0.581 1.8e-62
UNIPROTKB|Q43153368 CYSC "Bifunctional L-3-cyanoal 0.749 0.633 0.533 1.8e-62
TAIR|locus:2043964 OASB "O-acetylserine (thiol) lyase B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 910 (325.4 bits), Expect = 2.7e-91, P = 2.7e-91
 Identities = 182/271 (67%), Positives = 214/271 (78%)

Query:     3 TSSSLVCSPLTAPLCISKKS-SLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVCKAV 61
             +SS+ + +PLT+     K S  L++L L   S   AA  +    + +  +  + VVCKAV
Sbjct:     5 SSSAFLLNPLTSRHRPFKYSPELSSLSLS--SRKAAAFDVSSAAFTLKRQSRSDVVCKAV 62

Query:    62 SVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFS 121
             S+KP+ G+EGLNIA++  QLIGKTPMVYLN +VKGCVA++AAKLEIMEPCCSVKDRIG+S
Sbjct:    63 SIKPEAGVEGLNIADNAAQLIGKTPMVYLNNVVKGCVASVAAKLEIMEPCCSVKDRIGYS 122

Query:   122 MIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAF 181
             MI DAE+KGLITPGKS+LVE TSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLL+AF
Sbjct:   123 MITDAEEKGLITPGKSVLVESTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLRAF 182

Query:   182 GAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGK 241
             GAELVLT+ AKGM GA+QKAEEIL  TPN+YMLQQFDNPANPKIHYETTGPEIWEDTRGK
Sbjct:   183 GAELVLTEPAKGMTGAIQKAEEILKKTPNSYMLQQFDNPANPKIHYETTGPEIWEDTRGK 242

Query:   242 VDXXXXXXXXXXXXXXXXRYLKEKNPNIKVI 272
             +D                R++KE+ P +KVI
Sbjct:   243 IDILVAGIGTGGTITGVGRFIKERKPELKVI 273
GO:0003824 "catalytic activity" evidence=IEA
GO:0004124 "cysteine synthase activity" evidence=IEA;ISS;IDA
GO:0006535 "cysteine biosynthetic process from serine" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0009536 "plastid" evidence=TAS
GO:0019344 "cysteine biosynthetic process" evidence=RCA;IDA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0046686 "response to cadmium ion" evidence=IEP
GO:0048046 "apoplast" evidence=IDA
GO:0000096 "sulfur amino acid metabolic process" evidence=RCA
GO:0006546 "glycine catabolic process" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0006733 "oxidoreduction coenzyme metabolic process" evidence=RCA
GO:0006766 "vitamin metabolic process" evidence=RCA
GO:0008652 "cellular amino acid biosynthetic process" evidence=RCA
GO:0009072 "aromatic amino acid family metabolic process" evidence=RCA
GO:0009073 "aromatic amino acid family biosynthetic process" evidence=RCA
GO:0009106 "lipoate metabolic process" evidence=RCA
GO:0009108 "coenzyme biosynthetic process" evidence=RCA
GO:0009117 "nucleotide metabolic process" evidence=RCA
GO:0009684 "indoleacetic acid biosynthetic process" evidence=RCA
GO:0009695 "jasmonic acid biosynthetic process" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019748 "secondary metabolic process" evidence=RCA
GO:0019761 "glucosinolate biosynthetic process" evidence=RCA
GO:0030154 "cell differentiation" evidence=RCA
GO:0044272 "sulfur compound biosynthetic process" evidence=RCA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA
GO:0005768 "endosome" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005802 "trans-Golgi network" evidence=IDA
TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096454 CS26 "cysteine synthase 26" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q76MX2 PCAS-1 "Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial" [Solanum tuberosum (taxid:4113)] Back     alignment and assigned GO terms
TAIR|locus:2143754 DES1 "L-cysteine desulfhydrase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] Back     alignment and assigned GO terms
UNIPROTKB|Q43153 CYSC "Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial" [Spinacia oleracea (taxid:3562)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0A535CYSK_MYCBO2, ., 5, ., 1, ., 4, 70.55720.64300.6451yesno
P0A534CYSK_MYCTU2, ., 5, ., 1, ., 4, 70.55720.64300.6451yesno
P63871CYSK_STAAN2, ., 5, ., 1, ., 4, 70.54040.62700.6290yesno
P63872CYSK_STAAW2, ., 5, ., 1, ., 4, 70.54040.62700.6290yesno
P37887CYSK_BACSU2, ., 5, ., 1, ., 4, 70.55220.63660.6428yesno
P63870CYSK_STAAM2, ., 5, ., 1, ., 4, 70.54040.62700.6290yesno
P47999CYSKP_ARATH2, ., 5, ., 1, ., 4, 70.77110.75880.6020yesno
O81155CYSKP_SOLTU2, ., 5, ., 1, ., 4, 70.74440.84880.6839N/Ano
P38076CYSK_WHEAT2, ., 5, ., 1, ., 4, 70.73230.63660.6092N/Ano
Q6GJF8CYSK_STAAR2, ., 5, ., 1, ., 4, 70.54040.62700.6290yesno
Q6GBX5CYSK_STAAS2, ., 5, ., 1, ., 4, 70.54040.62700.6290yesno
O81154CYSK_SOLTU2, ., 5, ., 1, ., 4, 70.72270.64950.6215N/Ano
Q5HIG2CYSK_STAAC2, ., 5, ., 1, ., 4, 70.54040.62700.6290yesno
P32260CYSKP_SPIOL2, ., 5, ., 1, ., 4, 70.73070.81020.6579N/Ano
Q8CMT6CYSK_STAES2, ., 5, ., 1, ., 4, 70.55610.62050.6225yesno
O32978CYSK_MYCLE2, ., 5, ., 1, ., 4, 70.55720.64300.6451yesno
Q7DDL5CYSK_NEIMB2, ., 5, ., 1, ., 4, 70.52970.64300.6451yesno
Q43317CYSK_CITLA2, ., 5, ., 1, ., 5, 20.76760.63660.6092N/Ano
Q00834CYSK_SPIOL2, ., 5, ., 1, ., 4, 70.78890.63980.6123N/Ano
P80608CYSK_MAIZE2, ., 5, ., 1, ., 4, 70.74370.63980.6123N/Ano
O23733CYSK1_BRAJU2, ., 5, ., 1, ., 4, 70.76380.63980.6180N/Ano
Q5HRP1CYSK_STAEQ2, ., 5, ., 1, ., 4, 70.55610.62050.6225yesno
O23735CYSK2_BRAJU2, ., 5, ., 1, ., 4, 70.760.64300.6172N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.470.946
3rd Layer2.5.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
PLN03013429 PLN03013, PLN03013, cysteine synthase 1e-127
PLN02565322 PLN02565, PLN02565, cysteine synthase 1e-125
TIGR01136299 TIGR01136, cysKM, cysteine synthase 1e-113
TIGR01139298 TIGR01139, cysK, cysteine synthase A 1e-110
cd01561291 cd01561, CBS_like, CBS_like: This subgroup include 1e-109
PLN02556368 PLN02556, PLN02556, cysteine synthase/L-3-cyanoala 1e-109
COG0031300 COG0031, CysK, Cysteine synthase [Amino acid trans 1e-106
PLN00011323 PLN00011, PLN00011, cysteine synthase 1e-105
PRK10717330 PRK10717, PRK10717, cysteine synthase A; Provision 1e-88
PRK11761296 PRK11761, cysM, cysteine synthase B; Provisional 8e-79
TIGR01137 454 TIGR01137, cysta_beta, cystathionine beta-synthase 1e-72
TIGR01138290 TIGR01138, cysM, cysteine synthase B 2e-69
cd00640244 cd00640, Trp-synth-beta_II, Tryptophan synthase be 1e-66
TIGR03945304 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio 3e-52
pfam00291295 pfam00291, PALP, Pyridoxal-phosphate dependent enz 1e-48
PLN02356 423 PLN02356, PLN02356, phosphateglycerate kinase 7e-31
COG1171 347 COG1171, IlvA, Threonine dehydratase [Amino acid t 1e-17
cd01562304 cd01562, Thr-dehyd, Threonine dehydratase: The fir 1e-13
TIGR01127 380 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, m 2e-11
PRK08638333 PRK08638, PRK08638, threonine dehydratase; Validat 4e-10
PRK06382 406 PRK06382, PRK06382, threonine dehydratase; Provisi 2e-09
TIGR02079 409 TIGR02079, THD1, threonine dehydratase 2e-08
TIGR01124 499 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, b 4e-08
PRK12483 521 PRK12483, PRK12483, threonine dehydratase; Reviewe 1e-07
PRK08526 403 PRK08526, PRK08526, threonine dehydratase; Provisi 3e-07
cd01563324 cd01563, Thr-synth_1, Threonine synthase is a pyri 2e-06
PRK08198 404 PRK08198, PRK08198, threonine dehydratase; Provisi 4e-06
COG0498 411 COG0498, ThrC, Threonine synthase [Amino acid tran 1e-05
PRK08639 420 PRK08639, PRK08639, threonine dehydratase; Validat 1e-05
PRK06815317 PRK06815, PRK06815, hypothetical protein; Provisio 2e-05
PLN02550 591 PLN02550, PLN02550, threonine dehydratase 4e-05
PRK06381319 PRK06381, PRK06381, threonine synthase; Validated 4e-05
PRK09224 504 PRK09224, PRK09224, threonine dehydratase; Reviewe 4e-05
PRK08329347 PRK08329, PRK08329, threonine synthase; Validated 9e-05
PRK06608338 PRK06608, PRK06608, threonine dehydratase; Provisi 1e-04
PRK06721 352 PRK06721, PRK06721, threonine synthase; Reviewed 1e-04
PRK08246310 PRK08246, PRK08246, threonine dehydratase; Provisi 4e-04
TIGR02991317 TIGR02991, ectoine_eutB, ectoine utilization prote 4e-04
PRK06450338 PRK06450, PRK06450, threonine synthase; Validated 9e-04
PRK06110322 PRK06110, PRK06110, hypothetical protein; Provisio 0.002
TIGR03528 396 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammoni 0.003
PRK07476322 PRK07476, eutB, threonine dehydratase; Provisional 0.004
>gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase Back     alignment and domain information 
 Score =  368 bits (946), Expect = e-127
 Identities = 191/276 (69%), Positives = 227/276 (82%), Gaps = 8/276 (2%)

Query: 3   TSSSLVCSPLTAPLCISK------KSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSV 56
           +SS+L+ +PLT+    S          +++L     S  + A + +   +    +   SV
Sbjct: 38  SSSALLLNPLTSSSSSSTLRRFRCSPEISSLSFSSASDFSLAMKRQSRSFADGSERDPSV 97

Query: 57  VCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKD 116
           VC+AV  K +TG +GLNIA++V+QLIGKTPMVYLN+I KGCVANIAAKLEIMEPCCSVKD
Sbjct: 98  VCEAV--KRETGPDGLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKD 155

Query: 117 RIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRV 176
           RIG+SM+ DAEQKG I+PGKS+LVEPTSGNTGIGLAFIAAS+GY+LILTMPASMS+ERRV
Sbjct: 156 RIGYSMVTDAEQKGFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRV 215

Query: 177 LLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWE 236
           LLKAFGAELVLTD AKGM GAVQKAEEIL +TP+AYMLQQFDNPANPKIHYETTGPEIW+
Sbjct: 216 LLKAFGAELVLTDPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWD 275

Query: 237 DTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVI 272
           DT+GKVDIF+ GIGTGGTI+G GR++KEKNP  +VI
Sbjct: 276 DTKGKVDIFVAGIGTGGTITGVGRFIKEKNPKTQVI 311

Length = 429
>gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase Back     alignment and domain information
>gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase Back     alignment and domain information
>gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A Back     alignment and domain information
>gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase Back     alignment and domain information
>gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional Back     alignment and domain information
>gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional Back     alignment and domain information
>gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B Back     alignment and domain information
>gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA Back     alignment and domain information
>gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme Back     alignment and domain information
>gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase Back     alignment and domain information
>gnl|CDD|224092 COG1171, IlvA, Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107205 cd01562, Thr-dehyd, Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>gnl|CDD|130197 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, medium form Back     alignment and domain information
>gnl|CDD|236317 PRK08638, PRK08638, threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|180550 PRK06382, PRK06382, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|233712 TIGR02079, THD1, threonine dehydratase Back     alignment and domain information
>gnl|CDD|130194 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>gnl|CDD|237111 PRK12483, PRK12483, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|181457 PRK08526, PRK08526, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|107206 cd01563, Thr-synth_1, Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>gnl|CDD|236182 PRK08198, PRK08198, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|223572 COG0498, ThrC, Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|236318 PRK08639, PRK08639, threonine dehydratase; Validated Back     alignment and domain information
>gnl|CDD|180709 PRK06815, PRK06815, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178165 PLN02550, PLN02550, threonine dehydratase Back     alignment and domain information
>gnl|CDD|235789 PRK06381, PRK06381, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|236417 PRK09224, PRK09224, threonine dehydratase; Reviewed Back     alignment and domain information
>gnl|CDD|236244 PRK08329, PRK08329, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|235842 PRK06608, PRK06608, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|136018 PRK06721, PRK06721, threonine synthase; Reviewed Back     alignment and domain information
>gnl|CDD|181319 PRK08246, PRK08246, threonine dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|132036 TIGR02991, ectoine_eutB, ectoine utilization protein EutB Back     alignment and domain information
>gnl|CDD|180565 PRK06450, PRK06450, threonine synthase; Validated Back     alignment and domain information
>gnl|CDD|235699 PRK06110, PRK06110, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|234245 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammonia-lyase Back     alignment and domain information
>gnl|CDD|236025 PRK07476, eutB, threonine dehydratase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
PRK07591421 threonine synthase; Validated 100.0
PRK08197394 threonine synthase; Validated 100.0
PRK06260397 threonine synthase; Validated 100.0
PLN02569 484 threonine synthase 100.0
PRK05638 442 threonine synthase; Validated 100.0
PRK08329347 threonine synthase; Validated 100.0
PRK06450338 threonine synthase; Validated 100.0
PLN02565322 cysteine synthase 100.0
COG1171347 IlvA Threonine dehydratase [Amino acid transport a 100.0
PLN03013429 cysteine synthase 100.0
PRK06352351 threonine synthase; Validated 100.0
PRK02991441 D-serine dehydratase; Provisional 100.0
COG0031300 CysK Cysteine synthase [Amino acid transport and m 100.0
PLN00011323 cysteine synthase 100.0
PRK08526 403 threonine dehydratase; Provisional 100.0
TIGR02035431 D_Ser_am_lyase D-serine ammonia-lyase. This family 100.0
PLN02556368 cysteine synthase/L-3-cyanoalanine synthase 100.0
PLN02970328 serine racemase 100.0
PRK11761296 cysM cysteine synthase B; Provisional 100.0
PRK06382 406 threonine dehydratase; Provisional 100.0
PRK08198 404 threonine dehydratase; Provisional 100.0
TIGR01139298 cysK cysteine synthase A. This model distinguishes 100.0
PRK07476322 eutB threonine dehydratase; Provisional 100.0
PRK10717330 cysteine synthase A; Provisional 100.0
PRK08638333 threonine dehydratase; Validated 100.0
PRK06721352 threonine synthase; Reviewed 100.0
PRK12483 521 threonine dehydratase; Reviewed 100.0
TIGR01136299 cysKM cysteine synthases. This model discriminates 100.0
cd06447404 D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph 100.0
PRK07409353 threonine synthase; Validated 100.0
TIGR01138290 cysM cysteine synthase B. Alternate name: O-acetyl 100.0
cd01563324 Thr-synth_1 Threonine synthase is a pyridoxal phos 100.0
PRK06110322 hypothetical protein; Provisional 100.0
PRK06608338 threonine dehydratase; Provisional 100.0
TIGR02991317 ectoine_eutB ectoine utilization protein EutB. Mem 100.0
TIGR02079 409 THD1 threonine dehydratase. This model represents 100.0
PRK07048321 serine/threonine dehydratase; Validated 100.0
cd01561291 CBS_like CBS_like: This subgroup includes Cystathi 100.0
PLN02550 591 threonine dehydratase 100.0
PRK08639 420 threonine dehydratase; Validated 100.0
cd06448316 L-Ser-dehyd Serine dehydratase is a pyridoxal phos 100.0
TIGR01127 380 ilvA_1Cterm threonine dehydratase, medium form. A 100.0
TIGR03844398 cysteate_syn cysteate synthase. Members of this fa 100.0
TIGR01124 499 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, 100.0
PRK08813349 threonine dehydratase; Provisional 100.0
PRK07334 403 threonine dehydratase; Provisional 100.0
PLN02356423 phosphateglycerate kinase 100.0
KOG1250 457 consensus Threonine/serine dehydratases [Amino aci 100.0
PRK09224 504 threonine dehydratase; Reviewed 100.0
PRK06815317 hypothetical protein; Provisional 100.0
cd01562304 Thr-dehyd Threonine dehydratase: The first step in 100.0
PRK08246310 threonine dehydratase; Provisional 100.0
TIGR00260328 thrC threonine synthase. Involved in threonine bio 100.0
TIGR01137 454 cysta_beta cystathionine beta-synthase. Members of 100.0
PRK06381319 threonine synthase; Validated 100.0
PRK08206399 diaminopropionate ammonia-lyase; Provisional 100.0
KOG1252362 consensus Cystathionine beta-synthase and related 100.0
TIGR01415419 trpB_rel pyridoxal-phosphate dependent TrpB-like e 100.0
TIGR01747376 diampropi_NH3ly diaminopropionate ammonia-lyase fa 100.0
KOG1251323 consensus Serine racemase [Signal transduction mec 100.0
TIGR03528396 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem 100.0
PRK12391427 tryptophan synthase subunit beta; Reviewed 100.0
cd00640244 Trp-synth-beta_II Tryptophan synthase beta superfa 100.0
COG0498 411 ThrC Threonine synthase [Amino acid transport and 100.0
PRK13028402 tryptophan synthase subunit beta; Provisional 100.0
cd06446365 Trp-synth_B Tryptophan synthase-beta: Trptophan sy 100.0
PRK04346397 tryptophan synthase subunit beta; Validated 100.0
PLN02618410 tryptophan synthase, beta chain 100.0
TIGR00263385 trpB tryptophan synthase, beta subunit. Tryptophan 100.0
PRK03910331 D-cysteine desulfhydrase; Validated 100.0
TIGR01275311 ACC_deam_rel pyridoxal phosphate-dependent enzymes 100.0
PF00291306 PALP: Pyridoxal-phosphate dependent enzyme; InterP 100.0
PRK13802695 bifunctional indole-3-glycerol phosphate synthase/ 100.0
TIGR01274337 ACC_deam 1-aminocyclopropane-1-carboxylate deamina 100.0
PRK12390337 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
KOG1481391 consensus Cysteine synthase [Amino acid transport 100.0
cd06449307 ACCD Aminocyclopropane-1-carboxylate deaminase (AC 100.0
PRK13803610 bifunctional phosphoribosylanthranilate isomerase/ 100.0
PRK14045329 1-aminocyclopropane-1-carboxylate deaminase; Provi 100.0
COG1350 432 Predicted alternative tryptophan synthase beta-sub 99.97
COG3048443 DsdA D-serine dehydratase [Amino acid transport an 99.97
COG0133396 TrpB Tryptophan synthase beta chain [Amino acid tr 99.96
PRK09225 462 threonine synthase; Validated 99.95
cd01560 460 Thr-synth_2 Threonine synthase catalyzes the final 99.94
COG2515323 Acd 1-aminocyclopropane-1-carboxylate deaminase [A 99.92
KOG1395477 consensus Tryptophan synthase beta chain [Amino ac 99.92
PF03808172 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp 90.98
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 90.64
PRK10669558 putative cation:proton antiport protein; Provision 87.48
cd06533171 Glyco_transf_WecG_TagA The glycosyltransferase Wec 87.27
PRK03659601 glutathione-regulated potassium-efflux system prot 87.21
PRK03562621 glutathione-regulated potassium-efflux system prot 86.77
PF00764 388 Arginosuc_synth: Arginosuccinate synthase; InterPr 86.57
PF09837122 DUF2064: Uncharacterized protein conserved in bact 86.1
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 86.03
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 85.75
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 84.42
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 83.63
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 83.41
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 83.35
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 82.07
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 81.98
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 80.62
TIGR00670301 asp_carb_tr aspartate carbamoyltransferase. Ornith 80.61
>PRK07591 threonine synthase; Validated Back     alignment and domain information 
Probab=100.00  E-value=1.4e-55  Score=430.30  Aligned_cols=277  Identities=17%  Similarity=0.177  Sum_probs=237.6

Q ss_pred             cCCCCcccccCCCCCccccccCcCccchH--------HHhhccccccccc--CCCcccccccCCCCCCCccccchhhhcc
Q 021570           10 SPLTAPLCISKKSSLATLKLGYISPITAA--------RRLKQNLYKVSYK--PCNSVVCKAVSVKPQTGIEGLNIAEDVT   79 (311)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~~~~--~~~~wRy~~llP~~~~~~~~~~~~~~i~   79 (311)
                      ++...-.|+.|..+|+.... |.+|.+..        +.++....+..+.  ..++|||+++||+++        ...++
T Consensus        14 ~~~~~l~C~~Cg~~~~~~~~-~~C~~cg~~l~~~y~~~~~~~~~~~~~~~~~~~~~wry~~~lp~~~--------~~~v~   84 (421)
T PRK07591         14 GPAVALKCRECGAEYPLGPI-HVCEECFGPLEVAYDYDAIRKRVSRESIEAGPKSIWRYRDLLPVPA--------DNPVD   84 (421)
T ss_pred             cceeEEEeCCCCCcCCCCCC-ccCCCCCCeEEEEechhhhccccChhhhhccccchhcchhhCcccc--------CCCCc
Confidence            55566779999999987655 88886532        2222222222222  248999999999831        12488


Q ss_pred             cccCCCceeecccccccCCC-eEEEeeCCCCCCCchhhHHHHHHHHHHHHcCCCCCCCceEEeeCcChHHHHHHHHHHHc
Q 021570           80 QLIGKTPMVYLNTIVKGCVA-NIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASK  158 (311)
Q Consensus        80 ~~~g~TPL~~~~~l~~~~g~-~l~vK~E~~nPtGS~KdRga~~~v~~A~~~G~~~~g~~~vv~aSsGN~g~AlA~~aa~~  158 (311)
                      +++|+|||+++++|++.+|. +||+|+|++|||||||||++.+++.+|++.|.     ++|+++|+||||+|+|++|+++
T Consensus        85 l~eG~TPLv~~~~l~~~lG~~~l~~K~E~~nPtGSfKdRga~~~v~~A~~~g~-----~~vv~aSsGN~g~alA~~aa~~  159 (421)
T PRK07591         85 LGPGFTPLVKADRLARELGLKNLYIKDDSVNPTHSFKDRVVSVALTAARELGF-----TTVACASTGNLANSVAAHAARA  159 (421)
T ss_pred             CCCCCCcceEhHHHHHHhCCCcEEEEeCCCCCccChHHHHHHHHHHHHHHcCC-----CEEEEeCCCHHHHHHHHHHHHc
Confidence            99999999999999998885 99999999999999999999999999999995     6799999999999999999999


Q ss_pred             CCeEEEEECCCCCHHHHHHHHhcCCEEEEECCCCChHHHHHHHHHHHHhCCCceeeCCCCCCcchHhhHHHHHHHHHHHc
Q 021570          159 GYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDT  238 (311)
Q Consensus       159 Gi~~~vv~p~~~~~~k~~~l~~~GA~V~~v~~~~~~~~a~~~a~~~~~~~~~~~~~~~~~n~~~~~~G~~t~a~Ei~~Ql  238 (311)
                      |++|+||||+++++.|+.+++.|||+|+.++++  ++++.+.+.+++++.++++|++++.||+.++ |++|+++||++|+
T Consensus       160 Gl~~~I~vP~~~~~~k~~~~~~~GA~Vi~v~g~--~d~a~~~a~~~~~~~~~~~~~n~~~~p~~ie-G~~Tia~Ei~eQl  236 (421)
T PRK07591        160 GLDSCVFIPADLEAGKIVGTLVYGPTLVAVDGN--YDDVNRLCSELANEHEGWGFVNINLRPYYAE-GSKTLGYEVAEQL  236 (421)
T ss_pred             CCCEEEEEcCCCCHHHHHHHHHcCCEEEEECCC--HHHHHHHHHHHHHhcCCEEEecCCCCccccc-chHHHHHHHHHHc
Confidence            999999999999999999999999999999987  8999999999988765789999988999995 9999999999999


Q ss_pred             CCC-CCEEEEccChhhHHHHHHHHHHhc-------CCCCEEEEEeCCCCchhhhcCC--------CCCccccccccCCcc
Q 021570          239 RGK-VDIFIGGIGTGGTISGAGRYLKEK-------NPNIKVIIFVLFISKPYLACVP--------YPPPSLCLTCQSESV  302 (311)
Q Consensus       239 ~~~-pD~vv~pvG~Gg~~~Gi~~~lk~~-------~p~~~iigVe~~~s~~~~~~~~--------~~~~tiadgl~~~~~  302 (311)
                      ++. ||+||+|+|+||+++|++++|+++       .+.+|||+|||++++++.+++.        ...+|+|+||+++.+
T Consensus       237 ~~~~pD~iv~pvG~Gg~~~Gv~~g~kel~~~g~i~~~~prii~Vq~~g~~~~~~~~~~g~~~~~~~~~~tia~~l~~~~p  316 (421)
T PRK07591        237 GWRLPDQVVAPLASGSLLTKIDKGFQELIKVGLVEDKPVRVFGAQAEGCSPIAQAFKEGRDVVKPVKPNTIAKSLAIGNP  316 (421)
T ss_pred             CCCCCCEEEEeCCchHHHHHHHHHHHHHHhcCCccCCCceEEEEecCCCCHHHHHHHcCCCcccCCCCCchhhheecCCC
Confidence            865 999999999999999999999997       5789999999999999987532        246899999988775


Q ss_pred             c
Q 021570          303 L  303 (311)
Q Consensus       303 ~  303 (311)
                      .
T Consensus       317 ~  317 (421)
T PRK07591        317 A  317 (421)
T ss_pred             C
Confidence            3

>PRK08197 threonine synthase; Validated Back     alignment and domain information
>PRK06260 threonine synthase; Validated Back     alignment and domain information
>PLN02569 threonine synthase Back     alignment and domain information
>PRK05638 threonine synthase; Validated Back     alignment and domain information
>PRK08329 threonine synthase; Validated Back     alignment and domain information
>PRK06450 threonine synthase; Validated Back     alignment and domain information
>PLN02565 cysteine synthase Back     alignment and domain information
>COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03013 cysteine synthase Back     alignment and domain information
>PRK06352 threonine synthase; Validated Back     alignment and domain information
>PRK02991 D-serine dehydratase; Provisional Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00011 cysteine synthase Back     alignment and domain information
>PRK08526 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase Back     alignment and domain information
>PLN02556 cysteine synthase/L-3-cyanoalanine synthase Back     alignment and domain information
>PLN02970 serine racemase Back     alignment and domain information
>PRK11761 cysM cysteine synthase B; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR01139 cysK cysteine synthase A Back     alignment and domain information
>PRK07476 eutB threonine dehydratase; Provisional Back     alignment and domain information
>PRK10717 cysteine synthase A; Provisional Back     alignment and domain information
>PRK08638 threonine dehydratase; Validated Back     alignment and domain information
>PRK06721 threonine synthase; Reviewed Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>TIGR01136 cysKM cysteine synthases Back     alignment and domain information
>cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia Back     alignment and domain information
>PRK07409 threonine synthase; Validated Back     alignment and domain information
>TIGR01138 cysM cysteine synthase B Back     alignment and domain information
>cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate Back     alignment and domain information
>PRK06110 hypothetical protein; Provisional Back     alignment and domain information
>PRK06608 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR02991 ectoine_eutB ectoine utilization protein EutB Back     alignment and domain information
>TIGR02079 THD1 threonine dehydratase Back     alignment and domain information
>PRK07048 serine/threonine dehydratase; Validated Back     alignment and domain information
>cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>PRK08639 threonine dehydratase; Validated Back     alignment and domain information
>cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>TIGR03844 cysteate_syn cysteate synthase Back     alignment and domain information
>TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form Back     alignment and domain information
>PRK08813 threonine dehydratase; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>PLN02356 phosphateglycerate kinase Back     alignment and domain information
>KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK06815 hypothetical protein; Provisional Back     alignment and domain information
>cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen Back     alignment and domain information
>PRK08246 threonine dehydratase; Provisional Back     alignment and domain information
>TIGR00260 thrC threonine synthase Back     alignment and domain information
>TIGR01137 cysta_beta cystathionine beta-synthase Back     alignment and domain information
>PRK06381 threonine synthase; Validated Back     alignment and domain information
>PRK08206 diaminopropionate ammonia-lyase; Provisional Back     alignment and domain information
>KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme Back     alignment and domain information
>TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family Back     alignment and domain information
>KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase Back     alignment and domain information
>PRK12391 tryptophan synthase subunit beta; Reviewed Back     alignment and domain information
>cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions Back     alignment and domain information
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13028 tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions Back     alignment and domain information
>PRK04346 tryptophan synthase subunit beta; Validated Back     alignment and domain information
>PLN02618 tryptophan synthase, beta chain Back     alignment and domain information
>TIGR00263 trpB tryptophan synthase, beta subunit Back     alignment and domain information
>PRK03910 D-cysteine desulfhydrase; Validated Back     alignment and domain information
>TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family Back     alignment and domain information
>PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase Back     alignment and domain information
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia Back     alignment and domain information
>PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional Back     alignment and domain information
>COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] Back     alignment and domain information
>COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09225 threonine synthase; Validated Back     alignment and domain information
>cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis Back     alignment and domain information
>COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] Back     alignment and domain information
>PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PF00764 Arginosuc_synth: Arginosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>PF09837 DUF2064: Uncharacterized protein conserved in bacteria (DUF2064); InterPro: IPR018641 This entry contains proteins that have no known function Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
4aec_A430 Crystal Structure Of The Arabidopsis Thaliana O-Ace 6e-98
1z7w_A322 Crystal Structure Of O-Acetylserine Sulfhydrylase F 1e-81
2isq_A320 Crystal Structure Of O-Acetylserine Sulfhydrylase F 2e-81
1z7y_A322 Crystal Structure Of The Arabidopsis Thaliana O-Ace 7e-81
3vbe_A344 Crystal Structure Of Beta-Cyanoalanine Synthase In 1e-70
3vc3_A344 Crystal Structure Of Beta-Cyanoalanine Synthase K95 5e-70
2q3d_A313 2.2 A Resolution Crystal Structure Of O-acetylserin 7e-57
2q3b_A313 1.8 A Resolution Crystal Structure Of O-Acetylserin 3e-56
1oas_A322 O-Acetylserine Sulfhydrylase From Salmonella Typhim 1e-54
1d6s_A322 Crystal Structure Of The K41a Mutant Of O-Acetylser 5e-54
3rr2_A314 Structure Of A Cysteine Synthase (O-Acetylserine Su 6e-54
4i1y_A314 The Structure Of Cysteine Synthase From Mycobacteri 2e-53
1ve1_A304 Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh 2e-48
2egu_A308 Crystal Structure Of O-Acetylserine Sulfhydrase Fro 2e-48
4air_A354 Leishmania Major Cysteine Synthase Length = 354 4e-47
3t4p_A334 Crystal Structure Of O-Acetyl Serine Sulfhydrylase 1e-46
1y7l_A316 O-Acetylserine Sulfhydrylase Complex Length = 316 1e-44
2bhs_A303 Crystal Structure Of Cysteine Synthase B Length = 3 1e-39
2bht_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase B 4e-39
2jc3_A303 Structure Of O-acetylserine Sulfhydrylase B From Sa 5e-39
2v03_A303 High Resolution Structure And Catalysis Of An O- Ac 6e-39
3fca_A291 Genetic Incorporation Of A Metal-Ion Chelating Amin 2e-36
1o58_A303 Crystal Structure Of O-Acetylserine Sulfhydrylase ( 2e-36
1m54_A363 Cystathionine-Beta Synthase: Reduced Vicinal Thiols 7e-35
1jbq_A435 Structure Of Human Cystathionine Beta-Synthase: A U 1e-34
3bm5_A338 Crystal Structure Of O-Acetyl-Serine Sulfhydrylase 4e-34
2pqm_A343 Crystal Structure Of Cysteine Synthase (Oass) From 5e-34
3pc2_A 527 Full Length Structure Of Cystathionine Beta-Synthas 6e-33
3dwg_A325 Crystal Structure Of A Sulfur Carrier Protein Compl 4e-31
3dwi_A323 Crystal Structure Of Mycobacterium Tuberculosis Cys 2e-30
3dki_A326 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobac 2e-30
1wkv_A389 Crystal Structure Of O-Phosphoserine Sulfhydrylase 2e-04
3vsc_A389 Crystal Structure Of The K127a Mutant Of O-Phosphos 7e-04
>pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 Back     alignment and structure 
Iteration: 1

 Score =  353 bits (906), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 169/218 (77%), Positives = 190/218 (87%), Gaps = 2/218 (0%)
Query: 55  SVVCKAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSV 114
           SVVC+AV  K +TG +GLNIA++V+QLIGKTPMVYLN+I KGCVANIAAKLEIMEPCCSV
Sbjct: 96  SVVCEAV--KRETGPDGLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSV 153
Query: 115 KDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLER 174
           KDRIG+SM+ DAEQKG I+PGKS+LVEPTSGNTGIGLAFIAAS+GY+LILTMPASMS+ER
Sbjct: 154 KDRIGYSMVTDAEQKGFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMER 213
Query: 175 RVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEI 234
           RVLLKAFGAELVLTD AKGM GAVQKAEEIL +TP+AYMLQQFDNPANPKIHYETTGPEI
Sbjct: 214 RVLLKAFGAELVLTDPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEI 273
Query: 235 WEDTRGKVDXXXXXXXXXXXXXXXXRYLKEKNPNIKVI 272
           W+DT+GKVD                R++KEKNP  +VI
Sbjct: 274 WDDTKGKVDIFVAGIGTGGTITGVGRFIKEKNPKTQVI 311
>pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 Back     alignment and structure
>pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 Back     alignment and structure
>pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 Back     alignment and structure
>pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 Back     alignment and structure
>pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 Back     alignment and structure
>pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 Back     alignment and structure
>pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 Back     alignment and structure
>pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 Back     alignment and structure
>pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 Back     alignment and structure
>pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 Back     alignment and structure
>pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 Back     alignment and structure
>pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 Back     alignment and structure
>pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 Back     alignment and structure
>pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 Back     alignment and structure
>pdb|1Y7L|A Chain A, O-Acetylserine Sulfhydrylase Complex Length = 316 Back     alignment and structure
>pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 Back     alignment and structure
>pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 Back     alignment and structure
>pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 Back     alignment and structure
>pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 Back     alignment and structure
>pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 Back     alignment and structure
>pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 Back     alignment and structure
>pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 Back     alignment and structure
>pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 Back     alignment and structure
>pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 Back     alignment and structure
>pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 Back     alignment and structure
>pdb|3PC2|A Chain A, Full Length Structure Of Cystathionine Beta-Synthase From Drosophila Length = 527 Back     alignment and structure
>pdb|3DWG|A Chain A, Crystal Structure Of A Sulfur Carrier Protein Complex Found In The Cysteine Biosynthetic Pathway Of Mycobacterium Tuberculosis Length = 325 Back     alignment and structure
>pdb|3DWI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cysm, The Cysteine Synthase B Length = 323 Back     alignment and structure
>pdb|3DKI|A Chain A, 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobacterium Tuberculosis An O-Phosphoserine Dependent Cysteine Synthase Length = 326 Back     alignment and structure
>pdb|1WKV|A Chain A, Crystal Structure Of O-Phosphoserine Sulfhydrylase Length = 389 Back     alignment and structure
>pdb|3VSC|A Chain A, Crystal Structure Of The K127a Mutant Of O-Phosphoserine Sulfhydrylase Complexed With External Schiff Base Of Pyridoxal 5'-Phosphate With O- Phospho-L-Serine Length = 389 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 1e-154
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 1e-152
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 1e-149
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 1e-148
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 1e-141
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 1e-141
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 1e-139
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 1e-138
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 1e-132
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 1e-132
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 1e-130
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 1e-119
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 1e-115
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 1e-115
1p5j_A 372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 8e-14
4d9i_A 398 Diaminopropionate ammonia-lyase; fold type II PLP- 2e-12
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 8e-12
2d1f_A 360 Threonine synthase; amino acid synthesis, pyridoxa 1e-10
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 1e-10
1e5x_A 486 Threonine synthase; threonine biosynthesis, PLP en 5e-10
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 6e-10
2zsj_A 352 Threonine synthase; PLP dependent enzyme, lyase; H 7e-10
3ss7_X 442 D-serine dehydratase; type II fold, ALFA,beta-elim 1e-09
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomera 3e-09
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 5e-09
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 7e-09
3aey_A 351 Threonine synthase; PLP, pyridoxal phosphate, lyas 8e-09
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 2e-08
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 Back     alignment and structure
 Score =  438 bits (1129), Expect = e-154
 Identities = 186/274 (67%), Positives = 220/274 (80%), Gaps = 4/274 (1%)

Query: 3   TSSSLVCSPLT----APLCISKKSSLATLKLGYISPITAARRLKQNLYKVSYKPCNSVVC 58
           +SS+L+ +PLT    +      + S     L + S    +  +K+     +         
Sbjct: 38  SSSALLLNPLTSSSSSSTLRRFRCSPEISSLSFSSASDFSLAMKRQSRSFADGSERDPSV 97

Query: 59  KAVSVKPQTGIEGLNIAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRI 118
              +VK +TG +GLNIA++V+QLIGKTPMVYLN+I KGCVANIAAKLEIMEPCCSVKDRI
Sbjct: 98  VCEAVKRETGPDGLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRI 157

Query: 119 GFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLL 178
           G+SM+ DAEQKG I+PGKS+LVEPTSGNTGIGLAFIAAS+GY+LILTMPASMS+ERRVLL
Sbjct: 158 GYSMVTDAEQKGFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLL 217

Query: 179 KAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDT 238
           KAFGAELVLTD AKGM GAVQKAEEIL +TP+AYMLQQFDNPANPKIHYETTGPEIW+DT
Sbjct: 218 KAFGAELVLTDPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIWDDT 277

Query: 239 RGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVI 272
           +GKVDIF+ GIGTGGTI+G GR++KEKNP  +VI
Sbjct: 278 KGKVDIFVAGIGTGGTITGVGRFIKEKNPKTQVI 311
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Length = 372 Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Length = 398 Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Length = 318 Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Length = 360 Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Length = 323 Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Length = 486 Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Length = 311 Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Length = 352 Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Length = 442 Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} PDB: 3l6r_A* 3hmk_A* 3l6c_A* Length = 346 Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Length = 366 Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Length = 351 Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Length = 514 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
3vc3_A344 Beta-cyanoalnine synthase; beta-cyanoalanine synth 100.0
4aec_A430 Cysteine synthase, mitochondrial; lyase, cysteine 100.0
1p5j_A372 L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo 100.0
3tbh_A334 O-acetyl serine sulfhydrylase; cysteine synthase, 100.0
3aey_A351 Threonine synthase; PLP, pyridoxal phosphate, lyas 100.0
4h27_A364 L-serine dehydratase/L-threonine deaminase; PLP de 100.0
1z7w_A322 Cysteine synthase; transferase; HET: PLP; 2.20A {A 100.0
2d1f_A360 Threonine synthase; amino acid synthesis, pyridoxa 100.0
2zsj_A352 Threonine synthase; PLP dependent enzyme, lyase; H 100.0
3ss7_X442 D-serine dehydratase; type II fold, ALFA,beta-elim 100.0
3dwg_A325 Cysteine synthase B; sulfur carrier protein comple 100.0
2q3b_A313 Cysteine synthase A; pyridoxal-5'-phosphate, sulph 100.0
1y7l_A316 O-acetylserine sulfhydrylase, O-acetylserine (thio 100.0
2v03_A303 Cysteine synthase B; pyridoxal phosphate, cysteine 100.0
1ve1_A304 O-acetylserine sulfhydrylase; PLP, transferase, ri 100.0
2pqm_A343 Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 100.0
2egu_A308 Cysteine synthase; O-acetylserine sulfhydrase, str 100.0
3l6b_A346 Serine racemase; pyridoxal phosphate, PLP, isomera 100.0
3pc3_A 527 CG1753, isoform A; CBS, synthase, PLP, heme, amino 100.0
2gn0_A342 Threonine dehydratase catabolic; TDCB, biodegradat 100.0
2rkb_A318 Serine dehydratase-like; PLP bound enzyme, enzyme 100.0
1ve5_A311 Threonine deaminase; riken structural genomics/Pro 100.0
1v71_A323 Serine racemase, hypothetical protein C320.14 in c 100.0
1o58_A303 O-acetylserine sulfhydrylase; TM0665, structural g 100.0
1jbq_A435 B, cystathionine beta-synthase, serine sulfhydrase 100.0
1tdj_A 514 Biosynthetic threonine deaminase; allostery, coope 100.0
3iau_A366 Threonine deaminase; pyridoxal phosphate, amino-ac 100.0
1e5x_A 486 Threonine synthase; threonine biosynthesis, PLP en 100.0
4d9b_A342 D-cysteine desulfhydrase; fold type II PLP-depende 100.0
4d9i_A398 Diaminopropionate ammonia-lyase; fold type II PLP- 100.0
1j0a_A325 1-aminocyclopropane-1-carboxylate deaminase; PLP d 100.0
1f2d_A341 1-aminocyclopropane-1-carboxylate deaminase; carbo 100.0
1tzj_A338 ACC deaminase, 1-aminocyclopropane-1-carboxylate d 100.0
1wkv_A389 Cysteine synthase; homodimer, open alpha/beta fold 100.0
1x1q_A418 Tryptophan synthase beta chain; structural genomic 100.0
1qop_B396 Tryptophan synthase beta chain; lyase, carbon-oxyg 100.0
1v8z_A388 Tryptophan synthase beta chain 1; beta+alpha, rike 100.0
2o2e_A422 Tryptophan synthase beta chain; amino-acid biosynt 100.0
1kl7_A 514 Threonine synthase; threonine synthesis, pyridoxal 100.0
1vb3_A 428 Threonine synthase; PLP-dependent enzyme, lyase; H 100.0
4f4f_A 468 Threonine synthase; structural genomics, niaid, na 100.0
3v7n_A 487 Threonine synthase; ssgcid, structural genomics, s 100.0
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.94
1vp8_A201 Hypothetical protein AF0103; putative pyruvate kin 93.16
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 91.68
3krt_A456 Crotonyl COA reductase; structural genomics, prote 91.63
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 91.39
3c85_A183 Putative glutathione-regulated potassium-efflux S 91.35
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 91.33
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 91.29
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 91.04
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 90.85
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 90.67
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 90.65
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 90.06
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 90.01
4eye_A342 Probable oxidoreductase; structural genomics, niai 89.49
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 89.24
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 89.05
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 88.94
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 88.88
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 88.43
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 87.98
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 87.95
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 87.64
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 87.56
3gms_A340 Putative NADPH:quinone reductase; structural genom 87.37
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 87.21
1t57_A206 Conserved protein MTH1675; structural genomics, FM 87.03
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 86.81
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 86.73
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 86.73
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 86.72
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 86.6
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 86.42
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 86.26
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 85.76
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 85.71
3fbg_A346 Putative arginate lyase; structural genomics, unkn 85.58
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 85.4
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 85.35
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 85.13
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 85.03
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 84.99
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 84.78
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 84.63
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 84.15
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 83.92
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 83.84
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 83.75
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 83.32
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 83.26
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 82.35
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 81.51
1id1_A153 Putative potassium channel protein; RCK domain, E. 81.49
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 81.21
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 81.18
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 81.1
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 81.04
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 80.87
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 80.76
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 80.62
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 80.61
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 80.6
>3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* Back     alignment and structure
Probab=100.00  E-value=3.2e-52  Score=395.90  Aligned_cols=214  Identities=61%  Similarity=0.986  Sum_probs=200.3

Q ss_pred             hhhhcccccCCCceeecccccccCCCeEEEeeCCCCCCCchhhHHHHHHHHHHHHcCCCCCCCceEEeeCcChHHHHHHH
Q 021570           74 IAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAF  153 (311)
Q Consensus        74 ~~~~i~~~~g~TPL~~~~~l~~~~g~~l~vK~E~~nPtGS~KdRga~~~v~~A~~~G~~~~g~~~vv~aSsGN~g~AlA~  153 (311)
                      +.+.|...+|+|||+++++|++.+|++||+|+|++|||||||||++.++|.+|.++|.+.+|.++||++|+||||+|+|+
T Consensus        25 i~~~i~~lIG~TPLv~~~~Ls~~~G~~IylK~E~lnptGSfK~RgA~~~i~~a~~~g~l~~g~~~Vv~aSsGN~g~alA~  104 (344)
T 3vc3_A           25 IKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIADRPAYAMITDAEEKNLITPGKTTLIEPTSGNMGISMAF  104 (344)
T ss_dssp             CBSSGGGGSCCCCEEECCSTTTTCCSEEEEEEGGGSTTSBTTHHHHHHHHHHHHHTTCCCTTTCEEEEECSSHHHHHHHH
T ss_pred             hhccHhhhcCCCceEECcccchhhCCEEEEEecCCCCCCCcHHHHHHHHHHHHHHcCCCCCCCCEEEEeCCcHHHHHHHH
Confidence            45678999999999999999999999999999999999999999999999999999999998789999999999999999


Q ss_pred             HHHHcCCeEEEEECCCCCHHHHHHHHhcCCEEEEECCCCChHHHHHHHHHHHHhCCCceeeCCCCCCcchHhhHHHHHHH
Q 021570          154 IAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPE  233 (311)
Q Consensus       154 ~aa~~Gi~~~vv~p~~~~~~k~~~l~~~GA~V~~v~~~~~~~~a~~~a~~~~~~~~~~~~~~~~~n~~~~~~G~~t~a~E  233 (311)
                      +|+++|++|+||||++++..|+.+++.|||+|+.++...++.++...+.++..+.++.+++++|+||.++.+||+|+++|
T Consensus       105 ~aa~~G~~~~IvmP~~~~~~k~~~~~~~GA~Vv~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~np~~~~a~~~t~g~E  184 (344)
T 3vc3_A          105 MAAMKGYKMVLTMPSYTSLERRVTMRAFGAELILTDPAKGMGGTVKKAYELLENTPNAHMLQQFSNPANTQVHFETTGPE  184 (344)
T ss_dssp             HHHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHSTTEECCCTTTCHHHHHHHHHTHHHH
T ss_pred             HHHHcCCcEEEEECCCChHHHHHHHHHcCCEEEEECCCCcchHHHHHHHHHHhhccCceeccccccchhHHHHHHHHHHH
Confidence            99999999999999999999999999999999999876556667777777777777899999999999888899999999


Q ss_pred             HHHHcCCCCCEEEEccChhhHHHHHHHHHHhcCCCCEEEEEeCCCCchhhhcCC
Q 021570          234 IWEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVP  287 (311)
Q Consensus       234 i~~Ql~~~pD~vv~pvG~Gg~~~Gi~~~lk~~~p~~~iigVe~~~s~~~~~~~~  287 (311)
                      |++|+++.||+||+|+|+||+++|++.+||+.+|+++||+|||++++.+..+.+
T Consensus       185 I~eq~~~~~d~vv~~vGgGG~~~Gi~~~~k~~~p~v~vigVep~~s~~l~~~~~  238 (344)
T 3vc3_A          185 IWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNVKIYGVEPSESNVLNGGKP  238 (344)
T ss_dssp             HHHHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEEGGGCGGGTCCC
T ss_pred             HHHHhCCCceEEEEecCCccchHHHhhhhHhhCCCceEEEEcCCCChhhcCCCC
Confidence            999998889999999999999999999999999999999999999988877654
>4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Back     alignment and structure
>3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* Back     alignment and structure
>3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Back     alignment and structure
>4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* Back     alignment and structure
>1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Back     alignment and structure
>2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Back     alignment and structure
>3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Back     alignment and structure
>3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* Back     alignment and structure
>2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Back     alignment and structure
>1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Back     alignment and structure
>2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Back     alignment and structure
>1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Back     alignment and structure
>2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Back     alignment and structure
>2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Back     alignment and structure
>3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* Back     alignment and structure
>3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Back     alignment and structure
>2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Back     alignment and structure
>1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Back     alignment and structure
>1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Back     alignment and structure
>1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Back     alignment and structure
>1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Back     alignment and structure
>1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Back     alignment and structure
>3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Back     alignment and structure
>1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Back     alignment and structure
>4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* Back     alignment and structure
>4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Back     alignment and structure
>1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* Back     alignment and structure
>1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* Back     alignment and structure
>1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* Back     alignment and structure
>1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Back     alignment and structure
>1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} Back     alignment and structure
>1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... Back     alignment and structure
>1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* Back     alignment and structure
>2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A Back     alignment and structure
>1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 Back     alignment and structure
>1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 Back     alignment and structure
>4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} Back     alignment and structure
>3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1vp8_A Hypothetical protein AF0103; putative pyruvate kinase, structural genomics, joint center structural genomics, JCSG; HET: MSE FMN; 1.30A {Archaeoglobus fulgidus} SCOP: c.49.1.2 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1t57_A Conserved protein MTH1675; structural genomics, FMN; HET: FMN; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.49.1.2 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 311
d1z7wa1320 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C 1e-53
d1ve1a1302 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C 5e-44
d1y7la1310 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C 8e-44
d1jbqa_355 c.79.1.1 (A:) Cystathionine beta-synthase {Human ( 3e-43
d1fcja_302 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 7e-41
d1o58a_293 c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei 9e-41
d2bhsa1292 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C 7e-35
d1tdja1331 c.79.1.1 (A:5-335) Threonine deaminase {Escherichi 1e-27
d1wkva1382 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C 4e-27
d1v71a1318 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S 2e-26
d1tyza_338 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 4e-19
d1e5xa_ 477 c.79.1.1 (A:) Threonine synthase {Mouse-ear cress 5e-19
d1ve5a1310 c.79.1.1 (A:2-311) Threonine deaminase {Thermus th 1e-17
d1f2da_341 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 2e-16
d1p5ja_319 c.79.1.1 (A:) L-serine dehydratase {Human (Homo sa 5e-16
d1j0aa_325 c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de 7e-16
d1v8za1386 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subun 2e-15
d1v7ca_ 351 c.79.1.1 (A:) Threonine synthase {Thermus thermoph 8e-13
d1qopb_390 c.79.1.1 (B:) Tryptophan synthase, beta-subunit {S 1e-11
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score =  176 bits (446), Expect = 1e-53
 Identities = 153/218 (70%), Positives = 180/218 (82%)

Query: 74  IAEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLIT 133
           IA+DVT+LIG TP+VYLN + +GCV  +AAKLE+MEPC SVKDRIGFSMI+DAE+KGLI 
Sbjct: 3   IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK 62

Query: 134 PGKSILVEPTSGNTGIGLAFIAASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKG 193
           PG+S+L+EPTSGNTG+GLAF AA+KGYKLI+TMPASMS ERR++L AFG ELVLTD AKG
Sbjct: 63  PGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKG 122

Query: 194 MKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEIWEDTRGKVDIFIGGIGTGG 253
           MKGA+ KAEEIL  TPN YMLQQF+NPANPKIHYETTGPEIW+ T GK+D F+ GIGTGG
Sbjct: 123 MKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGG 182

Query: 254 TISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPP 291
           TI+GAG+YLKE+N N+K+       S       P P  
Sbjct: 183 TITGAGKYLKEQNANVKLYGVEPVESAILSGGKPGPHK 220
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 Back     information, alignment and structure
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 477 Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 319 Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 386 Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Length = 351 Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Length = 390 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d1z7wa1320 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1jbqa_355 Cystathionine beta-synthase {Human (Homo sapiens) 100.0
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1ve1a1302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1o58a_293 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1p5ja_319 L-serine dehydratase {Human (Homo sapiens) [TaxId: 100.0
d1e5xa_ 477 Threonine synthase {Mouse-ear cress (Arabidopsis t 100.0
d1v71a1318 Hypothetical protein C320.14 (SPCC320.14, SPCC330. 100.0
d1tdja1331 Threonine deaminase {Escherichia coli [TaxId: 562] 100.0
d1ve5a1310 Threonine deaminase {Thermus thermophilus [TaxId: 100.0
d1y7la1310 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1wkva1382 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1fcja_302 O-acetylserine sulfhydrylase (Cysteine synthase) { 100.0
d1v7ca_351 Threonine synthase {Thermus thermophilus [TaxId: 2 100.0
d1v8za1386 Tryptophan synthase, beta-subunit {Archaeon Pyroco 100.0
d1qopb_390 Tryptophan synthase, beta-subunit {Salmonella typh 100.0
d1j0aa_325 1-aminocyclopropane-1-carboxylate deaminase {Archa 100.0
d1tyza_338 1-aminocyclopropane-1-carboxylate deaminase {Pseud 99.97
d1f2da_341 1-aminocyclopropane-1-carboxylate deaminase {Yeast 99.96
d1vb3a1 428 Threonine synthase {Escherichia coli [TaxId: 562]} 99.81
d1kl7a_ 511 Threonine synthase {Baker's yeast (Saccharomyces c 98.78
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.74
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.46
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 95.34
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 95.11
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.08
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 94.67
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 94.65
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.61
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 94.5
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 94.34
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 94.11
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.94
d1vp8a_190 Hypothetical protein AF0103 {Archaeoglobus fulgidu 93.94
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 93.77
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 93.71
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 93.44
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.71
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 92.5
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 92.43
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 91.93
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 91.65
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 89.83
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 89.36
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 88.56
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 88.32
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 88.3
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 87.38
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 87.37
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 87.26
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.73
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 86.5
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 85.95
d1t57a_186 Hypothetical protein MTH1675 {Methanobacterium the 85.8
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 85.68
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 85.1
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 84.96
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 84.3
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 84.26
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 84.01
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 83.71
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 83.41
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 83.28
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 83.13
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 82.61
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 82.25
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 82.09
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 81.61
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 81.35
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 81.12
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 80.06
>d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes
superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes
family: Tryptophan synthase beta subunit-like PLP-dependent enzymes
domain: O-acetylserine sulfhydrylase (Cysteine synthase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=100.00  E-value=1.8e-49  Score=371.15  Aligned_cols=230  Identities=66%  Similarity=1.043  Sum_probs=202.1

Q ss_pred             hhhcccccCCCceeecccccccCCCeEEEeeCCCCCCCchhhHHHHHHHHHHHHcCCCCCCCceEEeeCcChHHHHHHHH
Q 021570           75 AEDVTQLIGKTPMVYLNTIVKGCVANIAAKLEIMEPCCSVKDRIGFSMIADAEQKGLITPGKSILVEPTSGNTGIGLAFI  154 (311)
Q Consensus        75 ~~~i~~~~g~TPL~~~~~l~~~~g~~l~vK~E~~nPtGS~KdRga~~~v~~A~~~G~~~~g~~~vv~aSsGN~g~AlA~~  154 (311)
                      .+.|...+|+|||+++++|.+.+|.+||+|+|++|||||||||++.++|.+|+++|.++++..+||++|+||||.|+|++
T Consensus         4 ~~~i~~~iG~TPLv~~~~l~~~~g~~i~~K~E~~nptGSfKdRgA~~~i~~a~~~g~~~~~~~~vv~aSsGN~g~a~A~~   83 (320)
T d1z7wa1           4 AKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAFT   83 (320)
T ss_dssp             CSSGGGGSSCCCEEECCGGGTTCSSEEEEEEGGGSTTSBTHHHHHHHHHHHHHHTTSCCTTTCEEEEECSSHHHHHHHHH
T ss_pred             hhhhhhhcCCCCeEECCCcccccCCEEEEEeCCCCCccCcHHHHHHHHHHHHHHcCCCCCCCceEEeeCCchHHHHHHHH
Confidence            45688889999999999999999999999999999999999999999999999999988877889999999999999999


Q ss_pred             HHHcCCeEEEEECCCCCHHHHHHHHhcCCEEEEECCCCChHHHHHHHHHHHHhCCCceeeCCCCCCcchHhhHHHHHHHH
Q 021570          155 AASKGYKLILTMPASMSLERRVLLKAFGAELVLTDSAKGMKGAVQKAEEILNSTPNAYMLQQFDNPANPKIHYETTGPEI  234 (311)
Q Consensus       155 aa~~Gi~~~vv~p~~~~~~k~~~l~~~GA~V~~v~~~~~~~~a~~~a~~~~~~~~~~~~~~~~~n~~~~~~G~~t~a~Ei  234 (311)
                      |+.+|++|+||||+++++.|+++++.|||+|+.++...+..+...++.+...+.++++|+++++|+.++.+||+|+|+||
T Consensus        84 a~~~g~~~~iv~p~~~~~~k~~~i~~~Ga~vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~g~~t~~~EI  163 (320)
T d1z7wa1          84 AAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEI  163 (320)
T ss_dssp             HHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHCTTEEECCTTTCTHHHHHHHHTHHHHH
T ss_pred             HHhhccceEEeehhhhhhhhhhhhhccCcceEEeeccccccccchhHHHHHHhCCCceecccccccchHHHhhhhHHHHH
Confidence            99999999999999999999999999999999998754344455555555666678999999999998878999999999


Q ss_pred             HHHcCCCCCEEEEccChhhHHHHHHHHHHhcCCCCEEEEEeCCCCchhhhcCCCCCccccccccCCcccccc
Q 021570          235 WEDTRGKVDIFIGGIGTGGTISGAGRYLKEKNPNIKVIIFVLFISKPYLACVPYPPPSLCLTCQSESVLKLV  306 (311)
Q Consensus       235 ~~Ql~~~pD~vv~pvG~Gg~~~Gi~~~lk~~~p~~~iigVe~~~s~~~~~~~~~~~~tiadgl~~~~~~~~~  306 (311)
                      .+|+.+.||+||+|+|+||+++|++++|++.+|++++|+|||++++.+..+.+.  +....||..+.+...+
T Consensus       164 ~~q~~~~~D~vv~~vGgGg~~~Gi~~~~k~~~~~~~~igve~~~s~~~~~~~~~--~~~~~gig~~~~~~~~  233 (320)
T d1z7wa1         164 WKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVEPVESAILSGGKPG--PHKIQGIGAGFIPSVL  233 (320)
T ss_dssp             HHHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEEEGGGCGGGTCCCC--CCSCTTSCCSSCCTTC
T ss_pred             HHhccCCCCEEEeCCCCCcccchhhhhhhhhhcceeeecccccCCccccCCCCC--CceeeeccCCcCcchh
Confidence            999977899999999999999999999999999999999999999877654332  2334566655554443
>d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Back     information, alignment and structure
>d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Back     information, alignment and structure
>d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vp8a_ c.49.1.2 (A:) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1t57a_ c.49.1.2 (A:) Hypothetical protein MTH1675 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure