Citrus Sinensis ID: 021739

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWDTPGAVARL
ccEEEccccccccEEEcHHHHHcccccHHHHHHHHHHHHccccEEEcccccccHHHHHcccccccEEEEcccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHHccccccccHHHHHHHcccccEEEEccccHHHHHHHHHHcccEEEEccccccccccccHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHccccEEEccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHccccccEEcccccccccccc
cccEEEccEccccEEEccHHHcccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHccccEEEEEEEEccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHccccccccccHHHHHHcccccccccccccHHHHHHHHccccccHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHcccEEEccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHccccHEEcccccccccccc
mtttvlgfnismpimiaptafqkmahpegecATARAASAAGTIMTLSswatssveevsstgpgirFFQLYVTKHRNVDAQLVKRAERAGFKAIALtvdtprlgrreadiknrfvlpphltlknyeglyigkmdktddsgLASYVANQIdrslnwkdvkwlqtitslpilvkgvltaEDASLAIQYGAAGiivsnhgarqldyvpATVMALEEVVQAAKgrvpvfldggvrrgTDVFKALALGasgvfvgrpvpfslavdgeAGVRKVLQMLRDEFELTMALSGCRSLKEITRNhivthwdtpgavarl
MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGPGIRFFQLYVTKHRNVDAQLVKRaeragfkaialtvdtprlgrreadiknrfvlpphltlknYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKeitrnhivthwdtpgavarl
MTTTVLGFNISMPIMIAPTAFQKMAHPEGECataraasaaGTIMTLSSWATSSVEEVSSTGPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWDTPGAVARL
****VLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWDT*******
MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLY************ASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWDTP***A**
MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSW**********TGPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWDTPGAVARL
*TTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLYIGKMD*TDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHW*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWDTPGAVARL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query308 2.2.26 [Sep-21-2011]
P05414369 Peroxisomal (S)-2-hydroxy N/A no 1.0 0.834 0.858 1e-150
O49506368 Peroxisomal (S)-2-hydroxy yes no 0.980 0.820 0.841 1e-150
Q9LRR9367 Peroxisomal (S)-2-hydroxy no no 1.0 0.839 0.850 1e-149
Q9LRS0367 Peroxisomal (S)-2-hydroxy no no 1.0 0.839 0.834 1e-146
Q7FAS1367 Peroxisomal (S)-2-hydroxy yes no 0.974 0.817 0.84 1e-142
B8AUI3367 Peroxisomal (S)-2-hydroxy N/A no 0.974 0.817 0.84 1e-142
Q6YT73369 Peroxisomal (S)-2-hydroxy no no 0.990 0.826 0.826 1e-141
B8B7C5369 Peroxisomal (S)-2-hydroxy N/A no 0.990 0.826 0.826 1e-141
Q10CE4369 Peroxisomal (S)-2-hydroxy no no 0.974 0.813 0.823 1e-138
B8AKX6369 Peroxisomal (S)-2-hydroxy N/A no 0.974 0.813 0.823 1e-138
>sp|P05414|GOX_SPIOL Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1 Back     alignment and function desciption
 Score =  530 bits (1364), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 266/310 (85%), Positives = 289/310 (93%), Gaps = 2/310 (0%)

Query: 1   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST 60
           MTTT+LGF ISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct: 60  MTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST 119

Query: 61  GPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLT 120
           GPGIRFFQLYV K RNV AQLV+RAERAGFKAIALTVDTPRLGRREADIKNRFVLPP LT
Sbjct: 120 GPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLT 179

Query: 121 LKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDAS 180
           LKN+EG+ +GKMDK +DSGL+SYVA QIDRSL+WKDV WLQTITSLPILVKGV+TAEDA 
Sbjct: 180 LKNFEGIDLGKMDKANDSGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDAR 239

Query: 181 LAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALA 240
           LA+Q+GAAGIIVSNHGARQLDYVPAT+MALEEVV+AA+GR+PVFLDGGVRRGTDVFKALA
Sbjct: 240 LAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALA 299

Query: 241 LGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWD 300
           LGA+GVF+GRPV FSLA +GEAGV+KVLQM+RDEFELTMALSGCRSLKEI+R+HI   WD
Sbjct: 300 LGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHIAADWD 359

Query: 301 TPG--AVARL 308
            P   AVARL
Sbjct: 360 GPSSRAVARL 369

Spinacia oleracea (taxid: 3562)
EC: 1EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 5
>sp|O49506|GLO5_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Arabidopsis thaliana GN=GLO5 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRR9|GLO1_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Arabidopsis thaliana GN=GLO1 PE=1 SV=1 Back     alignment and function description
>sp|Q9LRS0|GLO2_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Arabidopsis thaliana GN=GLO2 PE=1 SV=1 Back     alignment and function description
>sp|Q7FAS1|GLO3_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. japonica GN=GLO3 PE=2 SV=1 Back     alignment and function description
>sp|B8AUI3|GLO3_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. indica GN=GLO3 PE=3 SV=1 Back     alignment and function description
>sp|Q6YT73|GLO5_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. japonica GN=GLO5 PE=2 SV=1 Back     alignment and function description
>sp|B8B7C5|GLO5_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. indica GN=GLO5 PE=3 SV=1 Back     alignment and function description
>sp|Q10CE4|GLO1_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. japonica GN=GLO1 PE=1 SV=1 Back     alignment and function description
>sp|B8AKX6|GLO1_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. indica GN=GLO1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
147789493371 hypothetical protein VITISV_005886 [Viti 0.980 0.814 0.880 1e-152
366984550367 glycolate oxidase [Gossypium hirsutum] 1.0 0.839 0.892 1e-152
189418957369 glycolate oxidase [Mikania micrantha] 0.987 0.823 0.848 1e-149
255557255369 (S)-2-hydroxy-acid oxidase, putative [Ri 0.993 0.829 0.872 1e-149
304368145371 glycolate oxidase [Nicotiana benthamiana 0.987 0.819 0.871 1e-148
323650489370 glycolate oxidase [Mangifera indica] 0.980 0.816 0.884 1e-148
224076908368 predicted protein [Populus trichocarpa] 1.0 0.836 0.860 1e-148
225443896372 PREDICTED: peroxisomal (S)-2-hydroxy-aci 0.980 0.811 0.877 1e-148
164600806 525 hemoglobin/glycolate oxidase fusion prot 1.0 0.586 0.858 1e-148
999542369 Chain A, Involvement Of Tyr24 And Trp108 1.0 0.834 0.858 1e-148
>gi|147789493|emb|CAN67413.1| hypothetical protein VITISV_005886 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 266/302 (88%), Positives = 283/302 (93%)

Query: 1   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST 60
           MTTTVLGF ISMPIMIAPTA QKMAHPEGE ATARAASA GTIMTLSSWATSSVEEV+ST
Sbjct: 60  MTTTVLGFKISMPIMIAPTAMQKMAHPEGEYATARAASATGTIMTLSSWATSSVEEVAST 119

Query: 61  GPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLT 120
           GPGIRFFQLYV K R+V AQLV+RAERAGFKAIALTVDTPRLGRREADIKNRF LPP LT
Sbjct: 120 GPGIRFFQLYVYKDRHVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFTLPPFLT 179

Query: 121 LKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDAS 180
           LKN+EGL +GKMDK DDSGLASYVA QIDR+L+WKDVKWLQTIT+LPILVKGVLTAED  
Sbjct: 180 LKNFEGLDLGKMDKADDSGLASYVAGQIDRTLSWKDVKWLQTITNLPILVKGVLTAEDTR 239

Query: 181 LAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALA 240
           LAIQ GAAGIIVSNHGARQLDYVPAT+MALEEVV+AA+GRVPVFLDGGVRRGTDVFKALA
Sbjct: 240 LAIQAGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRVPVFLDGGVRRGTDVFKALA 299

Query: 241 LGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWD 300
           LGASG+F+GRPV FSLA +GEAGVRKVLQMLR+EFELTMALSGCRSLKEITR+HIVT W+
Sbjct: 300 LGASGIFIGRPVVFSLAAEGEAGVRKVLQMLREEFELTMALSGCRSLKEITRDHIVTEWE 359

Query: 301 TP 302
            P
Sbjct: 360 VP 361

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|366984550|gb|AEX09184.1| glycolate oxidase [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|189418957|gb|ACD93720.1| glycolate oxidase [Mikania micrantha] Back     alignment and taxonomy information
>gi|255557255|ref|XP_002519658.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] gi|223541075|gb|EEF42631.1| (S)-2-hydroxy-acid oxidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|304368145|gb|ADM26718.1| glycolate oxidase [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|323650489|gb|ADX97325.1| glycolate oxidase [Mangifera indica] Back     alignment and taxonomy information
>gi|224076908|ref|XP_002305044.1| predicted protein [Populus trichocarpa] gi|222848008|gb|EEE85555.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225443896|ref|XP_002278104.1| PREDICTED: peroxisomal (S)-2-hydroxy-acid oxidase GLO1 [Vitis vinifera] gi|297740741|emb|CBI30923.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|164600806|gb|ABY61829.1| hemoglobin/glycolate oxidase fusion protein [synthetic construct] Back     alignment and taxonomy information
>gi|999542|pdb|1GYL|A Chain A, Involvement Of Tyr24 And Trp108 In Substrate Binding And Substrate Specificity Of Glycolate Oxidase gi|999543|pdb|1GYL|B Chain B, Involvement Of Tyr24 And Trp108 In Substrate Binding And Substrate Specificity Of Glycolate Oxidase Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query308
TAIR|locus:2091642367 GOX1 "glycolate oxidase 1" [Ar 1.0 0.839 0.821 1.6e-132
TAIR|locus:2124499368 GOX3 "glycolate oxidase 3" [Ar 0.980 0.820 0.814 2.5e-129
UNIPROTKB|B8B7C5369 GLO5 "Peroxisomal (S)-2-hydrox 1.0 0.834 0.792 4.8e-126
UNIPROTKB|Q6YT73369 GLO5 "Peroxisomal (S)-2-hydrox 1.0 0.834 0.792 4.8e-126
UNIPROTKB|B8AUI3367 GLO3 "Peroxisomal (S)-2-hydrox 0.974 0.817 0.81 7.8e-126
UNIPROTKB|Q7FAS1367 GLO3 "Peroxisomal (S)-2-hydrox 0.974 0.817 0.81 7.8e-126
UNIPROTKB|B8AKX6369 GLO1 "Peroxisomal (S)-2-hydrox 0.974 0.813 0.793 2.7e-123
UNIPROTKB|Q10CE4369 GLO1 "Peroxisomal (S)-2-hydrox 0.974 0.813 0.793 2.7e-123
UNIPROTKB|Q01KC2368 GLO2 "Peroxisomal (S)-2-hydrox 1.0 0.836 0.675 4.2e-111
UNIPROTKB|Q7XPR4368 GLO2 "Peroxisomal (S)-2-hydrox 1.0 0.836 0.675 4.2e-111
TAIR|locus:2091642 GOX1 "glycolate oxidase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1299 (462.3 bits), Expect = 1.6e-132, P = 1.6e-132
 Identities = 253/308 (82%), Positives = 276/308 (89%)

Query:     1 MTTTVLGFNISMPIMIAPTAFQKMAHPEGECXXXXXXXXXGTIMTLSSWATSSVEEVSST 60
             MTTTVLGF ISMPIM+APTA QKMAHP+GE          GTIMTLSSWATSSVEEV+ST
Sbjct:    60 MTTTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST 119

Query:    61 GPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLT 120
             GPGIRFFQLYV K+RNV  QLV+RAERAGFKAIALTVDTPRLGRRE+DIKNRF LPP+LT
Sbjct:   120 GPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLT 179

Query:   121 LKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDAS 180
             LKN+EGL +GKMD+ +DSGLASYVA QIDR+L+WKDV+WLQTIT LPILVKGVLT EDA 
Sbjct:   180 LKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDAR 239

Query:   181 LAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALA 240
             +AIQ GAAGIIVSNHGARQLDYVPAT+ ALEEVV+A +GR+PVFLDGGVRRGTDVFKALA
Sbjct:   240 IAIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALA 299

Query:   241 LGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWD 300
             LGASG+F+GRPV FSLA +GEAGVRKVLQMLRDEFELTMALSGCRSLKEI+RNHI T WD
Sbjct:   300 LGASGIFIGRPVVFSLAAEGEAGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWD 359

Query:   301 TPGAVARL 308
             TP   ARL
Sbjct:   360 TPRPSARL 367
GO:0003824 "catalytic activity" evidence=IEA
GO:0008891 "glycolate oxidase activity" evidence=ISS;IMP
GO:0010181 "FMN binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0022626 "cytosolic ribosome" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0005777 "peroxisome" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0009506 "plasmodesma" evidence=IDA
GO:0042742 "defense response to bacterium" evidence=IMP
GO:0050665 "hydrogen peroxide biosynthetic process" evidence=IMP
TAIR|locus:2124499 GOX3 "glycolate oxidase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|B8B7C5 GLO5 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO5" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|Q6YT73 GLO5 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO5" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|B8AUI3 GLO3 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO3" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|Q7FAS1 GLO3 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|B8AKX6 GLO1 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO1" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|Q10CE4 GLO1 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO1" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q01KC2 GLO2 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO2" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XPR4 GLO2 "Peroxisomal (S)-2-hydroxy-acid oxidase GLO2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B8B8K5GLO4_ORYSI1, ., 1, ., 3, ., 1, 50.57800.96420.8114N/Ano
Q54E41HAOX_DICDI1, ., 1, ., 3, ., 1, 50.52490.93830.7448yesno
Q9LRR9GLO1_ARATH1, ., 1, ., 3, ., 1, 50.85061.00.8392nono
Q01KC2GLO2_ORYSI1, ., 1, ., 3, ., 1, 50.70121.00.8369N/Ano
B8AUI3GLO3_ORYSI1, ., 1, ., 3, ., 1, 50.840.97400.8174N/Ano
B8B7C5GLO5_ORYSI1, ., 1, ., 3, ., 1, 50.82620.99020.8265N/Ano
Q6YT73GLO5_ORYSJ1, ., 1, ., 3, ., 1, 50.82620.99020.8265nono
Q7XPR4GLO2_ORYSJ1, ., 1, ., 3, ., 1, 50.70121.00.8369nono
O49506GLO5_ARATH1, ., 1, ., 3, ., 1, 50.84100.98050.8206yesno
Q10CE4GLO1_ORYSJ1, ., 1, ., 3, ., 1, 50.82330.97400.8130nono
Q9LRS0GLO2_ARATH1, ., 1, ., 3, ., 1, 50.83441.00.8392nono
B8AKX6GLO1_ORYSI1, ., 1, ., 3, ., 1, 50.82330.97400.8130N/Ano
Q9UJM8HAOX1_HUMAN1, ., 1, ., 3, ., 1, 50.54160.99020.8243yesno
Q7FAS1GLO3_ORYSJ1, ., 1, ., 3, ., 1, 50.840.97400.8174yesno
P05414GOX_SPIOL1, ., 1, ., 3, ., 1, 50.85801.00.8346N/Ano
Q3ZBW2HAOX2_BOVIN1, ., 1, ., 3, ., 1, 50.48310.93500.8158yesno
Q9WU19HAOX1_MOUSE1, ., 1, ., 3, ., 1, 50.54800.99020.8243yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.30.983
3rd Layer1.1.3.150.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
PLN02979366 PLN02979, PLN02979, glycolate oxidase 0.0
PLN02493367 PLN02493, PLN02493, probable peroxisomal (S)-2-hyd 0.0
PLN02535364 PLN02535, PLN02535, glycolate oxidase 1e-156
cd02809299 cd02809, alpha_hydroxyacid_oxid_FMN, Family of hom 1e-132
pfam01070302 pfam01070, FMN_dh, FMN-dependent dehydrogenase 1e-131
cd02922344 cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-b 1e-109
COG1304360 COG1304, idi, Isopentenyl diphosphate isomerase (B 1e-101
cd03332383 cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) 5e-95
cd04737351 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN 5e-95
cd04736361 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-li 1e-77
TIGR02708367 TIGR02708, L_lactate_ox, L-lactate oxidase 6e-69
PRK11197381 PRK11197, lldD, L-lactate dehydrogenase; Provision 2e-66
TIGR03966385 TIGR03966, actino_HemFlav, heme/flavin dehydrogena 7e-64
TIGR02151333 TIGR02151, IPP_isom_2, isopentenyl-diphosphate del 2e-16
PRK05437352 PRK05437, PRK05437, isopentenyl pyrophosphate isom 4e-16
cd02811326 cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimeth 3e-14
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel protein 3e-09
cd02808392 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-b 8e-09
cd00381325 cd00381, IMPDH, IMPDH: The catalytic domain of the 1e-06
TIGR01302450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate 1e-06
PRK05567486 PRK05567, PRK05567, inosine 5'-monophosphate dehyd 5e-06
PTZ00314495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehyd 1e-05
cd04730236 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD 3e-05
COG2070336 COG2070, COG2070, Dioxygenases related to 2-nitrop 4e-05
PRK08649368 PRK08649, PRK08649, inosine 5-monophosphate dehydr 5e-05
TIGR01304369 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family 6e-05
pfam01645367 pfam01645, Glu_synthase, Conserved region in gluta 6e-05
pfam00478467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductas 1e-04
COG0069485 COG0069, GltB, Glutamate synthase domain 2 [Amino 2e-04
COG0167310 COG0167, PyrD, Dihydroorotate dehydrogenase [Nucle 0.001
>gnl|CDD|166620 PLN02979, PLN02979, glycolate oxidase Back     alignment and domain information 
 Score =  536 bits (1381), Expect = 0.0
 Identities = 262/308 (85%), Positives = 285/308 (92%)

Query: 1   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST 60
           MTTTVLGF ISMPIM+APTA QKMAHP+GE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct: 59  MTTTVLGFKISMPIMVAPTAMQKMAHPDGEYATARAASAAGTIMTLSSWATSSVEEVAST 118

Query: 61  GPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLT 120
           GPGIRFFQLYV K+RNV  QLV+RAERAGFKAIALTVDTPRLGRRE+DIKNRF LPP+LT
Sbjct: 119 GPGIRFFQLYVYKNRNVVEQLVRRAERAGFKAIALTVDTPRLGRRESDIKNRFTLPPNLT 178

Query: 121 LKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDAS 180
           LKN+EGL +GKMD+ +DSGLASYVA QIDR+L+WKDV+WLQTIT LPILVKGVLT EDA 
Sbjct: 179 LKNFEGLDLGKMDEANDSGLASYVAGQIDRTLSWKDVQWLQTITKLPILVKGVLTGEDAR 238

Query: 181 LAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALA 240
           +AIQ GAAGIIVSNHGARQLDYVPAT+ ALEEVV+A +GR+PVFLDGGVRRGTDVFKALA
Sbjct: 239 IAIQAGAAGIIVSNHGARQLDYVPATISALEEVVKATQGRIPVFLDGGVRRGTDVFKALA 298

Query: 241 LGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWD 300
           LGASG+F+GRPV FSLA +GEAGVRKVLQMLRDEFELTMALSGCRSLKEI+RNHI T WD
Sbjct: 299 LGASGIFIGRPVVFSLAAEGEAGVRKVLQMLRDEFELTMALSGCRSLKEISRNHITTEWD 358

Query: 301 TPGAVARL 308
           TP   ARL
Sbjct: 359 TPRPSARL 366

Length = 366
>gnl|CDD|166134 PLN02493, PLN02493, probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>gnl|CDD|215294 PLN02535, PLN02535, glycolate oxidase Back     alignment and domain information
>gnl|CDD|239203 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>gnl|CDD|216281 pfam01070, FMN_dh, FMN-dependent dehydrogenase Back     alignment and domain information
>gnl|CDD|239238 cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>gnl|CDD|224223 COG1304, idi, Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|239448 cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>gnl|CDD|240088 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>gnl|CDD|240087 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>gnl|CDD|131755 TIGR02708, L_lactate_ox, L-lactate oxidase Back     alignment and domain information
>gnl|CDD|183033 PRK11197, lldD, L-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188481 TIGR03966, actino_HemFlav, heme/flavin dehydrogenase, mycofactocin system Back     alignment and domain information
>gnl|CDD|233750 TIGR02151, IPP_isom_2, isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>gnl|CDD|235465 PRK05437, PRK05437, isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|239205 cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>gnl|CDD|240073 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>gnl|CDD|239202 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>gnl|CDD|238223 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|240355 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|240081 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>gnl|CDD|224981 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|236322 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233351 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|110632 pfam01645, Glu_synthase, Conserved region in glutamate synthase Back     alignment and domain information
>gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|223147 COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223245 COG0167, PyrD, Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 308
KOG0538363 consensus Glycolate oxidase [Energy production and 100.0
PLN02979366 glycolate oxidase 100.0
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 100.0
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 100.0
PF01070356 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR 100.0
PRK11197381 lldD L-lactate dehydrogenase; Provisional 100.0
PLN02535364 glycolate oxidase 100.0
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 100.0
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 100.0
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 100.0
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 100.0
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MT 100.0
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 100.0
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 100.0
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 100.0
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 100.0
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 99.96
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 99.96
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 99.95
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 99.95
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 99.94
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 99.94
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 99.94
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 99.94
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 99.93
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 99.93
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 99.93
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 99.93
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 99.92
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 99.92
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 99.91
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 99.9
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 99.9
PLN02495385 oxidoreductase, acting on the CH-CH group of donor 99.9
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 99.9
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 99.9
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 99.9
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 99.89
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 99.89
PRK02506310 dihydroorotate dehydrogenase 1A; Reviewed 99.88
PF01645368 Glu_synthase: Conserved region in glutamate syntha 99.87
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 99.87
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 99.86
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 99.86
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 99.86
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 99.86
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 99.86
PLN02826409 dihydroorotate dehydrogenase 99.86
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 99.85
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 99.85
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 99.84
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 99.81
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 99.79
COG0069485 GltB Glutamate synthase domain 2 [Amino acid trans 99.78
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 99.78
PF01180295 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP 99.77
TIGR01036335 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 99.76
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 99.73
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 99.73
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 99.72
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 99.72
PLN02274505 inosine-5'-monophosphate dehydrogenase 99.71
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 99.7
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 99.68
KOG2333614 consensus Uncharacterized conserved protein [Gener 99.66
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 99.62
KOG1436398 consensus Dihydroorotate dehydrogenase [Nucleotide 99.61
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 99.59
PRK13523337 NADPH dehydrogenase NamA; Provisional 99.57
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 99.56
KOG2550503 consensus IMP dehydrogenase/GMP reductase [Nucleot 99.51
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 99.51
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 99.48
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 99.44
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 99.4
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 99.4
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 99.4
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 99.38
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 99.38
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 99.38
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like dom 99.36
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase 99.35
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 99.34
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 99.31
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 99.27
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) 99.26
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 99.26
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 99.26
TIGR02814 444 pfaD_fam PfaD family protein. The protein PfaD is 99.26
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 99.22
PLN02591250 tryptophan synthase 99.22
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzym 99.21
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 99.19
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 99.19
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 99.14
KOG2334 477 consensus tRNA-dihydrouridine synthase [Translatio 99.12
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 99.11
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 99.11
PRK10605362 N-ethylmaleimide reductase; Provisional 99.09
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 99.08
PRK13125244 trpA tryptophan synthase subunit alpha; Provisiona 99.07
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 99.06
PF00724341 Oxidored_FMN: NADH:flavin oxidoreductase / NADH ox 99.04
KOG1799471 consensus Dihydropyrimidine dehydrogenase [Nucleot 99.04
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 99.03
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 99.01
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 98.99
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 98.99
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 98.98
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 98.92
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 98.89
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 98.86
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.79
PLN02411391 12-oxophytodienoate reductase 98.79
PRK14024241 phosphoribosyl isomerase A; Provisional 98.74
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.73
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 98.73
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.73
PRK00507221 deoxyribose-phosphate aldolase; Provisional 98.69
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 98.69
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 98.68
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 98.67
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.67
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.66
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 98.62
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.59
PRK07695201 transcriptional regulator TenI; Provisional 98.56
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 98.56
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 98.56
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 98.54
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 98.54
PRK00208250 thiG thiazole synthase; Reviewed 98.52
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 98.52
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 98.5
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino a 98.49
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 98.49
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.46
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 98.46
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide tr 98.44
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 98.42
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/ 98.39
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 98.37
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.36
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 98.36
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.34
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 98.33
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 98.31
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 98.3
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 98.29
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 98.26
PLN02460338 indole-3-glycerol-phosphate synthase 98.25
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 98.24
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 98.23
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 98.23
CHL00162267 thiG thiamin biosynthesis protein G; Validated 98.22
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 98.21
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 98.21
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 98.21
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 98.18
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 98.18
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 98.14
PRK05848273 nicotinate-nucleotide pyrophosphorylase; Provision 98.12
PTZ00170228 D-ribulose-5-phosphate 3-epimerase; Provisional 98.08
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 98.05
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 98.02
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 97.99
cd00429211 RPE Ribulose-5-phosphate 3-epimerase (RPE). This e 97.99
KOG0399 2142 consensus Glutamate synthase [Amino acid transport 97.98
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 97.98
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 97.98
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.97
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 97.97
PRK04302223 triosephosphate isomerase; Provisional 97.95
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.95
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 97.92
PRK14024241 phosphoribosyl isomerase A; Provisional 97.9
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 97.89
PRK07226267 fructose-bisphosphate aldolase; Provisional 97.86
PLN02334229 ribulose-phosphate 3-epimerase 97.86
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 97.84
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 97.83
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 97.81
PTZ00314 495 inosine-5'-monophosphate dehydrogenase; Provisiona 97.8
PRK05581220 ribulose-phosphate 3-epimerase; Validated 97.79
PRK07428288 nicotinate-nucleotide pyrophosphorylase; Provision 97.78
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 97.77
TIGR00078265 nadC nicotinate-nucleotide pyrophosphorylase. Syno 97.77
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provision 97.76
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related p 97.76
TIGR00875213 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ 97.75
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 97.75
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 97.74
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 97.74
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 97.74
KOG4175268 consensus Tryptophan synthase alpha chain [Amino a 97.73
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme meta 97.71
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 97.7
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QA 97.7
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 97.7
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 97.69
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 97.69
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transfe 97.68
PRK08072277 nicotinate-nucleotide pyrophosphorylase; Provision 97.68
PRK06806281 fructose-bisphosphate aldolase; Provisional 97.64
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 97.6
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.59
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferas 97.59
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 97.58
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 97.57
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 97.56
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.56
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 97.55
PRK05283257 deoxyribose-phosphate aldolase; Provisional 97.54
PRK09722229 allulose-6-phosphate 3-epimerase; Provisional 97.53
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.52
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 97.51
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 97.51
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.5
PRK12653220 fructose-6-phosphate aldolase; Reviewed 97.5
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 97.5
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 97.5
PRK08005210 epimerase; Validated 97.48
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 97.48
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 97.48
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 97.47
PRK08385278 nicotinate-nucleotide pyrophosphorylase; Provision 97.46
PRK01362214 putative translaldolase; Provisional 97.45
KOG1606296 consensus Stationary phase-induced protein, SOR/SN 97.44
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.43
PRK12655220 fructose-6-phosphate aldolase; Reviewed 97.41
PF00977229 His_biosynth: Histidine biosynthesis protein; Inte 97.4
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provision 97.39
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.38
PRK04169232 geranylgeranylglyceryl phosphate synthase-like pro 97.37
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole 97.35
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.35
PRK12656222 fructose-6-phosphate aldolase; Reviewed 97.34
PF01729169 QRPTase_C: Quinolinate phosphoribosyl transferase, 97.33
PLN02274 505 inosine-5'-monophosphate dehydrogenase 97.3
PRK13586232 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.28
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 97.25
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provision 97.23
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provision 97.23
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 97.22
PRK06801286 hypothetical protein; Provisional 97.22
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 97.22
cd02812219 PcrB_like PcrB_like proteins. One member of this f 97.22
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 97.21
PF01884230 PcrB: PcrB family; InterPro: IPR008205 This entry 97.17
PLN02898502 HMP-P kinase/thiamin-monophosphate pyrophosphoryla 97.16
PF01081196 Aldolase: KDPG and KHG aldolase; InterPro: IPR0008 97.16
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 97.14
PRK12290437 thiE thiamine-phosphate pyrophosphorylase; Reviewe 97.13
PF00834201 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase fam 97.11
PLN02446262 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methy 97.1
PRK12376236 putative translaldolase; Provisional 97.09
PRK09016296 quinolinate phosphoribosyltransferase; Validated 97.09
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.05
PRK06978294 nicotinate-nucleotide pyrophosphorylase; Provision 97.04
TIGR02134236 transald_staph transaldolase. This small family of 97.04
PRK07807 479 inosine 5-monophosphate dehydrogenase; Validated 97.03
cd03319316 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase cat 97.02
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 97.02
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 97.01
PRK07896289 nicotinate-nucleotide pyrophosphorylase; Provision 97.01
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 96.99
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 96.99
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 96.96
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 96.96
PLN02617538 imidazole glycerol phosphate synthase hisHF 96.95
PRK06096284 molybdenum transport protein ModD; Provisional 96.94
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; 96.93
PRK08227264 autoinducer 2 aldolase; Validated 96.92
TIGR01334277 modD putative molybdenum utilization protein ModD. 96.9
PRK08999312 hypothetical protein; Provisional 96.89
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 96.87
KOG4201289 consensus Anthranilate synthase component II [Amin 96.81
PRK07114222 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.79
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 96.74
PRK05567 486 inosine 5'-monophosphate dehydrogenase; Reviewed 96.72
PLN02617 538 imidazole glycerol phosphate synthase hisHF 96.68
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 96.67
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 96.66
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 96.63
PRK09517 755 multifunctional thiamine-phosphate pyrophosphoryla 96.55
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 96.53
PRK07315293 fructose-bisphosphate aldolase; Provisional 96.5
PLN02716308 nicotinate-nucleotide diphosphorylase (carboxylati 96.49
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 96.49
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 96.46
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coen 96.45
PRK08091228 ribulose-phosphate 3-epimerase; Validated 96.44
PLN02591250 tryptophan synthase 96.4
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 96.34
PF00478 352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 96.31
PF03932201 CutC: CutC family; InterPro: IPR005627 Copper tran 96.3
PRK14057254 epimerase; Provisional 96.25
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 96.24
PRK06843 404 inosine 5-monophosphate dehydrogenase; Validated 96.23
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 96.22
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 96.2
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 96.17
PRK08185283 hypothetical protein; Provisional 96.15
PRK11572248 copper homeostasis protein CutC; Provisional 96.14
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 96.12
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 96.11
PLN02417 280 dihydrodipicolinate synthase 96.09
COG0135208 TrpF Phosphoribosylanthranilate isomerase [Amino a 96.03
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 96.0
PRK03170292 dihydrodipicolinate synthase; Provisional 96.0
TIGR02313 294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 95.98
CHL00162267 thiG thiamin biosynthesis protein G; Validated 95.96
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 95.94
PRK00208250 thiG thiazole synthase; Reviewed 95.92
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 95.91
PRK06852304 aldolase; Validated 95.91
cd00951 289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 95.89
PRK03620 303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 95.87
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 95.86
PRK11750 1485 gltB glutamate synthase subunit alpha; Provisional 95.86
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 95.85
cd00952 309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 95.81
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 95.8
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.8
cd00408 281 DHDPS-like Dihydrodipicolinate synthase family. A 95.76
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 95.65
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 95.65
TIGR00734221 hisAF_rel hisA/hisF family protein. This alignment 95.64
TIGR03249 296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 95.6
TIGR01305 343 GMP_reduct_1 guanosine monophosphate reductase, eu 95.59
KOG2335358 consensus tRNA-dihydrouridine synthase [Translatio 95.57
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 95.54
COG0329 299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 95.49
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase 95.47
TIGR00683 290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 95.47
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 95.46
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 95.45
PRK09250348 fructose-bisphosphate aldolase; Provisional 95.42
PRK07107 502 inosine 5-monophosphate dehydrogenase; Validated 95.36
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 95.34
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 95.3
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 95.28
cd00954 288 NAL N-Acetylneuraminic acid aldolase, also called 95.25
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 95.23
TIGR00674 285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 95.21
PF00701 289 DHDPS: Dihydrodipicolinate synthetase family; Inte 95.15
TIGR01303 475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 95.13
PRK05096 346 guanosine 5'-monophosphate oxidoreductase; Provisi 95.11
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 95.09
TIGR03569 329 NeuB_NnaB N-acetylneuraminate synthase. This famil 95.08
cd00950 284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 95.07
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 95.04
PRK04147 293 N-acetylneuraminate lyase; Provisional 95.03
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 95.01
cd00516281 PRTase_typeII Phosphoribosyltransferase (PRTase) t 94.95
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 94.95
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 94.89
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 94.85
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fo 94.85
cd00439252 Transaldolase Transaldolase. Enzymes found in the 94.84
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 94.84
KOG2550 503 consensus IMP dehydrogenase/GMP reductase [Nucleot 94.84
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 94.81
PF04898287 Glu_syn_central: Glutamate synthase central domain 94.74
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 94.69
PRK07709285 fructose-bisphosphate aldolase; Provisional 94.67
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 94.64
PRK03170 292 dihydrodipicolinate synthase; Provisional 94.64
COG3142241 CutC Uncharacterized protein involved in copper re 94.63
PLN02979366 glycolate oxidase 94.55
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 94.52
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 94.5
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 94.46
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 94.37
PLN02535364 glycolate oxidase 94.35
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 94.24
PRK13523337 NADPH dehydrogenase NamA; Provisional 94.14
cd01571302 NAPRTase_B Nicotinate phosphoribosyltransferase (N 94.0
PRK08883220 ribulose-phosphate 3-epimerase; Provisional 93.99
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 93.93
PLN02493367 probable peroxisomal (S)-2-hydroxy-acid oxidase 93.92
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 93.82
cd03174265 DRE_TIM_metallolyase DRE-TIM metallolyase superfam 93.76
TIGR03569329 NeuB_NnaB N-acetylneuraminate synthase. This famil 93.75
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 93.72
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 93.67
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 93.64
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 93.59
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 93.43
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 93.4
PRK07455187 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 93.37
COG2089347 SpsE Sialic acid synthase [Cell envelope biogenesi 93.37
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 93.37
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 93.32
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 93.26
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 93.26
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 93.25
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 93.24
PRK05835307 fructose-bisphosphate aldolase; Provisional 93.2
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 93.18
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 93.18
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 93.17
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 93.12
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate 93.12
PRK08610286 fructose-bisphosphate aldolase; Reviewed 93.04
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy 92.99
PRK07695201 transcriptional regulator TenI; Provisional 92.94
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 92.92
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 92.91
TIGR03586 327 PseI pseudaminic acid synthase. 92.9
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminato 92.87
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 92.7
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 92.7
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 92.67
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 92.58
PLN02334229 ribulose-phosphate 3-epimerase 92.55
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 92.54
KOG3111224 consensus D-ribulose-5-phosphate 3-epimerase [Carb 92.49
PRK07709285 fructose-bisphosphate aldolase; Provisional 92.45
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 92.39
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 92.28
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 92.21
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 92.18
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 92.16
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminato 91.99
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 91.98
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 91.95
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 91.93
PRK11320 292 prpB 2-methylisocitrate lyase; Provisional 91.84
PF03102241 NeuB: NeuB family; InterPro: IPR013132 NeuB is the 91.82
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 91.79
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 91.73
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 91.69
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 91.67
PRK00366 360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 91.66
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 91.66
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 91.64
KOG0134400 consensus NADH:flavin oxidoreductase/12-oxophytodi 91.62
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 91.51
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 91.45
PRK08005210 epimerase; Validated 91.43
PRK08610286 fructose-bisphosphate aldolase; Reviewed 91.39
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 91.39
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 91.28
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 91.27
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 91.24
PRK09427 454 bifunctional indole-3-glycerol phosphate synthase/ 91.1
PRK06806281 fructose-bisphosphate aldolase; Provisional 91.06
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 91.04
PRK06801286 hypothetical protein; Provisional 91.03
PF00218254 IGPS: Indole-3-glycerol phosphate synthase; InterP 91.0
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 90.99
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 90.98
PLN02826409 dihydroorotate dehydrogenase 90.91
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 90.9
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 90.79
PRK10605362 N-ethylmaleimide reductase; Provisional 90.76
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 90.75
TIGR02317 285 prpB methylisocitrate lyase. Members of this famil 90.71
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide tran 90.71
PF01680208 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p 90.71
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 90.67
PRK13307391 bifunctional formaldehyde-activating enzyme/3-hexu 90.63
PTZ00411333 transaldolase-like protein; Provisional 90.56
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 90.46
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 90.32
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 90.29
cd00953 279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 90.17
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 90.17
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 90.13
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 90.09
PF04309175 G3P_antiterm: Glycerol-3-phosphate responsive anti 90.07
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 90.05
cd02812219 PcrB_like PcrB_like proteins. One member of this f 90.03
TIGR01521347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 89.9
cd00957313 Transaldolase_TalAB Transaldolases including both 89.89
TIGR01768223 GGGP-family geranylgeranylglyceryl phosphate synth 89.87
TIGR03151 307 enACPred_II putative enoyl-(acyl-carrier-protein) 89.85
TIGR00874317 talAB transaldolase. This family includes the majo 89.79
PRK13398266 3-deoxy-7-phosphoheptulonate synthase; Provisional 89.62
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 89.61
COG2876286 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate ( 89.58
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 89.54
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 89.49
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 89.48
PRK08745223 ribulose-phosphate 3-epimerase; Provisional 89.39
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 89.35
COG0176239 MipB Transaldolase [Carbohydrate transport and met 89.29
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 89.19
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 89.1
TIGR02319 294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 89.09
PRK12346316 transaldolase A; Provisional 89.09
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 89.07
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 88.93
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 88.91
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 88.74
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 88.59
PRK04147293 N-acetylneuraminate lyase; Provisional 88.32
PRK08999312 hypothetical protein; Provisional 88.3
COG2513 289 PrpB PEP phosphonomutase and related enzymes [Carb 88.3
>KOG0538 consensus Glycolate oxidase [Energy production and conversion] Back     alignment and domain information 
Probab=100.00  E-value=3.6e-65  Score=450.29  Aligned_cols=304  Identities=71%  Similarity=1.103  Sum_probs=289.2

Q ss_pred             CceeecCcccCCceEeccccCcccCCCHHHHHHHHHHHHcCCceeecCCCCCCHHHHhccCC-CCceEEeeecCCchHHH
Q 021739            1 MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP-GIRFFQLYVTKHRNVDA   79 (308)
Q Consensus         1 ~~t~~~g~~~~~Pi~iapm~~~~~~~~~~~~~~a~~a~~~g~~~~~s~~~~~~~e~i~~~~~-~~~~~Ql~~~~d~~~~~   79 (308)
                      +||++||.+++.||+|||.+.+.+.||+||...+++|.+.|+++++|+++++++||+...+| +..|||||.++|++.++
T Consensus        58 ~sTtvlG~~i~~Pi~iapTa~qkma~pdGE~~taraa~~~~~~~i~Ss~at~S~EdI~~aap~~~rwfQLYvykdr~It~  137 (363)
T KOG0538|consen   58 TSTTVLGQKISAPIMIAPTAMQKMAHPDGELATARAAQAAGTIMILSSWATCSVEDIASAAPPGIRWFQLYVYKDRDITE  137 (363)
T ss_pred             ccceeccccccceeEEcchHHHhccCCcccHHHHHHHHhcCCcEEEechhcCCHHHHHhhCCCCcEEEEEEecCchHHHH
Confidence            68999999999999999999999999999999999999999999999999999999998876 58999999999999999


Q ss_pred             HHHHHHHHcCCcEEEEecCCCCCCcchHHhhhccCCCCccccccccccccccCCCCCCchhhhHhhhhcccccCHHHHHH
Q 021739           80 QLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKW  159 (308)
Q Consensus        80 ~~~~~~~~~g~~~i~i~~~~p~~~~r~~~~~~~~~~p~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~i~~  159 (308)
                      +++++++++||++|++|+|+|+.|+|+.|++|.|..|+.++.++++.......++...++...+++...||..+|+.|+|
T Consensus       138 ~Lv~raEk~GfkAlvlTvDtP~lG~R~~D~~n~f~lp~~l~lknfe~~~~~~v~~~~~sg~~~~~~~~id~Sl~W~Di~w  217 (363)
T KOG0538|consen  138 QLVKRAEKAGFKALVLTVDTPRLGRRESDIKNKFSLPKNLTLKNFEGLKLTEVEEAGDSGLAAYVSSQIDPSLSWKDIKW  217 (363)
T ss_pred             HHHHHHHHcCceEEEEEeccccccCchhhhhhcccCCcccccccccccccccCCcccchhhhhhhhcCCCCCCChhhhHH
Confidence            99999999999999999999999999999999999999888888887766666665567778899999999999999999


Q ss_pred             HHHhcCCCEEEEecCCHHHHHHHHHcCCcEEEEecccccCCCCCcchHHHHHHHHHHccCCCeEEEecCCCCHHHHHHHH
Q 021739          160 LQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKAL  239 (308)
Q Consensus       160 ir~~~~~Pv~vK~~~~~e~a~~~~~~G~d~i~v~~~gg~~~~~~~~~~~~l~~i~~~~~~~ipvia~GGI~~~~d~~k~l  239 (308)
                      +|+.+++||++|++++.|+|+.+.++|+++|+||||||+|+|..+.+.+.|.++.+++.+++||+.+||+|++.|++|||
T Consensus       218 Lr~~T~LPIvvKGilt~eDA~~Ave~G~~GIIVSNHGgRQlD~vpAtI~~L~Evv~aV~~ri~V~lDGGVR~G~DVlKAL  297 (363)
T KOG0538|consen  218 LRSITKLPIVVKGVLTGEDARKAVEAGVAGIIVSNHGGRQLDYVPATIEALPEVVKAVEGRIPVFLDGGVRRGTDVLKAL  297 (363)
T ss_pred             HHhcCcCCeEEEeecccHHHHHHHHhCCceEEEeCCCccccCcccchHHHHHHHHHHhcCceEEEEecCcccchHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCCCEEEEchHHHHhcccCCHHHHHHHHHHHHHHHHHHHHHcCCCCHhhhcccceeccCCCCcc
Q 021739          240 ALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWDTPGA  304 (308)
Q Consensus       240 ~~GAd~V~ig~~~l~~~~~~G~~~v~~~i~~l~~~l~~~m~~~G~~~i~~l~~~~~~~~~~~~~~  304 (308)
                      ++||.+|.+|||++|+++++|+.||+++++.+++|++..|...|+.|+.|+.++.+....+++++
T Consensus       298 ALGAk~VfiGRP~v~gLA~~Ge~GV~~vl~iL~~efe~tmaLsGc~sv~ei~~~~v~~~~s~l~~  362 (363)
T KOG0538|consen  298 ALGAKGVFIGRPIVWGLAAKGEAGVKKVLDILRDEFELTMALSGCRSVKEITRNHVLTEESRLKK  362 (363)
T ss_pred             hcccceEEecCchheeeccccchhHHHHHHHHHHHHHHHHHHhCCCchhhhCccceeechhhhcc
Confidence            99999999999999999999999999999999999999999999999999999987777666553

>PLN02979 glycolate oxidase Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>KOG1436 consensus Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>TIGR02814 pfaD_fam PfaD family protein Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion] Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>KOG2334 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>PRK13125 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PF00724 Oxidored_FMN: NADH:flavin oxidoreductase / NADH oxidase family; InterPro: IPR001155 The TIM-barrel fold is a closed barrel structure composed of an eight-fold repeat of beta-alpha units, where the eight parallel beta strands on the inside are covered by the eight alpha helices on the outside [] Back     alignment and domain information
>KOG1799 consensus Dihydropyrimidine dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PLN02411 12-oxophytodienoate reductase Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PLN02460 indole-3-glycerol-phosphate synthase Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd00429 RPE Ribulose-5-phosphate 3-epimerase (RPE) Back     alignment and domain information
>KOG0399 consensus Glutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK04302 triosephosphate isomerase; Provisional Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK05581 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase Back     alignment and domain information
>PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4175 consensus Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>COG0214 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolism] Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport Back     alignment and domain information
>PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd01568 QPRTase_NadC Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK05283 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>PRK09722 allulose-6-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK12653 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK01362 putative translaldolase; Provisional Back     alignment and domain information
>KOG1606 consensus Stationary phase-induced protein, SOR/SNZ family [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PRK12655 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes Back     alignment and domain information
>PRK06106 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed Back     alignment and domain information
>cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK12656 fructose-6-phosphate aldolase; Reviewed Back     alignment and domain information
>PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK13586 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06543 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK03512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) Back     alignment and domain information
>PLN02898 HMP-P kinase/thiamin-monophosphate pyrophosphorylase Back     alignment and domain information
>PF01081 Aldolase: KDPG and KHG aldolase; InterPro: IPR000887 4-Hydroxy-2-oxoglutarate aldolase (4 Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>PRK12290 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PF00834 Ribul_P_3_epim: Ribulose-phosphate 3 epimerase family; InterPro: IPR000056 Ribulose-phosphate 3-epimerase (5 Back     alignment and domain information
>PLN02446 (5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase Back     alignment and domain information
>PRK12376 putative translaldolase; Provisional Back     alignment and domain information
>PRK09016 quinolinate phosphoribosyltransferase; Validated Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR02134 transald_staph transaldolase Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd03319 L-Ala-DL-Glu_epimerase L-Ala-D/L-Glu epimerase catalyzes the epimerization of L-Ala-D/L-Glu and other dipeptides Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK06096 molybdenum transport protein ModD; Provisional Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>TIGR01334 modD putative molybdenum utilization protein ModD Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>KOG4201 consensus Anthranilate synthase component II [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07114 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK09517 multifunctional thiamine-phosphate pyrophosphorylase/synthase/phosphomethylpyrimidine kinase; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PLN02716 nicotinate-nucleotide diphosphorylase (carboxylating) Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>COG0157 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme metabolism] Back     alignment and domain information
>PRK08091 ribulose-phosphate 3-epimerase; Validated Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PF03932 CutC: CutC family; InterPro: IPR005627 Copper transport in Escherichia coli is mediated by the products of at least six genes, cutA, cutB, cutC, cutD, cutE, and cutF Back     alignment and domain information
>PRK14057 epimerase; Provisional Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>COG0135 TrpF Phosphoribosylanthranilate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>PRK06852 aldolase; Validated Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>TIGR00734 hisAF_rel hisA/hisF family protein Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>KOG2335 consensus tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1830 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd00516 PRTase_typeII Phosphoribosyltransferase (PRTase) type II; This family contains two enzymes that play an important role in NAD production by either allowing quinolinic acid (QA) , quinolinate phosphoribosyl transferase (QAPRTase), or nicotinic acid (NA), nicotinate phosphoribosyltransferase (NAPRTase), to be used in the synthesis of NAD Back     alignment and domain information
>PRK13957 indole-3-glycerol-phosphate synthase; Provisional Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd00439 Transaldolase Transaldolase Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>PF04898 Glu_syn_central: Glutamate synthase central domain; InterPro: IPR006982 Glutamate synthase (GltS)1 is a key enzyme in the early stages of the assimilation of ammonia in bacteria, yeasts, and plants Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>COG3142 CutC Uncharacterized protein involved in copper resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B Back     alignment and domain information
>PRK08883 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>cd03174 DRE_TIM_metallolyase DRE-TIM metallolyase superfamily Back     alignment and domain information
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>COG0036 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PLN02334 ribulose-phosphate 3-epimerase Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>KOG3111 consensus D-ribulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PF03102 NeuB: NeuB family; InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac) Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>KOG0134 consensus NADH:flavin oxidoreductase/12-oxophytodienoate reductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK08005 epimerase; Validated Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK09427 bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase; Provisional Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PF00218 IGPS: Indole-3-glycerol phosphate synthase; InterPro: IPR013798 Indole-3-glycerol phosphate synthase (4 Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PLN02826 dihydroorotate dehydrogenase Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PF01680 SOR_SNZ: SOR/SNZ family; InterPro: IPR001852 Snz1p is a highly conserved protein involved in growth arrest in Saccharomyces cerevisiae (Baker's yeast) [] Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>PTZ00411 transaldolase-like protein; Provisional Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PF04309 G3P_antiterm: Glycerol-3-phosphate responsive antiterminator; InterPro: IPR006699 Glycerol enters bacterial cells via facilitated diffusion, an energy-independent transport process catalysed by the glycerol transport facilitator GlpF, an integral membrane protein of the aquaporin family Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>cd00957 Transaldolase_TalAB Transaldolases including both TalA and TalB Back     alignment and domain information
>TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>TIGR00874 talAB transaldolase Back     alignment and domain information
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG2876 AroA 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>PRK08745 ribulose-phosphate 3-epimerase; Provisional Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>COG0176 MipB Transaldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>PRK12346 transaldolase A; Provisional Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
1gox_A370 Refined Structure Of Spinach Glycolate Oxidase At 2 1e-150
1gyl_A369 Involvement Of Tyr24 And Trp108 In Substrate Bindin 1e-150
1al7_A359 Three-Dimensional Structures Of Glycolate Oxidase W 1e-148
2nzl_A392 Crystal Structure Of Human Hydroxyacid Oxidase 1 Le 5e-91
2w0u_A370 Crystal Structure Of Human Glycolate Oxidase In Com 7e-91
2rdu_A387 Crystal Structure Of Human Glycolate Oxidase (Go) I 7e-91
1tb3_A352 Crystal Structure Analysis Of Recombinant Rat Kidne 8e-68
3sgz_A352 High Resolution Crystal Structure Of Rat Long Chain 4e-65
2cdh_0226 Architecture Of The Thermomyces Lanuginosus Fungal 1e-63
2a7n_A380 Crystal Structure Of The G81a Mutant Of The Active 2e-57
1huv_A380 Crystal Structure Of A Soluble Mutant Of The Membra 7e-57
1kbj_A412 Crystallographic Study Of The Recombinant Flavin-Bi 9e-50
1qcw_A410 Flavocytochrome B2, Arg289lys Mutant Length = 410 1e-49
1ltd_A506 The 2.6 Angstroms Refined Structure Of The Escheric 2e-49
1fcb_A511 Molecular Structure Of Flavocytochrome B2 At 2.4 An 2e-49
1ldc_A511 X-Ray Structure Of Two Complexes Of The Y143f Flavo 2e-49
1sze_A511 L230a Mutant Flavocytochrome B2 With Benzoylformate 3e-49
1szf_A511 A198g:l230a Mutant Flavocytochrome B2 With Pyruvate 8e-49
2oz0_A511 Mechanistic And Structural Studies Of H373q Flavocy 1e-48
2j6x_A374 The Crystal Structure Of Lactate Oxidase Length = 3 4e-43
2du2_A374 Crystal Structure Analysis Of The L-Lactate Oxidase 6e-43
2nli_A368 Crystal Structure Of The Complex Between L-Lactate 6e-43
1p0k_A349 Ipp:dmapp Isomerase Type Ii Apo Structure Length = 1e-05
3ffs_A400 The Crystal Structure Of Cryptosporidium Parvum Ino 8e-05
3khj_A361 C. Parvum Inosine Monophosphate Dehydrogenase Bound 1e-04
1vrd_A494 Crystal Structure Of Inosine-5'-Monophosphate Dehyd 4e-04
>pdb|1GOX|A Chain A, Refined Structure Of Spinach Glycolate Oxidase At 2 Angstroms Resolution Length = 370 Back     alignment and structure 
Iteration: 1

 Score =  527 bits (1358), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 257/310 (82%), Positives = 280/310 (90%), Gaps = 2/310 (0%)
Query: 1   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECXXXXXXXXXGTIMTLSSWATSSVEEVSST 60
           MTTT+LGF ISMPIMIAPTA QKMAHPEGE          GTIMTLSSWATSSVEEV+ST
Sbjct: 61  MTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST 120
Query: 61  GPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLT 120
           GPGIRFFQLYV K RNV AQLV+RAERAGFKAIALTVDTPRLGRREADIKNRFVLPP LT
Sbjct: 121 GPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLT 180
Query: 121 LKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDAS 180
           LKN+EG+ +GKMDK +DSGL+SYVA QIDRSL+WKDV WLQTITSLPILVKGV+TAEDA 
Sbjct: 181 LKNFEGIDLGKMDKANDSGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDAR 240
Query: 181 LAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALA 240
           LA+Q+GAAGIIVSNHGARQLDYVPAT+MALEEVV+AA+GR+PVFLDGGVRRGTDVFKALA
Sbjct: 241 LAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALA 300
Query: 241 LGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWD 300
           LGA+GVF+GRPV FSLA +GEAGV+KVLQM+RDEFELTMALSGCRSLKEI+R+HI   WD
Sbjct: 301 LGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHIAADWD 360
Query: 301 TPG--AVARL 308
            P   AVARL
Sbjct: 361 GPSSRAVARL 370
>pdb|1GYL|A Chain A, Involvement Of Tyr24 And Trp108 In Substrate Binding And Substrate Specificity Of Glycolate Oxidase Length = 369 Back     alignment and structure
>pdb|1AL7|A Chain A, Three-Dimensional Structures Of Glycolate Oxidase With Bound Active- Site Inhibitors Length = 359 Back     alignment and structure
>pdb|2NZL|A Chain A, Crystal Structure Of Human Hydroxyacid Oxidase 1 Length = 392 Back     alignment and structure
>pdb|2W0U|A Chain A, Crystal Structure Of Human Glycolate Oxidase In Complex With The Inhibitor 5-[(4-Chlorophenyl)sulfanyl]- 1,2,3-Thiadiazole-4-Carboxylate. Length = 370 Back     alignment and structure
>pdb|2RDU|A Chain A, Crystal Structure Of Human Glycolate Oxidase In Complex With Glyoxylate Length = 387 Back     alignment and structure
>pdb|1TB3|A Chain A, Crystal Structure Analysis Of Recombinant Rat Kidney Long- Chain Hydroxy Acid Oxidase Length = 352 Back     alignment and structure
>pdb|3SGZ|A Chain A, High Resolution Crystal Structure Of Rat Long Chain Hydroxy Acid Oxidase In Complex With The Inhibitor 4-Carboxy-5-[(4-Chiorophenyl) Sulfanyl]-1, 2, 3-Thiadiazole. Length = 352 Back     alignment and structure
>pdb|2CDH|0 Chain 0, Architecture Of The Thermomyces Lanuginosus Fungal Fatty Acid Synthase At 5 Angstrom Resolution. Length = 226 Back     alignment and structure
>pdb|2A7N|A Chain A, Crystal Structure Of The G81a Mutant Of The Active Chimera Of (S)- Mandelate Dehydrogenase Length = 380 Back     alignment and structure
>pdb|1HUV|A Chain A, Crystal Structure Of A Soluble Mutant Of The Membrane-Associated (S)- Mandelate Dehydrogenase From Pseudomonas Putida At 2.15a Resolution Length = 380 Back     alignment and structure
>pdb|1KBJ|A Chain A, Crystallographic Study Of The Recombinant Flavin-Binding Domain Of Baker's Yeast Flavocytochrome B2: Comparison With The Intact Wild- Type Enzyme Length = 412 Back     alignment and structure
>pdb|1QCW|A Chain A, Flavocytochrome B2, Arg289lys Mutant Length = 410 Back     alignment and structure
>pdb|1LTD|A Chain A, The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex Length = 506 Back     alignment and structure
>pdb|1FCB|A Chain A, Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution Length = 511 Back     alignment and structure
>pdb|1LDC|A Chain A, X-Ray Structure Of Two Complexes Of The Y143f Flavocytochrome B2 Mutant Crystallized In The Presence Of Lactate Or Phenyl-Lactate Length = 511 Back     alignment and structure
>pdb|1SZE|A Chain A, L230a Mutant Flavocytochrome B2 With Benzoylformate Length = 511 Back     alignment and structure
>pdb|1SZF|A Chain A, A198g:l230a Mutant Flavocytochrome B2 With Pyruvate Bound Length = 511 Back     alignment and structure
>pdb|2OZ0|A Chain A, Mechanistic And Structural Studies Of H373q Flavocytochrome B2: Effects Of Mutating The Active Site Base Length = 511 Back     alignment and structure
>pdb|2J6X|A Chain A, The Crystal Structure Of Lactate Oxidase Length = 374 Back     alignment and structure
>pdb|2DU2|A Chain A, Crystal Structure Analysis Of The L-Lactate Oxidase Length = 374 Back     alignment and structure
>pdb|2NLI|A Chain A, Crystal Structure Of The Complex Between L-Lactate Oxidase And A Substrate Analogue At 1.59 Angstrom Resolution Length = 368 Back     alignment and structure
>pdb|1P0K|A Chain A, Ipp:dmapp Isomerase Type Ii Apo Structure Length = 349 Back     alignment and structure
>pdb|3FFS|A Chain A, The Crystal Structure Of Cryptosporidium Parvum Inosine-5'- Monophosphate Dehydrogenase Length = 400 Back     alignment and structure
>pdb|3KHJ|A Chain A, C. Parvum Inosine Monophosphate Dehydrogenase Bound By Inhibitor C64 Length = 361 Back     alignment and structure
>pdb|1VRD|A Chain A, Crystal Structure Of Inosine-5'-Monophosphate Dehydrogenase (Tm1347) From Thermotoga Maritima At 2.18 A Resolution Length = 494 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query308
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 0.0
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 1e-174
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 1e-168
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 1e-167
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 1e-166
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 1e-155
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 1e-82
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 2e-74
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 3e-58
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 2e-44
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 1e-06
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 2e-06
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 5e-06
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 6e-06
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 7e-06
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 2e-05
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 3e-05
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 4e-05
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 6e-05
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 7e-05
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 8e-05
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 9e-05
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 1e-04
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 1e-04
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 2e-04
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 4e-04
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 6e-04
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Length = 370 Back     alignment and structure
 Score =  516 bits (1331), Expect = 0.0
 Identities = 265/310 (85%), Positives = 289/310 (93%), Gaps = 2/310 (0%)

Query: 1   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST 60
           MTTT+LGF ISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct: 61  MTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST 120

Query: 61  GPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLT 120
           GPGIRFFQLYV K RNV AQLV+RAERAGFKAIALTVDTPRLGRREADIKNRFVLPP LT
Sbjct: 121 GPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLT 180

Query: 121 LKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDAS 180
           LKN+EG+ +GKMDK +DSGL+SYVA QIDRSL+WKDV WLQTITSLPILVKGV+TAEDA 
Sbjct: 181 LKNFEGIDLGKMDKANDSGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDAR 240

Query: 181 LAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALA 240
           LA+Q+GAAGIIVSNHGARQLDYVPAT+MALEEVV+AA+GR+PVFLDGGVRRGTDVFKALA
Sbjct: 241 LAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALA 300

Query: 241 LGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWD 300
           LGA+GVF+GRPV FSLA +GEAGV+KVLQM+RDEFELTMALSGCRSLKEI+R+HI   WD
Sbjct: 301 LGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHIAADWD 360

Query: 301 TPGA--VARL 308
            P +  VARL
Sbjct: 361 GPSSRAVARL 370
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Length = 392 Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Length = 352 Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Length = 368 Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Length = 380 Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Length = 365 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Length = 349 Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Length = 368 Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Length = 332 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Length = 393 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Length = 400 Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Length = 234 Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Length = 361 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} Length = 232 Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Length = 404 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4fez_A Length = 366 Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Length = 223 Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Length = 369 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Length = 328 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 100.0
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 100.0
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 100.0
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 100.0
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 100.0
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 100.0
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 100.0
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 100.0
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 100.0
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 100.0
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 99.97
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 99.97
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 99.96
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 99.95
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 99.94
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 99.94
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 99.94
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 99.94
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 99.92
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 99.92
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 99.92
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 99.91
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 99.91
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 99.9
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 99.9
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 99.89
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 99.89
1ea0_A 1479 Glutamate synthase [NADPH] large chain; oxidoreduc 99.89
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 99.89
1ofd_A 1520 Ferredoxin-dependent glutamate synthase 2; oxidore 99.88
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 99.86
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 99.85
3tjx_A354 Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh 99.84
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.78
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 99.77
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 99.76
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 99.76
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 99.76
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 99.76
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 99.75
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 99.75
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 99.75
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 99.75
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 99.73
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 99.69
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 99.68
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 99.67
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 99.67
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 99.67
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 99.67
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 99.64
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 99.63
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 99.62
2cu0_A486 Inosine-5'-monophosphate dehydrogenase; structural 99.59
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 99.58
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 99.55
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 99.53
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 99.51
1o94_A 729 Tmadh, trimethylamine dehydrogenase; electron tran 99.5
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 99.5
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 99.46
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 99.46
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 99.34
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 99.32
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 99.31
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 99.31
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 99.27
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 99.24
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 99.23
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 99.19
3tjl_A407 NADPH dehydrogenase; OLD yellow enzyme, flavin mon 99.11
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 99.11
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 99.1
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 99.07
3tha_A252 Tryptophan synthase alpha chain; structural genomi 99.03
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 99.02
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 99.01
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 99.0
4a3u_A358 NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET 99.0
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 98.99
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.96
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 98.95
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 98.95
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 98.94
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 98.92
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 98.92
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 98.86
1ujp_A271 Tryptophan synthase alpha chain; riken structural 98.85
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 98.84
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 98.82
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 98.8
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 98.8
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 98.77
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 98.74
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 98.71
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 98.69
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 98.69
3oa3_A288 Aldolase; structural genomics, seattle structural 98.68
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.67
2yzr_A330 Pyridoxal biosynthesis lyase PDXS; redox protein, 98.66
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 98.64
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 98.63
4gbu_A400 NADPH dehydrogenase 1; alpha/beta barrel, enenone 98.63
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 98.6
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 98.6
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 98.58
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 98.55
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 98.55
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 98.52
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 98.51
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 98.51
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 98.5
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 98.5
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 98.49
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 98.49
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 98.48
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 98.47
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 98.45
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 98.45
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 98.44
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 98.44
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 98.42
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 98.42
2fli_A220 Ribulose-phosphate 3-epimerase; (beta/alpha)8-barr 98.41
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 98.4
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 98.4
1i4n_A251 Indole-3-glycerol phosphate synthase; thermostable 98.4
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 98.39
1tqj_A230 Ribulose-phosphate 3-epimerase; beta-alpha barrel 98.31
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.29
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 98.29
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 98.29
3inp_A246 D-ribulose-phosphate 3-epimerase; IDP02542, isomer 98.27
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 98.25
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 98.22
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 98.11
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 98.07
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 98.07
1n7k_A234 Deoxyribose-phosphate aldolase; A.pernix, tetramer 98.0
3kts_A192 Glycerol uptake operon antiterminator regulatory; 97.98
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 97.96
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 97.94
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 97.94
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 97.92
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 97.91
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 97.9
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 97.9
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 97.88
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 97.86
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 97.85
1qap_A296 Quinolinic acid phosphoribosyltransferase; glycosy 97.85
2b7n_A273 Probable nicotinate-nucleotide pyrophosphorylase; 97.85
3exr_A221 RMPD (hexulose-6-phosphate synthase); beta barrel, 97.83
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 97.82
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 97.82
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 97.8
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 97.8
2w6r_A 266 Imidazole glycerol phosphate synthase subunit HISF 97.72
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 97.71
1x1o_A286 Nicotinate-nucleotide pyrophosphorylase; transfera 97.67
2jbm_A299 Nicotinate-nucleotide pyrophosphorylase; NAD, enzy 97.66
3s1x_A223 Probable transaldolase; alpha-beta barrel, conform 97.63
3r8r_A212 Transaldolase; pentose phosphate pathway, schiff b 97.62
3tqv_A287 Nicotinate-nucleotide pyrophosphorylase; glycosylt 97.6
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.58
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 97.58
1q6o_A216 Humps, 3-keto-L-gulonate 6-phosphate decarboxylase 97.57
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 97.56
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 97.53
4eiv_A297 Deoxyribose-phosphate aldolase; chemotherapy, brai 97.5
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.49
3c2e_A294 Nicotinate-nucleotide pyrophosphorylase; qprtase, 97.48
3paj_A320 Nicotinate-nucleotide pyrophosphorylase, carboxyl; 97.48
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 97.47
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 97.47
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 97.44
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 97.41
1o4u_A285 Type II quinolic acid phosphoribosyltransferase; s 97.37
1viz_A240 PCRB protein homolog; structural genomics, unknown 97.34
3l0g_A300 Nicotinate-nucleotide pyrophosphorylase; ssgcid, N 97.33
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 97.32
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 97.29
1hg3_A225 Triosephosphate isomerase; thermostability, tetram 97.27
3gnn_A298 Nicotinate-nucleotide pyrophosphorylase; decode bi 97.25
1vpx_A230 Protein (transaldolase (EC 2.2.1.2)); TM0295, stru 97.23
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 97.23
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 97.23
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 97.23
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 97.22
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 97.21
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 97.2
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 97.18
2nql_A388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 97.17
2hzg_A401 Mandelate racemase/muconate lactonizing enzyme/EN 97.15
1w0m_A226 TIM, triosephosphate isomerase; glycolysis, glucon 97.15
1rvk_A382 Isomerase/lactonizing enzyme; enolase superfamily, 97.14
1qpo_A284 Quinolinate acid phosphoribosyl transferase; type 97.13
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 97.04
1zfj_A 491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 97.04
3iv3_A332 Tagatose 1,6-diphosphate aldolase 2; TIM barrel, p 97.03
1nu5_A370 Chloromuconate cycloisomerase; enzyme, dehalogenat 97.01
2qgy_A391 Enolase from the environmental genome shotgun sequ 96.98
2h6r_A219 Triosephosphate isomerase; beta-alpha barrel; 2.30 96.96
3ve9_A215 Orotidine-5'-phosphate decarboxylase; TIM barrel f 96.96
2og9_A393 Mandelate racemase/muconate lactonizing enzyme; NY 96.95
3ozy_A389 Putative mandelate racemase; beta-alpha barrel, en 96.84
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 96.84
1tkk_A366 Similar to chloromuconate cycloisomerase; epimeras 96.82
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 96.81
4dbe_A222 Orotidine 5'-phosphate decarboxylase; TIM barrel, 96.8
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.8
2qdd_A378 Mandelate racemase/muconate lactonizing enzyme; en 96.78
2p8b_A369 Mandelate racemase/muconate lactonizing enzyme fam 96.76
3eez_A378 Putative mandelate racemase/muconate lactonizing e 96.74
2pp0_A398 L-talarate/galactarate dehydratase; enolase superf 96.69
3cu2_A237 Ribulose-5-phosphate 3-epimerase; YP_718263.1, rib 96.69
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.66
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 96.63
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 96.62
1l6w_A220 Fructose-6-phosphate aldolase 1; alpha-beta barrel 96.61
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis pro 96.59
2ps2_A371 Putative mandelate racemase/muconate lactonizing e 96.56
2oz8_A389 MLL7089 protein; structural genomics, unknown func 96.56
3sjn_A374 Mandelate racemase/muconate lactonizing protein; e 96.54
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 96.5
3i4k_A383 Muconate lactonizing enzyme; structural genomics, 96.47
3stp_A412 Galactonate dehydratase, putative; PSI biology, st 96.46
2qde_A397 Mandelate racemase/muconate lactonizing enzyme FA 96.45
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 96.44
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 96.42
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 96.41
3rcy_A433 Mandelate racemase/muconate lactonizing enzyme-LI 96.4
4dwd_A393 Mandelate racemase/muconate lactonizing enzyme, C 96.38
2agk_A260 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 96.38
2gdq_A382 YITF; mandelate racemase/muconate lactonizing enzy 96.34
1tzz_A392 Hypothetical protein L1841; structural genomics, m 96.3
4e5t_A404 Mandelate racemase / muconate lactonizing enzyme, 96.24
3jva_A354 Dipeptide epimerase; enolase superfamily, isomeras 96.23
1wx0_A223 Transaldolase; structural genomics, riken structur 96.22
3usb_A 511 Inosine-5'-monophosphate dehydrogenase; structural 96.21
1vli_A385 Spore coat polysaccharide biosynthesis protein SP; 96.2
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 96.18
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 96.15
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 96.12
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 96.09
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 96.01
3daq_A 292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 95.96
2poz_A392 Putative dehydratase; octamer, structural genomics 95.95
3tj4_A372 Mandelate racemase; enolase, dehydratase, enzyme f 95.94
3rr1_A405 GALD, putative D-galactonate dehydratase; enolase, 95.93
4e4u_A412 Mandalate racemase/muconate lactonizing enzyme; ma 95.85
3cpr_A 304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 95.85
3bjs_A428 Mandelate racemase/muconate lactonizing enzyme; en 95.83
3flu_A 297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 95.81
3tak_A 291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 95.79
3qze_A 314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 95.77
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 95.75
2gl5_A410 Putative dehydratase protein; structural genomics, 95.74
2wkj_A 303 N-acetylneuraminate lyase; directed evolution, sia 95.73
1f6k_A 293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 95.73
3go2_A409 Putative L-alanine-DL-glutamate epimerase; structu 95.71
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 95.71
2yxg_A 289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 95.71
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 95.69
1xky_A 301 Dihydrodipicolinate synthase; TIM barrel, , lysine 95.68
2ehh_A 294 DHDPS, dihydrodipicolinate synthase; structural ge 95.67
3si9_A 315 DHDPS, dihydrodipicolinate synthase; structural ge 95.66
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.66
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 95.65
2r8w_A 332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 95.64
3ugv_A390 Enolase; enzyme function initiative, EFI, lyase; 2 95.63
3na8_A 315 Putative dihydrodipicolinate synthetase; lyase; HE 95.63
3dg3_A367 Muconate cycloisomerase; muconate lactonizing enzy 95.63
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 95.62
1sjd_A368 N-acylamino acid racemase; lyase, isomerase; HET: 95.6
2o56_A407 Putative mandelate racemase; dehydratase, structur 95.59
2ox4_A403 Putative mandelate racemase; enolase, dehydratase, 95.59
3fkr_A 309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 95.56
3r4e_A418 Mandelate racemase/muconate lactonizing enzyme; en 95.56
3mqt_A394 Mandelate racemase/muconate lactonizing protein; P 95.55
2hxt_A441 L-fuconate dehydratase; enolase superfamily, D-ery 95.55
2rfg_A 297 Dihydrodipicolinate synthase; beta barrel, amino-a 95.53
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 95.5
3q45_A368 Mandelate racemase/muconate lactonizing enzyme FA 95.5
3ddm_A392 Putative mandelate racemase/muconate lactonizing e 95.5
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 95.49
2ojp_A 292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 95.48
3mkc_A394 Racemase; metabolic process, PSI2, NYSGXRC, struct 95.47
3m5v_A 301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 95.46
3b4u_A 294 Dihydrodipicolinate synthase; structural genomics, 95.46
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 95.45
1chr_A370 Chloromuconate cycloisomerase; 3.00A {Ralstonia eu 95.42
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 95.39
1o5k_A 306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 95.39
3sbf_A401 Mandelate racemase / muconate lactonizing enzyme; 95.39
3kts_A192 Glycerol uptake operon antiterminator regulatory; 95.33
3e96_A 316 Dihydrodipicolinate synthase; structural genomics, 95.32
3ro6_B356 Putative chloromuconate cycloisomerase; TIM barrel 95.3
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 95.29
3qfe_A 318 Putative dihydrodipicolinate synthase family PROT; 95.27
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 95.27
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.27
3mwc_A400 Mandelate racemase/muconate lactonizing protein; e 95.25
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 95.24
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 95.19
2vc6_A 292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 95.16
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 95.15
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 95.15
2qq6_A410 Mandelate racemase/muconate lactonizing enzyme- li 95.12
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 95.08
3s5o_A 307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 95.05
3vcn_A425 Mannonate dehydratase; enolase, magnesium binding 95.05
3tji_A422 Mandelate racemase/muconate lactonizing enzyme, N 95.03
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 95.01
3dz1_A 313 Dihydrodipicolinate synthase; lysine biosynthesis, 94.98
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 94.98
3my9_A377 Muconate cycloisomerase; structural genomics, PSI- 94.95
3h5d_A 311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 94.94
4avf_A 490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 94.92
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 94.92
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 94.9
2wqp_A 349 Polysialic acid capsule biosynthesis protein SIAC; 94.86
1r0m_A375 N-acylamino acid racemase; isomerase; 1.30A {Deino 94.84
3ffs_A 400 Inosine-5-monophosphate dehydrogenase; beta-alpha 94.83
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 94.83
4fxs_A 496 Inosine-5'-monophosphate dehydrogenase; structural 94.72
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 94.7
3a5f_A 291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 94.69
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 94.68
3eb2_A 300 Putative dihydrodipicolinate synthetase; lysine bi 94.67
4dpp_A 360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 94.67
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 94.63
2zc8_A369 N-acylamino acid racemase; octamer, TIM beta/alpha 94.57
3v3w_A424 Starvation sensing protein RSPA; enolase, enzyme f 94.55
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 94.54
2hmc_A 344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 94.51
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 94.51
3gd6_A391 Muconate cycloisomerase; structural genomics, NYSG 94.48
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 94.47
3r0u_A379 Enzyme of enolase superfamily; structural genomics 94.44
4adt_A 297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 94.42
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 94.41
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 94.38
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 94.34
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 94.31
3g8r_A 350 Probable spore coat polysaccharide biosynthesis P; 94.25
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 94.25
3i6e_A385 Muconate cycloisomerase I; structural genomics, NY 94.09
3g8r_A350 Probable spore coat polysaccharide biosynthesis P; 94.06
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 94.04
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 94.02
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 94.0
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 93.89
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 93.8
1vrd_A 494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 93.69
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 93.69
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 93.67
3p3b_A392 Mandelate racemase/muconate lactonizing protein; e 93.67
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 93.65
3tcs_A388 Racemase, putative; PSI-biology, nysgrc, structura 93.64
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 93.58
3fv9_G386 Mandelate racemase/muconate lactonizing enzyme; st 93.58
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 93.57
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 93.56
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 93.55
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 93.53
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 93.52
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 93.51
3bo9_A 326 Putative nitroalkan dioxygenase; TM0800, structura 93.51
3t6c_A440 RSPA, putative MAND family dehydratase; enolase, m 93.47
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 93.44
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 93.35
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 93.35
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 93.29
2cu0_A 486 Inosine-5'-monophosphate dehydrogenase; structural 93.27
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 93.16
1eep_A 404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 93.13
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 93.11
4dye_A398 Isomerase; enolase family protein, EFI, enzym func 93.09
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 93.08
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 92.98
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 92.98
3dgb_A382 Muconate cycloisomerase; muconate lactonizing enzy 92.91
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 92.88
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 92.85
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 92.77
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 92.75
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 92.75
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 92.59
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 92.54
2zbt_A 297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 92.47
4e8g_A391 Enolase, mandelate racemase/muconate lactonizing e 92.4
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 92.4
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 92.3
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 92.23
2c6q_A 351 GMP reductase 2; TIM barrel, metal-binding, NADP, 92.22
3fcp_A381 L-Ala-D/L-Glu epimerase, A muconate lactonizing en 92.19
3pm6_A306 Putative fructose-bisphosphate aldolase; structura 92.13
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 92.07
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 92.01
2nv1_A 305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 91.96
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 91.92
1ujp_A271 Tryptophan synthase alpha chain; riken structural 91.85
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 91.74
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 91.74
3dip_A410 Enolase; structural genomics, isomerase, PSI-2, pr 91.73
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 91.68
3oa3_A288 Aldolase; structural genomics, seattle structural 91.64
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 91.55
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 91.51
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 91.51
2r91_A 286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 91.5
1dbt_A239 Orotidine 5'-phosphate decarboxylase; UMP, TIM bar 91.43
4e4f_A426 Mannonate dehydratase; magnesium binding, enzyme f 91.33
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 91.18
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 91.18
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 91.05
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 91.03
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 90.99
3fa4_A 302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 90.97
3tha_A252 Tryptophan synthase alpha chain; structural genomi 90.87
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 90.86
2isw_A323 Putative fructose-1,6-bisphosphate aldolase; class 90.8
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 90.8
1rpx_A230 Protein (ribulose-phosphate 3-epimerase); chloropl 90.78
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 90.76
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 90.64
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 90.63
3vk5_A286 MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S 90.63
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 90.59
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 90.56
3ik4_A365 Mandelate racemase/muconate lactonizing protein; s 90.49
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 90.45
1w3i_A 293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 90.43
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 90.3
3o07_A 291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 90.25
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 90.24
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 90.21
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 90.15
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 90.1
4hnl_A421 Mandelate racemase/muconate lactonizing enzyme; de 90.01
4a35_A441 Mitochondrial enolase superfamily member 1; isomer 89.97
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 89.96
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 89.96
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 89.93
1vqt_A213 Orotidine 5'-phosphate decarboxylase; TM0332, stru 89.81
1twd_A 256 Copper homeostasis protein CUTC; TIM-like protein, 89.8
2hjp_A 290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 89.77
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 89.75
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 89.7
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 89.65
2nuw_A 288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 89.6
1tqx_A227 D-ribulose-5-phosphate 3-epimerase, putative; stru 89.31
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 89.26
4dxk_A400 Mandelate racemase / muconate lactonizing enzyme p 89.25
3lye_A 307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 89.2
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 88.94
3b8i_A 287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 88.89
4aaj_A228 N-(5'-phosphoribosyl)anthranilate isomerase; alpha 88.65
3eoo_A 298 Methylisocitrate lyase; seattle structural genomic 88.61
2vef_A314 Dihydropteroate synthase; antibiotic resistance, t 88.58
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 88.42
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 88.31
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 88.24
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 88.21
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 88.02
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 87.95
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 87.86
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 87.83
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 87.81
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 87.81
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 87.78
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 87.71
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 87.65
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 87.49
3ctl_A231 D-allulose-6-phosphate 3-epimerase; D-glucitol 6-p 87.47
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 87.4
4a29_A258 Engineered retro-aldol enzyme RA95.0; de novo prot 87.29
1viz_A240 PCRB protein homolog; structural genomics, unknown 87.17
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 87.1
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 87.08
3ih1_A 305 Methylisocitrate lyase; alpha-beta structure, TIM- 87.04
2i1o_A398 Nicotinate phosphoribosyltransferase; ZIN ION, zin 87.04
1v5x_A203 PRA isomerase, phosphoribosylanthranilate isomeras 87.02
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 87.01
1rvg_A305 Fructose-1,6-bisphosphate aldolase; class II aldol 86.85
1nsj_A205 PRAI, phosphoribosyl anthranilate isomerase; therm 86.63
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 86.55
1zlp_A 318 PSR132, petal death protein; TIM-barrel, helix swa 86.53
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 86.49
1vkf_A188 Glycerol uptake operon antiterminator-related Pro; 86.46
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 86.45
1s2w_A 295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 86.4
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 86.31
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 86.26
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 86.15
1xg4_A 295 Probable methylisocitrate lyase; 2-methylisocitrat 86.13
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 85.95
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 85.95
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 85.95
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
Probab=100.00  E-value=9.4e-58  Score=424.35  Aligned_cols=290  Identities=46%  Similarity=0.748  Sum_probs=261.3

Q ss_pred             CceeecCcccCCceEeccccCcccCCCHHHHHHHHHHHHcCCceeecCCCCCCHHHHhccCC-CCceEEeeecCCchHHH
Q 021739            1 MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP-GIRFFQLYVTKHRNVDA   79 (308)
Q Consensus         1 ~~t~~~g~~~~~Pi~iapm~~~~~~~~~~~~~~a~~a~~~g~~~~~s~~~~~~~e~i~~~~~-~~~~~Ql~~~~d~~~~~   79 (308)
                      |+|++||++++.||++||+++.++.||++|..++++|+++|+++++|+++++++||+++..+ ++.|||||+..|++.+.
T Consensus        59 ~~t~llG~~~~~P~~iaP~g~~~l~~~~ge~~~araa~~~gi~~~lSt~ss~s~e~v~~~~~~~~~wfQlY~~~d~~~~~  138 (352)
T 3sgz_A           59 TRTTIQGQEISAPICISPTAFHSIAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNK  138 (352)
T ss_dssp             CCEEETTEEESSSEEECCCSCGGGTCTTHHHHHHHHHHHHTCEEEECTTCSSCHHHHHHHSTTCEEEEECCCCSCHHHHH
T ss_pred             CceEECCcccCCcceechHHHHHhcCccHHHHHHHHHHHcCCCeEeCCCCCCCHHHHHHhccCccceeccccCCCHHHHH
Confidence            68999999999999999999999999999999999999999999999999999999998876 48899999999999999


Q ss_pred             HHHHHHHHcCCcEEEEecCCCCCCcchHHhhhccCCCCccccccccccccccCCCCCCchhhhHhhhhcccccCHHHHHH
Q 021739           80 QLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKW  159 (308)
Q Consensus        80 ~~~~~~~~~g~~~i~i~~~~p~~~~r~~~~~~~~~~p~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~i~~  159 (308)
                      +++++++++|+++|++|+|+|+.|+|++|+|++|..|++++.+++....    ....++.   ......|+.++|+.|++
T Consensus       139 ~l~~ra~~aG~~alvlTvD~p~~g~R~~d~r~~~~~p~~~~~~~~~~~~----~~~~~~~---~~~~~~d~~~~w~~i~~  211 (352)
T 3sgz_A          139 QMVQRAEALGFKALVITIDTPVLGNRRRDKRNQLNLEANILKAALRALK----EEKPTQS---VPVLFPKASFCWNDLSL  211 (352)
T ss_dssp             HHHHHHHHTTCCCEEEECSCSSCCCCHHHHHHHHHSCHHHHTTCC----------------------CCCTTCCHHHHHH
T ss_pred             HHHHHHHHcCCCEEEEEeCCCCCCcchhhhhcCCCCCcccchhhhcccc----cccccch---hhhhccCCCCCHHHHHH
Confidence            9999999999999999999999999999999999999766554443211    0000011   11134789999999999


Q ss_pred             HHHhcCCCEEEEecCCHHHHHHHHHcCCcEEEEecccccCCCCCcchHHHHHHHHHHccCCCeEEEecCCCCHHHHHHHH
Q 021739          160 LQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKAL  239 (308)
Q Consensus       160 ir~~~~~Pv~vK~~~~~e~a~~~~~~G~d~i~v~~~gg~~~~~~~~~~~~l~~i~~~~~~~ipvia~GGI~~~~d~~k~l  239 (308)
                      +|+.+++||++|++.+.++++.+.++|+|+|+++||||++.++++++++.|.++++.+.+++|||++|||+++.|+.|+|
T Consensus       212 lr~~~~~PvivK~v~~~e~A~~a~~~GaD~I~vsn~GG~~~d~~~~~~~~L~~i~~av~~~ipVia~GGI~~g~Dv~kaL  291 (352)
T 3sgz_A          212 LQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREVVAAVKGKIEVYMDGGVRTGTDVLKAL  291 (352)
T ss_dssp             HHHHCCSCEEEEEECSHHHHHHHHHTTCSEEEECCGGGTSSCSSCCHHHHHHHHHHHHTTSSEEEEESSCCSHHHHHHHH
T ss_pred             HHHhcCCCEEEEecCcHHHHHHHHHcCCCEEEEeCCCCCccCCCccHHHHHHHHHHHhCCCCeEEEECCCCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999988887789999999999999999999


Q ss_pred             HcCCCEEEEchHHHHhcccCCHHHHHHHHHHHHHHHHHHHHHcCCCCHhhhcccceec
Q 021739          240 ALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVT  297 (308)
Q Consensus       240 ~~GAd~V~ig~~~l~~~~~~G~~~v~~~i~~l~~~l~~~m~~~G~~~i~~l~~~~~~~  297 (308)
                      ++|||+|++||+|++++.+.|++++.++++.+++||+.+|..+|+++++|++++.++.
T Consensus       292 alGA~aV~iGr~~l~~l~~~G~~gv~~~l~~l~~el~~~m~~~G~~~i~el~~~~~~y  349 (352)
T 3sgz_A          292 ALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISPDLIQF  349 (352)
T ss_dssp             HTTCSEEEESHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSBGGGCCGGGBSS
T ss_pred             HcCCCEEEECHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHHhCCCcHHHHhhhcchh
Confidence            9999999999999999888899999999999999999999999999999999988763
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3tjl_A NADPH dehydrogenase; OLD yellow enzyme, flavin mononucleotide, TIM barrel, NADPH oxidoreductase, enone reductase; HET: FMN; 1.50A {Scheffersomyces stipitis cbs 6054} PDB: 3upw_A* 4df2_A* Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>4a3u_A NCR, NADH\:flavin oxidoreductase/NADH oxidase; HET: FMN; 1.70A {Zymomonas mobilis} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>4gbu_A NADPH dehydrogenase 1; alpha/beta barrel, enenone reductase, alkene reductase, NADP oxidoreductase, carvone, enenatioselectivity; HET: 0WV 1PE FMN; 1.18A {Saccharomyces pastorianus} PDB: 4ge8_A* 1oya_A* 1oyb_A* 1oyc_A* 3tx9_A* 3rnd_A* 1k02_A* 1k03_A* 1bwk_A* 1bwl_A* Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2fli_A Ribulose-phosphate 3-epimerase; (beta/alpha)8-barrel, D- xylitol 5-phosphate, isomerase; HET: DX5; 1.80A {Streptococcus pyogenes} SCOP: c.1.2.2 Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1i4n_A Indole-3-glycerol phosphate synthase; thermostable TIM-barrel protein, salt bridges, electrostatic interactions, lyase; 2.50A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1j5t_A Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>1tqj_A Ribulose-phosphate 3-epimerase; beta-alpha barrel epimerase, isomerase; 1.60A {Synechocystis SP} SCOP: c.1.2.2 Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3inp_A D-ribulose-phosphate 3-epimerase; IDP02542, isomerase, struc genomics, center for structural genomics of infectious DISE csgid; 2.05A {Francisella tularensis subsp} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* Back     alignment and structure
>3exr_A RMPD (hexulose-6-phosphate synthase); beta barrel, lyase; 1.70A {Streptococcus mutans} SCOP: c.1.2.3 PDB: 3exs_A* 3ext_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} Back     alignment and structure
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A Back     alignment and structure
>3s1x_A Probable transaldolase; alpha-beta barrel, conformational selection, domain swapping transferase; HET: I22; 1.65A {Thermoplasma acidophilum} PDB: 3s1u_A* 3s1v_A* 3s0c_A* 3s1w_A* Back     alignment and structure
>3r8r_A Transaldolase; pentose phosphate pathway, schiff bases; 1.90A {Bacillus subtilis} Back     alignment and structure
>3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A* Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* Back     alignment and structure
>3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1 Back     alignment and structure
>3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} Back     alignment and structure
>1vpx_A Protein (transaldolase (EC 2.2.1.2)); TM0295, structural genomics, JOI for structural genomics, JCSG; HET: GOL; 2.40A {Thermotoga maritima} SCOP: c.1.10.1 Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>1w0m_A TIM, triosephosphate isomerase; glycolysis, gluconeogenesis; 2.5A {Thermoproteus tenax} SCOP: c.1.1.1 Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolas tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A* 3myp_A 3myo_A Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>2h6r_A Triosephosphate isomerase; beta-alpha barrel; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3ve9_A Orotidine-5'-phosphate decarboxylase; TIM barrel fold, orotidine 5'-monopho decarboxylase, lyase; 1.45A {Metallosphaera sedula} PDB: 3ve7_A Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>4dbe_A Orotidine 5'-phosphate decarboxylase; TIM barrel, orotidine 5'-monophosphate decarboxylase, inhibi lyase-lyase inhibitor complex; HET: BMP; 1.79A {Sulfolobus solfataricus} Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2qdd_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.30A {Roseovarius nubinhibens} PDB: 3fvd_B Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>3cu2_A Ribulose-5-phosphate 3-epimerase; YP_718263.1, ribulose-PHOS epimerase family, structural genomics, joint center for STR genomics, JCSG; 1.91A {Haemophilus somnus} Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1l6w_A Fructose-6-phosphate aldolase 1; alpha-beta barrel, domain swapping, lyase; 1.93A {Escherichia coli} SCOP: c.1.10.1 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>1wx0_A Transaldolase; structural genomics, riken structural genomics/proteomics initiative, RSGI, transferas; 2.27A {Thermus thermophilus HB8} SCOP: c.1.10.1 Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>3dg3_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding; 1.60A {Mycobacterium smegmatis} PDB: 3dg6_A* 3dg7_A* Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>3mqt_A Mandelate racemase/muconate lactonizing protein; PSI-II, NYSGXRC, muconate lactonizing EN structural genomics, protein structure initiative; 2.10A {Shewanella pealeana} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>3q45_A Mandelate racemase/muconate lactonizing enzyme FA possible chloromuconate cycloisomerase...; (beta/alpha)8-barrel; 3.00A {Cytophaga hutchinsonii} PDB: 3q4d_A Back     alignment and structure
>3ddm_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9284B, enolase family, PSI-2; 2.60A {Bordetella bronchiseptica} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>3mkc_A Racemase; metabolic process, PSI2, NYSGXRC, structu genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; 1.77A {Pseudovibrio SP} PDB: 3nzg_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1chr_A Chloromuconate cycloisomerase; 3.00A {Ralstonia eutropha} PDB: 2chr_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3ro6_B Putative chloromuconate cycloisomerase; TIM barrel; 2.20A {Methylococcus capsulatus} PDB: 3rit_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3mwc_A Mandelate racemase/muconate lactonizing protein; enolase, structural genomics, protein structure initiative, nysgrc; 1.80A {Kosmotoga olearia} Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3my9_A Muconate cycloisomerase; structural genomics, PSI-2, protein structure INI NEW YORK SGX research center for structural genomics, nysgx; 2.20A {Azorhizobium caulinodans} Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2zc8_A N-acylamino acid racemase; octamer, TIM beta/alpha-barrel, metal-binding, metal binding; 1.95A {Thermus thermophilus} Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3gd6_A Muconate cycloisomerase; structural genomics, NYSGXRC, target 9375A, divergent enolase, lyase, PSI-2; 1.60A {Oceanobacillus iheyensis HTE831} PDB: 2oqy_A 3es8_A 3es7_A 3fyy_A 3hpf_A* Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>3r0u_A Enzyme of enolase superfamily; structural genomics, putative epimerase, PSI-biolog YORK structural genomics research consortium; HET: MSE TAR; 1.90A {Francisella philomiragia subsp} PDB: 3px5_A* 3r0k_A* 3r10_A 3r11_A 3r1z_A* Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>3i6e_A Muconate cycloisomerase I; structural genomics, NYSGXRC, targer 9468A, muconate lactonizing enzyme, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} PDB: 3i6t_A Back     alignment and structure
>3g8r_A Probable spore coat polysaccharide biosynthesis P; structural genomics, protein structure initiative; 2.49A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>3p3b_A Mandelate racemase/muconate lactonizing protein; enolase superfamily fold, galacturonate dehydratase, D-tartr galacturonate, lyase; HET: TAR; 1.65A {Geobacillus SP} PDB: 3ops_A* 3n4f_A* 3qpe_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>3fv9_G Mandelate racemase/muconate lactonizing enzyme; structural genomics, mandelate racemase/muconatelactonizing hydrolase, PSI-2; 1.90A {Roseovarius nubinhibens ism} PDB: 2pce_A Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3t6c_A RSPA, putative MAND family dehydratase; enolase, mannonate dehydratase related protein, enzyme funct intitiative, lyase, hydro-lyases; HET: GCO; 1.60A {Pantoea ananatis} PDB: 3tw9_A 3twa_A 3twb_A* Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>4dye_A Isomerase; enolase family protein, EFI, enzym function initiative; 1.60A {Streptomyces coelicolor} PDB: 2oqh_A Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3dgb_A Muconate cycloisomerase; muconate lactonizing enzyme, muconolactone binding, isomeras structural genomics, PSI-2; HET: MUC; 1.70A {Pseudomonas fluorescens} PDB: 3ct2_A* 3fj4_A* 1muc_A 1bkh_A 3muc_A 2muc_A 1f9c_A Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>4e8g_A Enolase, mandelate racemase/muconate lactonizing enzyme, N domain protein; putative racemase, nysgrc, structural genomics, PSI-biology; 2.00A {Paracoccus denitrificans} Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>3fcp_A L-Ala-D/L-Glu epimerase, A muconate lactonizing enzyme; structural genomics, nysgrc,target 9450E, PSI-2; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3pm6_A Putative fructose-bisphosphate aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.20A {Coccidioides immitis} Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>3dip_A Enolase; structural genomics, isomerase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, NYSGXRC, lyase; HET: SIC; 2.50A {Unidentified} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>1dbt_A Orotidine 5'-phosphate decarboxylase; UMP, TIM barrel, lyase; HET: U5P; 2.40A {Bacillus subtilis} SCOP: c.1.2.3 Back     alignment and structure
>4e4f_A Mannonate dehydratase; magnesium binding, enzyme function initiative, isomerase; 2.00A {Pectobacterium carotovorum subsp} Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2isw_A Putative fructose-1,6-bisphosphate aldolase; class II fructose-1,6-bisphosphate aldolase, glycolytic pathway, giardia lamblia, drug target; HET: PGH; 1.75A {Giardia intestinalis} PDB: 2isv_A* 3ohi_A* 3gay_A* 3gak_A* 3gb6_A* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>1rpx_A Protein (ribulose-phosphate 3-epimerase); chloroplast, calvin cycle, oxidative pentose PH pathway; 2.30A {Solanum tuberosum} SCOP: c.1.2.2 Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>3ik4_A Mandelate racemase/muconate lactonizing protein; structural genomics, enolase, epimerase, PSI-2, protein STRU initiative; 2.10A {Herpetosiphon aurantiacus atcc 23779} Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>4hnl_A Mandelate racemase/muconate lactonizing enzyme; dehydratase, magnesium binding, enzyme function initiative,; 1.48A {Enterococcus gallinarum EG2} PDB: 3s47_A Back     alignment and structure
>4a35_A Mitochondrial enolase superfamily member 1; isomerase; 1.74A {Homo sapiens} Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>1vqt_A Orotidine 5'-phosphate decarboxylase; TM0332, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.00A {Thermotoga maritima} SCOP: c.1.2.3 Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>1tqx_A D-ribulose-5-phosphate 3-epimerase, putative; structural genomics, protein structure initiative, PSI; 2.00A {Plasmodium falciparum} SCOP: c.1.2.2 Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>4dxk_A Mandelate racemase / muconate lactonizing enzyme protein; enolase, mandelate racemase subgroup, enzyme function initia EFI; 1.25A {Agrobacterium tumefaciens} PDB: 4dx3_A 2pod_A Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>4aaj_A N-(5'-phosphoribosyl)anthranilate isomerase; alpha/beta-barrel, hyperthermophilic, phosphoribo isomerase; 1.75A {Pyrococcus furiosus} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>2vef_A Dihydropteroate synthase; antibiotic resistance, transferase, folate biosynthesis; 1.8A {Streptococcus pneumoniae} PDB: 2veg_A* Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ctl_A D-allulose-6-phosphate 3-epimerase; D-glucitol 6-phosphate, (beta/alpha)8 barrel, carbohydrate metabolism, isomerase; HET: S6P; 2.20A {Escherichia coli} PDB: 3ct7_A* Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>4a29_A Engineered retro-aldol enzyme RA95.0; de novo protein, engineered enzyme, retro-aldolase, directed evolution; HET: 3NK MLT; 1.10A {Synthetic construct} PDB: 4a2s_A* 4a2r_A* 3tc7_A 3tc6_A 3nl8_A* 3nxf_A* 3o6y_X 3ud6_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 1a53_A* 1lbf_A* 1lbl_A* 3nyz_A 3nz1_A* 3uy7_A 3uxd_A* 3uxa_A* ... Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>2i1o_A Nicotinate phosphoribosyltransferase; ZIN ION, zinc finger M structural genomics, PSI, protein structure initiative; 2.40A {Thermoplasma acidophilum} PDB: 1ytd_A* 1yte_A* 1ytk_A Back     alignment and structure
>1v5x_A PRA isomerase, phosphoribosylanthranilate isomerase; alpha-beta barrel, TRPF, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>1rvg_A Fructose-1,6-bisphosphate aldolase; class II aldolase, metal-depdendent aldolase, lyase; 2.00A {Thermus aquaticus} SCOP: c.1.10.2 PDB: 1rv8_A 2fjk_A* Back     alignment and structure
>1nsj_A PRAI, phosphoribosyl anthranilate isomerase; thermostability; 2.00A {Thermotoga maritima} SCOP: c.1.2.4 PDB: 1lbm_A 1dl3_A Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1vkf_A Glycerol uptake operon antiterminator-related Pro; struc genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: CIT; 1.65A {Thermotoga maritima} SCOP: c.1.29.1 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 308
d1goxa_359 c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia 4e-84
d1p4ca_353 c.1.4.1 (A:) Membrane-associated (S)-mandelate deh 7e-67
d1tb3a1349 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus 2e-66
d1kbia1414 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal 3e-63
d1p0ka_329 c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomera 1e-49
d1vcfa1310 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-i 2e-43
d1yxya1230 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-p 2e-14
d1y0ea_222 c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosph 3e-14
d1ofda2809 c.1.4.1 (A:431-1239) Alpha subunit of glutamate sy 1e-07
d1ea0a2771 c.1.4.1 (A:423-1193) Alpha subunit of glutamate sy 1e-07
d1juba_311 c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactoco 0.001
d1znna1254 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase Pd 0.001
d1xm3a_251 c.1.31.1 (A:) Thiazole biosynthesis protein ThiG { 0.003
d1wv2a_243 c.1.31.1 (A:) Thiazole biosynthesis protein ThiG { 0.004
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 359 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Glycolate oxidase
species: Spinach (Spinacia oleracea) [TaxId: 3562]

 Score =  255 bits (652), Expect = 4e-84
 Identities = 260/300 (86%), Positives = 283/300 (94%)

Query: 1   MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSST 60
           MTTT+LGF ISMPIMIAPTA QKMAHPEGE ATARAASAAGTIMTLSSWATSSVEEV+ST
Sbjct: 60  MTTTILGFKISMPIMIAPTAMQKMAHPEGEYATARAASAAGTIMTLSSWATSSVEEVAST 119

Query: 61  GPGIRFFQLYVTKHRNVDAQLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLT 120
           GPGIRFFQLYV K RNV AQLV+RAERAGFKAIALTVDTPRLGRREADIKNRFVLPP LT
Sbjct: 120 GPGIRFFQLYVYKDRNVVAQLVRRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPFLT 179

Query: 121 LKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKWLQTITSLPILVKGVLTAEDAS 180
           LKN+EG+ +GKMDK +DSGL+SYVA QIDRSL+WKDV WLQTITSLPILVKGV+TAEDA 
Sbjct: 180 LKNFEGIDLGKMDKANDSGLSSYVAGQIDRSLSWKDVAWLQTITSLPILVKGVITAEDAR 239

Query: 181 LAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKALA 240
           LA+Q+GAAGIIVSNHGARQLDYVPAT+MALEEVV+AA+GR+PVFLDGGVRRGTDVFKALA
Sbjct: 240 LAVQHGAAGIIVSNHGARQLDYVPATIMALEEVVKAAQGRIPVFLDGGVRRGTDVFKALA 299

Query: 241 LGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIVTHWD 300
           LGA+GVF+GRPV FSLA +GEAGV+KVLQM+RDEFELTMALSGCRSLKEI+R+HI   WD
Sbjct: 300 LGAAGVFIGRPVVFSLAAEGEAGVKKVLQMMRDEFELTMALSGCRSLKEISRSHIAADWD 359
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 353 Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 349 Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 414 Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Length = 329 Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Length = 310 Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Length = 230 Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Length = 222 Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Length = 809 Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Length = 771 Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Length = 311 Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Length = 254 Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Length = 251 Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Length = 243 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query308
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 100.0
d1goxa_359 Glycolate oxidase {Spinach (Spinacia oleracea) [Ta 100.0
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 100.0
d1kbia1414 Flavocytochrome b2, C-terminal domain {Baker's yea 100.0
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 100.0
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 100.0
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 99.95
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 99.91
d1juba_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.89
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 99.89
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 99.87
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 99.86
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 99.85
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 99.85
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 99.84
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 99.82
d1ea0a2771 Alpha subunit of glutamate synthase, central and F 99.81
d2b4ga1312 Dihydroorotate dehydrogenase {Trypanosoma brucei [ 99.81
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 99.8
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 99.79
d1ofda2809 Alpha subunit of glutamate synthase, central and F 99.76
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 99.64
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 99.51
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.49
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 99.43
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 99.38
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 99.38
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 99.2
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 99.13
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 99.09
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 99.0
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 98.96
d1gwja_374 Morphinone reductase {Pseudomonas putida [TaxId: 3 98.96
d1icpa_364 12-oxophytodienoate reductase (OPR, OYE homolog) { 98.93
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 98.87
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 98.7
d1q45a_380 12-oxophytodienoate reductase (OPR, OYE homolog) { 98.67
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 98.63
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 98.62
d1oyaa_399 Old yellow enzyme (OYE) {Lager yeast (Saccharomyce 98.59
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 98.52
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 98.46
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 98.45
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 98.36
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 98.34
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 98.29
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 98.26
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 98.25
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 98.25
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 98.24
d1jvna1323 Cyclase subunit (or domain) of imidazoleglycerolph 98.19
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 98.13
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 98.1
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 98.07
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 98.05
d1vcva1226 Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro 98.02
d1znna1254 Pyridoxal biosynthesis lyase PdxS {Bacillus stearo 97.9
d1n7ka_234 Deoxyribose-phosphate aldolase DeoC {Archaeon Aero 97.88
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 97.86
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 97.83
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 97.76
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 97.73
d1vpxa_218 Decameric fructose-6-phosphate aldolase/transaldol 97.53
d1p1xa_250 Deoxyribose-phosphate aldolase DeoC {Escherichia c 97.45
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 97.42
d1qapa1167 Quinolinic acid phosphoribosyltransferase (Nicotin 97.41
d1h5ya_252 Cyclase subunit (or domain) of imidazoleglycerolph 97.35
d1hg3a_224 Triosephosphate isomerase {Archaeon Pyrococcus woe 97.35
d1qpoa1169 Quinolinic acid phosphoribosyltransferase (Nicotin 97.3
d1viza_229 PcrB protein homolog YerE {Bacillus subtilis [TaxI 97.28
d1thfd_253 Cyclase subunit (or domain) of imidazoleglycerolph 97.18
d1w0ma_226 Triosephosphate isomerase {Thermoproteus tenax [Ta 97.13
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 97.11
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 97.09
d1tqja_221 D-ribulose-5-phosphate 3-epimerase {Synechocystis 97.05
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 97.02
d1ka9f_251 Cyclase subunit (or domain) of imidazoleglycerolph 97.02
d2czda1206 Orotidine 5'-monophosphate decarboxylase (OMP deca 96.96
d1l6wa_220 Decameric fructose-6-phosphate aldolase/transaldol 96.93
d1vzwa1239 Phosphoribosylformimino-5-aminoimidazole carboxami 96.89
d1wx0a1211 Decameric fructose-6-phosphate aldolase/transaldol 96.87
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 96.82
d1o4ua1170 Quinolinic acid phosphoribosyltransferase (Nicotin 96.77
d2a4aa1256 Fructose-1,6-bisphosphate aldolase {Plasmodium yoe 96.59
d1jvna1 323 Cyclase subunit (or domain) of imidazoleglycerolph 96.43
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 96.42
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 96.11
d1tqxa_221 D-ribulose-5-phosphate 3-epimerase {Plasmodium fal 96.08
d1xxxa1 296 Dihydrodipicolinate synthase {Mycobacterium tuberc 96.03
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 95.95
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 95.87
d2f6ua1231 (S)-3-O-geranylgeranylglyceryl phosphate synthase 95.84
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 95.79
d2a6na1 292 Dihydrodipicolinate synthase {Escherichia coli [Ta 95.7
d1km4a_212 Orotidine 5'-monophosphate decarboxylase (OMP deca 95.61
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 95.56
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 95.55
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 95.51
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 95.45
d1eepa_ 388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 95.3
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 95.28
d1qo2a_241 Phosphoribosylformimino-5-aminoimidazole carboxami 95.23
d1zfja1 365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 94.91
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 94.47
d1vrda1 330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 94.43
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 94.38
d1hl2a_ 295 N-acetylneuraminate lyase {Escherichia coli [TaxId 94.37
d2chra1244 Chlormuconate cycloisomerase {Alcaligenes eutrophu 94.08
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 93.94
d1f74a_ 293 N-acetylneuraminate lyase {Haemophilus influenzae 93.91
d1jr1a1 378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 93.34
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 93.34
d1pvna1 362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 93.26
d1muca1242 Muconate-lactonizing enzyme {Pseudomonas putida [T 93.16
d1eixa_231 Orotidine 5'-monophosphate decarboxylase (OMP deca 92.82
d1tv5a1409 Dihydroorotate dehydrogenase {Plasmodium falciparu 92.42
d1vc4a_254 Indole-3-glycerophosphate synthase, IPGS {Thermus 92.02
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 91.73
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 91.65
d2mnra1227 Mandelate racemase {Pseudomonas putida [TaxId: 303 91.65
d1ea0a2 771 Alpha subunit of glutamate synthase, central and F 90.89
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 90.75
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 90.6
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 90.37
d1nu5a1243 Chlormuconate cycloisomerase {Pseudomonas sp. p51 90.18
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 90.15
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 89.84
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 89.61
d1muma_ 289 2-methylisocitrate lyase {Escherichia coli [TaxId: 89.46
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 89.39
d1tzza1247 Hypothetical protein Bll6730 {Bradyrhizobium japon 89.03
d1rvka1255 Hypothetical protein Atu3453 {Agrobacterium tumefa 89.02
d1s2wa_ 275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 88.97
d1f76a_336 Dihydroorotate dehydrogenase {Escherichia coli [Ta 88.95
d2cu0a1 368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 88.73
d1d3ga_367 Dihydroorotate dehydrogenase {Human (Homo sapiens) 88.43
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 88.1
d1yeya1252 RTS beta protein {Xanthomonas campestris pv. campe 88.05
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 87.99
d1dbta_237 Orotidine 5'-monophosphate decarboxylase (OMP deca 87.86
d1djqa1340 Trimethylamine dehydrogenase, N-terminal domain {M 87.84
d3bofa1260 Cobalamin-dependent methionine synthase MetH, C-te 87.78
d2gl5a1278 Putative dehydratase protein STM2273 {Salmonella t 87.7
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 87.45
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 87.33
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 87.17
d1wufa1244 N-acylamino acid racemase {Listeria innocua [TaxId 87.05
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 86.88
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 86.58
d1piia2254 Indole-3-glycerophosphate synthase, IPGS {Escheric 86.42
d1f6ya_262 Methyltetrahydrofolate: corrinoid/iron-sulfur prot 86.41
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 86.14
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 86.1
d1onra_316 Transaldolase {Escherichia coli [TaxId: 562]} 85.91
d1ofda2 809 Alpha subunit of glutamate synthase, central and F 85.84
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 85.77
d1a53a_247 Indole-3-glycerophosphate synthase, IPGS {Archaeon 85.67
d2zdra2280 Capsule biosynthesis protein SiaC, N-terminal doma 85.48
d1h1ya_220 D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sa 85.36
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 85.19
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 85.05
d1rpxa_230 D-ribulose-5-phosphate 3-epimerase {Potato (Solanu 84.63
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 84.53
d1i3ca_144 Response regulator for cyanobacterial phytochrome 84.49
d1v5xa_200 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 84.34
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 84.14
d1r0ma1243 N-acylamino acid racemase {Deinococcus radiodurans 84.03
d1ykwa1283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 83.73
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 83.73
d1vlia2295 Spore coat polysaccharide biosynthesis protein Sps 83.4
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 82.71
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 82.43
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 82.26
d1nsja_205 N-(5'phosphoribosyl)antranilate isomerase, PRAI {T 82.14
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 82.06
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 82.04
d1ep3a_311 Dihydroorotate dehydrogenase {Lactococcus lactis, 81.9
d1w3ia_ 293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 81.21
d2flia1217 D-ribulose-5-phosphate 3-epimerase {Streptococcus 80.98
d2basa1261 Hypothetical protein YkuI, N-terminal domain {Baci 80.68
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 80.51
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 80.4
d1izca_ 299 Macrophomate synthase {Macrophoma commelinae [TaxI 80.31
d1ajza_282 Dihydropteroate synthetase {Escherichia coli [TaxI 80.3
d1piia1198 N-(5'phosphoribosyl)antranilate isomerase, PRAI {E 80.26
d1q6oa_213 3-keto-L-gulonate 6-phosphate decarboxylase {Esche 80.18
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: FMN-linked oxidoreductases
family: FMN-linked oxidoreductases
domain: Hydroxyacid oxidase
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=5.7e-51  Score=380.15  Aligned_cols=289  Identities=47%  Similarity=0.769  Sum_probs=254.9

Q ss_pred             CceeecCcccCCceEeccccCcccCCCHHHHHHHHHHHHcCCceeecCCCCCCHHHHhccCC-CCceEEeeecCCchHHH
Q 021739            1 MTTTVLGFNISMPIMIAPTAFQKMAHPEGECATARAASAAGTIMTLSSWATSSVEEVSSTGP-GIRFFQLYVTKHRNVDA   79 (308)
Q Consensus         1 ~~t~~~g~~~~~Pi~iapm~~~~~~~~~~~~~~a~~a~~~g~~~~~s~~~~~~~e~i~~~~~-~~~~~Ql~~~~d~~~~~   79 (308)
                      |||+|||++++.||+|+||++++..++++|..++++|+++|+++++|++++.+.|++.+..+ ++.|+|+|.+.|.+...
T Consensus        59 lst~~lG~~l~~P~~Iapmtgg~~~~~~~~~~lA~aA~~~g~~~~~~s~s~~~~e~v~~~~~~~~~~~ql~~~~~~~~~~  138 (349)
T d1tb3a1          59 TRTTIQGQEISAPICISPTAFHSIAWPDGEKSTARAAQEANICYVISSYASYSLEDIVAAAPEGFRWFQLYMKSDWDFNK  138 (349)
T ss_dssp             CCEEETTEEESSSEEECCCSCGGGTCTTTHHHHHHHHHHHTCCEEECTTCSSCHHHHHHHSTTCCEEEECCCCSCTTHHH
T ss_pred             CceeECCcCccceEEEcchhcccccccchhhHHHHhhhhcccceeecccccccchhhhhhccCCCeeeeeecccCHHHHH
Confidence            78999999999999999999999999999999999999999999999999999999887665 48899999999999999


Q ss_pred             HHHHHHHHcCCcEEEEecCCCCCCcchHHhhhccCCCCccccccccccccccCCCCCCchhhhHhhhhcccccCHHHHHH
Q 021739           80 QLVKRAERAGFKAIALTVDTPRLGRREADIKNRFVLPPHLTLKNYEGLYIGKMDKTDDSGLASYVANQIDRSLNWKDVKW  159 (308)
Q Consensus        80 ~~~~~~~~~g~~~i~i~~~~p~~~~r~~~~~~~~~~p~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~i~~  159 (308)
                      +++++++++|++++.+++|.|+.++|++++|+.|..|..+.......     +...  ...........++.++|+.+++
T Consensus       139 ~~i~~~~~~g~~a~~~tvd~~~~~~~~~d~r~~~~~~~~~~~~~~~~-----~~~~--~~~~~~~~~~~~~~~~~~~i~~  211 (349)
T d1tb3a1         139 QMVQRAEALGFKALVITIDTPVLGNRRRDKRNQLNLEANILLKDLRA-----LKEE--KPTQSVPVSFPKASFCWNDLSL  211 (349)
T ss_dssp             HHHHHHHHHTCCCEEEECSCSSCCCCHHHHHTTCCCCC----CCSCC-----CCC---------------CCCCHHHHHH
T ss_pred             HHHHHHHhcCCcccccccCchhhcchhhhhhccccCCcccchhhhhh-----hhhc--cccccccccccCCCCCHHHHHH
Confidence            99999999999999999999999999999999999886544322211     1100  0000111112456788999999


Q ss_pred             HHHhcCCCEEEEecCCHHHHHHHHHcCCcEEEEecccccCCCCCcchHHHHHHHHHHccCCCeEEEecCCCCHHHHHHHH
Q 021739          160 LQTITSLPILVKGVLTAEDASLAIQYGAAGIIVSNHGARQLDYVPATVMALEEVVQAAKGRVPVFLDGGVRRGTDVFKAL  239 (308)
Q Consensus       160 ir~~~~~Pv~vK~~~~~e~a~~~~~~G~d~i~v~~~gg~~~~~~~~~~~~l~~i~~~~~~~ipvia~GGI~~~~d~~k~l  239 (308)
                      +|+.++.|+++|++.+.+++..+.++|+|+|.++||||+++++.+++.+.+.++++.+.+++|||+|||||++.|++|+|
T Consensus       212 l~~~~~~pii~Kgi~~~~da~~a~~~G~d~i~vsnhggr~~d~~~~~~~~l~~i~~~~~~~~~iiadGGIR~G~Dv~KAL  291 (349)
T d1tb3a1         212 LQSITRLPIILKGILTKEDAELAMKHNVQGIVVSNHGGRQLDEVSASIDALREVVAAVKGKIEVYMDGGVRTGTDVLKAL  291 (349)
T ss_dssp             HHTTCCSCEEEEEECSHHHHHHHHHTTCSEEEECCGGGTSSCSBCCHHHHHHHHHHHHTTSSEEEEESSCCSHHHHHHHH
T ss_pred             HHHhcCCCcccchhhhhHHHHHHHHhhccceeeeccccccccccccchhhcceeeeccCCCeeEEeccCcCcHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999888889999999999999999999


Q ss_pred             HcCCCEEEEchHHHHhcccCCHHHHHHHHHHHHHHHHHHHHHcCCCCHhhhccccee
Q 021739          240 ALGASGVFVGRPVPFSLAVDGEAGVRKVLQMLRDEFELTMALSGCRSLKEITRNHIV  296 (308)
Q Consensus       240 ~~GAd~V~ig~~~l~~~~~~G~~~v~~~i~~l~~~l~~~m~~~G~~~i~~l~~~~~~  296 (308)
                      ++||++|++|||++++++.+|+++|.++++.+++||+..|..+|+++++||+++.+.
T Consensus       292 ALGA~~V~igrp~L~~la~~G~~gv~~~l~~l~~EL~~~M~l~G~~~i~eL~~~~i~  348 (349)
T d1tb3a1         292 ALGARCIFLGRPILWGLACKGEDGVKEVLDILTAELHRCMTLSGCQSVAEISPDLIQ  348 (349)
T ss_dssp             HTTCSCEEESHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCSBGGGCCGGGBC
T ss_pred             HcCCCEEEEChHHHHHHHhccHHHHHHHHHHHHHHHHHHHHHhCCCCHHHcCHhhee
Confidence            999999999999999988899999999999999999999999999999999888764
>d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gwja_ c.1.4.1 (A:) Morphinone reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1icpa_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1q45a_ c.1.4.1 (A:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Thale cress (Arabidopsis thaliana), OPR3 [TaxId: 3702]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1oyaa_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1znna1 c.1.2.6 (A:18-271) Pyridoxal biosynthesis lyase PdxS {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vpxa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1qapa1 c.1.17.1 (A:130-296) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1h5ya_ c.1.2.1 (A:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1viza_ c.1.4.1 (A:) PcrB protein homolog YerE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1thfd_ c.1.2.1 (D:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w0ma_ c.1.1.1 (A:) Triosephosphate isomerase {Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tqja_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ka9f_ c.1.2.1 (F:) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2czda1 c.1.2.3 (A:1-206) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1l6wa_ c.1.10.1 (A:) Decameric fructose-6-phosphate aldolase/transaldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vzwa1 c.1.2.1 (A:2-240) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1wx0a1 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1jvna1 c.1.2.1 (A:230-552) Cyclase subunit (or domain) of imidazoleglycerolphosphate synthase HisF {Baker's yeast (Saccharomyces cerevisiae), His7 [TaxId: 4932]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tqxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2f6ua1 c.1.4.1 (A:1001-1231) (S)-3-O-geranylgeranylglyceryl phosphate synthase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1km4a_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qo2a_ c.1.2.1 (A:) Phosphoribosylformimino-5-aminoimidazole carboxamide ribotite isomerase HisA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2chra1 c.1.11.2 (A:127-370) Chlormuconate cycloisomerase {Alcaligenes eutrophus [TaxId: 106590]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1muca1 c.1.11.2 (A:131-372) Muconate-lactonizing enzyme {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1eixa_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vc4a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2mnra1 c.1.11.2 (A:133-359) Mandelate racemase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1nu5a1 c.1.11.2 (A:127-369) Chlormuconate cycloisomerase {Pseudomonas sp. p51 [TaxId: 65067]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1tzza1 c.1.11.2 (A:1146-1392) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yeya1 c.1.11.2 (A:184-435) RTS beta protein {Xanthomonas campestris pv. campestris [TaxId: 340]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1dbta_ c.1.2.3 (A:) Orotidine 5'-monophosphate decarboxylase (OMP decarboxylase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1djqa1 c.1.4.1 (A:1-340) Trimethylamine dehydrogenase, N-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d3bofa1 c.1.21.2 (A:301-560) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gl5a1 c.1.11.2 (A:123-400) Putative dehydratase protein STM2273 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wufa1 c.1.11.2 (A:1127-1370) N-acylamino acid racemase {Listeria innocua [TaxId: 1642]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1piia2 c.1.2.4 (A:1-254) Indole-3-glycerophosphate synthase, IPGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f6ya_ c.1.21.2 (A:) Methyltetrahydrofolate: corrinoid/iron-sulfur protein methyltransferase MetR {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onra_ c.1.10.1 (A:) Transaldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2zdra2 c.1.10.6 (A:2-281) Capsule biosynthesis protein SiaC, N-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1h1ya_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rpxa_ c.1.2.2 (A:) D-ribulose-5-phosphate 3-epimerase {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nsja_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2basa1 c.1.33.1 (A:2-262) Hypothetical protein YkuI, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1ajza_ c.1.21.1 (A:) Dihydropteroate synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piia1 c.1.2.4 (A:255-452) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q6oa_ c.1.2.3 (A:) 3-keto-L-gulonate 6-phosphate decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure