Citrus Sinensis ID: 021794


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MSINIVVAMAGLEVHHSSHQQFEPMSTSCKADEIFSTPSYSHLADREFLVTEESTNHNGSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG
cccEEEEccccHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccEEEcccccccccccccccccccccccccccEEEEEcccccccccccccccccccEEEccccccccccccccccccccccccccccccccEEccccccEEEccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccHHHHccEEEEEEcccccccEEcccccccccccccccEEccccc
ccHHHHHHHHHHHHHcccHHHccccccccccccccccccHHHHHHHccccccccccccccHHHccccccccccHHccccEEEEccccccEEEcccccccccccccccHHHcccccccccccHHHHcHHccHHHHHHHHHHcEccccccccccEccccccEEEcccccccEEccccccEEEEEcccccccEHccccccccccHHHHccccccEEEcccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccHHHcccEEEEEEccccccccEEEEEEEEEccccccccccEccc
MSINIVVAMAGLevhhsshqqfepmstsckadeifstpsyshladreflvteestnhngsteLLRKGFMEYGCQHYrrrcrirapccneifdcrhchneamnninvdqklrhdiprhevNQVQQVCVNCgvcmgeyfcescklfdddtskkqyhcdgcgicriggcdnffhcnkcrccysmllknshpcvegamhhdcpvccEYLFetrqdvivlpcghtIHKNCLKEMRehhqyacpicsksvcdMSKVWEKYDREiaatpmpeaylNKKVWILcndcgktsnVQFHVLAqkcpncksyntrltrg
MSINIVVAMAGLEVHHSSHQQFEPMSTSCKADEIFSTPSYSHLADREFLVTeestnhngstellrkgFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVlaqkcpncksyntrltrg
MSINIVVAMAGLEVHHSSHQQFEPMSTSCKADEIFSTPSYSHLADREFLVTEESTNHNGSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEvnqvqqvcvncgvcMGEYFCESCKLFDDDTSKKQYHcdgcgicriggcdNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG
****IVVAMAGL*****************************HLADREFLV**********TELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSY*******
****IVV**************************************************************EYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLT**
MSINIVVAMAGLEVHH***********SCKADEIFSTPSYSHLADREFLVTEESTNHNGSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKS********
*SINIVVAMAGLEVHHSS********************************************LLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTR****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSINIVVAMAGLEVHHSSHQQFEPMSTSCKADEIFSTPSYSHLADREFLVTEESTNHNGSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVQQVCVNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query307 2.2.26 [Sep-21-2011]
Q96PM5261 RING finger and CHY zinc yes no 0.765 0.900 0.454 4e-54
Q9CR50261 RING finger and CHY zinc yes no 0.729 0.858 0.437 3e-53
O14099425 Uncharacterized RING fing yes no 0.814 0.588 0.376 2e-44
Q8BGI1148 RING finger protein 24 OS no no 0.241 0.5 0.328 0.0005
Q9Y225148 RING finger protein 24 OS no no 0.241 0.5 0.328 0.0005
>sp|Q96PM5|ZN363_HUMAN RING finger and CHY zinc finger domain-containing protein 1 OS=Homo sapiens GN=RCHY1 PE=1 SV=1 Back     alignment and function desciption
 Score =  212 bits (539), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 142/240 (59%), Gaps = 5/240 (2%)

Query: 70  EYGCQHYRRRCRIRAPCCNEIFDCRHCH--NEAMNNINVDQKLRHDIPRHEVNQVQQVCV 127
           + GC+HY R C ++APCC++++ CR CH  NE         K    I   ++   QQ C 
Sbjct: 17  QRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCE 76

Query: 128 NCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSH 187
            C    GEY+C+ C LFD D  KKQYHC+ CGICRIG  ++FFHC KC  C +M L+  H
Sbjct: 77  ECSTLFGEYYCDICHLFDKD--KKQYHCENCGICRIGPKEDFFHCLKCNLCLAMNLQGRH 134

Query: 188 PCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDM 247
            C+E     +CP+C E +  +R    VLPCGH +H+ C +EM +   Y CP+C  S  DM
Sbjct: 135 KCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLK-EGYRCPLCMHSALDM 193

Query: 248 SKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG 307
           ++ W + D E+A TPMP  Y N  V ILCNDC   S VQFH+L  KC  C+SYNT    G
Sbjct: 194 TRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNTAQAGG 253




Mediates E3-dependent ubiquitination and proteasomal degradation of target proteins, including p53/TP53, HDAC1 and CDKN1B. Preferentially acts on tetrameric p53/TP53. Contributes to the regulation of CDKN1B and p53/TP53 levels, and thereby contributes to the regulation of the cell cycle progression. Increases AR transcription factor activity.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9CR50|ZN363_MOUSE RING finger and CHY zinc finger domain-containing protein 1 OS=Mus musculus GN=Rchy1 PE=1 SV=1 Back     alignment and function description
>sp|O14099|YERG_SCHPO Uncharacterized RING finger protein C2F3.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2F3.16 PE=4 SV=1 Back     alignment and function description
>sp|Q8BGI1|RNF24_MOUSE RING finger protein 24 OS=Mus musculus GN=Rnf24 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y225|RNF24_HUMAN RING finger protein 24 OS=Homo sapiens GN=RNF24 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
224092372300 predicted protein [Populus trichocarpa] 0.872 0.893 0.767 1e-122
225430120315 PREDICTED: RING finger and CHY zinc fing 0.973 0.949 0.695 1e-120
356563813308 PREDICTED: RING finger and CHY zinc fing 0.967 0.964 0.691 1e-120
356552549308 PREDICTED: RING finger and CHY zinc fing 0.967 0.964 0.701 1e-119
296081945294 unnamed protein product [Vitis vinifera] 0.859 0.897 0.761 1e-119
356552551323 PREDICTED: RING finger and CHY zinc fing 0.967 0.919 0.668 1e-118
356515508309 PREDICTED: RING finger and CHY zinc fing 0.957 0.951 0.678 1e-117
255635979309 unknown [Glycine max] 0.957 0.951 0.675 1e-117
449437104307 PREDICTED: RING finger and CHY zinc fing 0.931 0.931 0.678 1e-115
297808579308 zinc finger family protein [Arabidopsis 0.856 0.853 0.726 1e-113
>gi|224092372|ref|XP_002309580.1| predicted protein [Populus trichocarpa] gi|118485648|gb|ABK94674.1| unknown [Populus trichocarpa] gi|222855556|gb|EEE93103.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/280 (76%), Positives = 238/280 (85%), Gaps = 12/280 (4%)

Query: 39  SYSHLADREFLVTEESTNHNGSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHN 98
           S S   + +F+ +EES N   + ++L KG MEYGC HYRRRCRIRAPCCNE+FDCRHCHN
Sbjct: 22  SCSQHFNEDFIFSEESMNVE-TPQILDKGLMEYGCLHYRRRCRIRAPCCNEVFDCRHCHN 80

Query: 99  EAMNNINVDQKLRHDIPRHEVNQV-----------QQVCVNCGVCMGEYFCESCKLFDDD 147
           EA NNINVDQK RHD+PRHEV QV           QQVC+NCGVCMG+YFCE+CKLFDDD
Sbjct: 81  EAKNNINVDQKHRHDMPRHEVKQVICSLCGTEQEVQQVCINCGVCMGKYFCETCKLFDDD 140

Query: 148 TSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFE 207
           TSKKQYHCDGCGICRIGG +NFFHC KC CCYS LLKNSHPCVEGAMHHDCPVC E+LFE
Sbjct: 141 TSKKQYHCDGCGICRIGGPENFFHCYKCGCCYSNLLKNSHPCVEGAMHHDCPVCFEFLFE 200

Query: 208 TRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAY 267
           +R DV VLPCGHTIH++CLKEMR+H+QYACP+CSKSVCDMSKVWEK+D EIAATPMPE Y
Sbjct: 201 SRYDVTVLPCGHTIHESCLKEMRDHYQYACPLCSKSVCDMSKVWEKFDMEIAATPMPEPY 260

Query: 268 LNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNTRLTRG 307
           LNK VWILCNDCGK+S VQFHV+AQKC NCKSYNTR TR 
Sbjct: 261 LNKMVWILCNDCGKSSEVQFHVVAQKCMNCKSYNTRQTRS 300




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225430120|ref|XP_002284652.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1 [Vitis vinifera] gi|147785653|emb|CAN68688.1| hypothetical protein VITISV_029477 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356563813|ref|XP_003550153.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|356552549|ref|XP_003544629.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|296081945|emb|CBI20950.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356552551|ref|XP_003544630.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356515508|ref|XP_003526442.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|255635979|gb|ACU18335.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|449437104|ref|XP_004136332.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] gi|449505475|ref|XP_004162482.1| PREDICTED: RING finger and CHY zinc finger domain-containing protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297808579|ref|XP_002872173.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297318010|gb|EFH48432.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
TAIR|locus:2172656291 AT5G22920 [Arabidopsis thalian 0.830 0.876 0.531 5.6e-84
TAIR|locus:2179474328 AT5G25560 [Arabidopsis thalian 0.837 0.783 0.571 2.2e-82
TAIR|locus:2180074267 MIEL1 "MYB30-Interacting E3 Li 0.775 0.891 0.488 8.9e-70
TAIR|locus:2099212287 AT3G62970 [Arabidopsis thalian 0.765 0.818 0.459 1.6e-61
UNIPROTKB|J9NZR5259 RCHY1 "Uncharacterized protein 0.739 0.876 0.405 7.4e-50
UNIPROTKB|Q96PM5261 RCHY1 "RING finger and CHY zin 0.755 0.888 0.401 9.5e-50
RGD|1359180261 Rchy1 "ring finger and CHY zin 0.755 0.888 0.401 1.2e-49
UNIPROTKB|A4IFE2261 RCHY1 "RCHY1 protein" [Bos tau 0.739 0.869 0.405 1.5e-49
MGI|MGI:1915348261 Rchy1 "ring finger and CHY zin 0.755 0.888 0.393 1.1e-48
ZFIN|ZDB-GENE-040801-73264 rchy1 "ring finger and CHY zin 0.739 0.859 0.391 2.3e-46
TAIR|locus:2172656 AT5G22920 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 841 (301.1 bits), Expect = 5.6e-84, P = 5.6e-84
 Identities = 142/267 (53%), Positives = 181/267 (67%)

Query:    53 ESTNHNGSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRH 112
             E+  +     L+  G   YGC HYRRRC+IRAPCC+EIFDCRHCHNEA ++++++Q  RH
Sbjct:     7 ENEQNQEFANLMEIGSGHYGCSHYRRRCKIRAPCCDEIFDCRHCHNEAKDSLHIEQHHRH 66

Query:   113 DIPRHEXXXXXXXXXXXXXX-----------MGEYFCESCKLFDDDTSKKQYHXXXXXXX 161
             ++PRHE                         MG+YFC  CK FDDD SKKQYH       
Sbjct:    67 ELPRHEVSKVICSLCETEQDVQQNCSNCGVCMGKYFCSKCKFFDDDLSKKQYHCDECGIC 126

Query:   162 XXXXXXNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFETRQDVIVLPCGHTI 221
                   NFFHC +CRCCYS ++++ H CVEGAMHH+CPVC EYLF++ +D+ VL CGHT+
Sbjct:   127 RTGGEENFFHCKRCRCCYSKIMEDKHQCVEGAMHHNCPVCFEYLFDSTRDITVLRCGHTM 186

Query:   222 HKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGK 281
             H  C K+M  H++Y CP+CSKS+CDMS +W+K D E+AA PMP+ Y NK VWILCNDCG 
Sbjct:   187 HLECTKDMGLHNRYTCPVCSKSICDMSNLWKKLDEEVAAYPMPKMYENKMVWILCNDCGS 246

Query:   282 TSNVQFHVLAQKCPNCKSYNTRLT-RG 307
              +NV+FH++A KC +C SYNTR T RG
Sbjct:   247 NTNVRFHLIAHKCSSCGSYNTRQTQRG 273




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2179474 AT5G25560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2180074 MIEL1 "MYB30-Interacting E3 Ligase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2099212 AT3G62970 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZR5 RCHY1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96PM5 RCHY1 "RING finger and CHY zinc finger domain-containing protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1359180 Rchy1 "ring finger and CHY zinc finger domain containing 1, E3 ubiquitin protein ligase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A4IFE2 RCHY1 "RCHY1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915348 Rchy1 "ring finger and CHY zinc finger domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-73 rchy1 "ring finger and CHY zinc finger domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
pfam0549574 pfam05495, zf-CHY, CHY zinc finger 2e-11
cd0016245 cd00162, RING, RING-finger (Really Interesting New 6e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 7e-05
COG5243491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 9e-05
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 3e-04
smart0018440 smart00184, RING, Ring finger 3e-04
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 0.002
>gnl|CDD|218608 pfam05495, zf-CHY, CHY zinc finger Back     alignment and domain information
 Score = 58.5 bits (142), Expect = 2e-11
 Identities = 33/83 (39%), Positives = 41/83 (49%), Gaps = 19/83 (22%)

Query: 73  CQHYRRR-CRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQVQ-QVC---- 126
           C+HY R  C IRAPCCN+ + CR CH+E  +         H + R  V  V   VC    
Sbjct: 1   CKHYHRNLCAIRAPCCNKYYPCRLCHDELED---------HPLDRWNVKAVLCGVCRTEQ 51

Query: 127 ----VNCGVCMGEYFCESCKLFD 145
                NCGV   +Y+C  CKLF 
Sbjct: 52  TVQEYNCGVEFADYYCPICKLFF 74


This family of domains are likely to bind to zinc ions. They contain many conserved cysteine and histidine residues. We have named this domain after the N-terminal motif CXHY. This domain can be found in isolation in some proteins, but is also often associated with pfam00097. One of the proteins in this family is a mitochondrial intermembrane space protein called Hot13. This protein is involved in the assembly of small TIM complexes. Length = 74

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 307
KOG1940276 consensus Zn-finger protein [General function pred 100.0
PF1459961 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A. 99.93
PF0549571 zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc 99.68
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.3
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.16
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.96
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.94
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.91
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.83
PHA02929238 N1R/p28-like protein; Provisional 98.75
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.75
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.71
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.7
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.68
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.64
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.62
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.59
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.58
PF1463444 zf-RING_5: zinc-RING finger domain 98.57
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.51
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.5
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.31
PHA02926242 zinc finger-like protein; Provisional 98.29
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.24
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.08
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.06
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.03
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 97.87
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.84
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 97.82
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.78
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 97.75
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.71
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.65
COG4357105 Zinc finger domain containing protein (CHY type) [ 97.58
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.54
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 97.42
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.35
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.2
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.08
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.79
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 96.76
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.69
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.57
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 96.56
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 96.55
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 96.54
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.47
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 96.42
KOG1941518 consensus Acetylcholine receptor-associated protei 96.27
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.22
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.0
COG52191525 Uncharacterized conserved protein, contains RING Z 95.92
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 95.73
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 95.65
KOG0825 1134 consensus PHD Zn-finger protein [General function 95.54
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 95.45
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 95.44
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 94.63
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.55
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 94.49
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 94.42
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 93.98
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 93.88
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.78
KOG0297 391 consensus TNF receptor-associated factor [Signal t 93.6
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 93.6
KOG4445 368 consensus Uncharacterized conserved protein, conta 93.31
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 93.29
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 92.84
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 92.65
PF04641260 Rtf2: Rtf2 RING-finger 91.77
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 91.73
KOG3002 299 consensus Zn finger protein [General function pred 91.54
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 91.37
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 91.04
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 90.67
TIGR00100115 hypA hydrogenase nickel insertion protein HypA. In 90.43
PRK03824135 hypA hydrogenase nickel incorporation protein; Pro 89.77
COG5236 493 Uncharacterized conserved protein, contains RING Z 89.62
COG5152259 Uncharacterized conserved protein, contains RING a 89.36
PRK00564117 hypA hydrogenase nickel incorporation protein; Pro 89.26
PHA02862156 5L protein; Provisional 89.22
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 88.39
KOG1002 791 consensus Nucleotide excision repair protein RAD16 88.34
PHA02825162 LAP/PHD finger-like protein; Provisional 88.31
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 88.22
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 88.09
PRK12380113 hydrogenase nickel incorporation protein HybF; Pro 88.06
PRK03681114 hypA hydrogenase nickel incorporation protein; Val 87.7
KOG3039303 consensus Uncharacterized conserved protein [Funct 87.69
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 87.31
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 87.17
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 87.0
KOG2660 331 consensus Locus-specific chromosome binding protei 86.68
PF01155113 HypA: Hydrogenase expression/synthesis hypA family 86.01
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 85.65
KOG4739 233 consensus Uncharacterized protein involved in syna 84.68
KOG03091081 consensus Conserved WD40 repeat-containing protein 83.41
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 82.96
COG5222427 Uncharacterized conserved protein, contains RING Z 82.69
PRK00762124 hypA hydrogenase nickel incorporation protein; Pro 82.59
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 81.82
PHA03096284 p28-like protein; Provisional 80.47
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 80.29
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=6.8e-65  Score=476.02  Aligned_cols=236  Identities=53%  Similarity=1.070  Sum_probs=227.7

Q ss_pred             CCchhcccCCCcCCCcccccCceeEcCccCCeecCCccccccccCcCcCCcCCcccCcccccc-----------cccccc
Q 021794           59 GSTELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQ-----------VQQVCV  127 (307)
Q Consensus        59 ~~~~~~~~~~~~~GC~HY~R~Cki~aPCC~~~y~CR~CHde~~~~~~~~~~~~H~l~R~~v~e-----------v~~~C~  127 (307)
                      .+.++.|++.+.+||+||+|+|++++|||++||+||+||+++         ++|.++|+.|.+           +++.|.
T Consensus        21 ~~~~~~d~~~~~~~c~hy~r~~~~~a~ccd~~~~C~hCH~~s---------~~h~~~r~~v~~~~C~~C~~~q~~~~~c~   91 (276)
T KOG1940|consen   21 IHSDAEDEIAFPYGCPHYRRNCKSRAPCCDREITCRHCHNES---------EDHDLDRKTVYELLCMKCRKIQPVGQICS   91 (276)
T ss_pred             cccccccccccccCCchhhhccccccccccceeeeEEecChh---------hhcccchhhhhhhhhhhHHhhhhhhhccc
Confidence            345788999999999999999999999999999999999987         489999998876           789999


Q ss_pred             cCCcccceeecCccccccCCCCCCccccCCCCcccccCCcceeeccCCCcceeccccCCccccCCCCCCCCccccccccc
Q 021794          128 NCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHHDCPVCCEYLFE  207 (307)
Q Consensus       128 nCg~~f~~YfC~~Ckl~ddd~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~CiE~~~~~~CPIClE~lf~  207 (307)
                      +|+..||+|||.+|+||||+++ .||||+.|||||+|++++||||++|+.|++..+.+.|+|+|++++.+||||.|++|+
T Consensus        92 ~c~~~~g~~~c~~C~l~dd~~~-~~~hC~~C~icr~g~~~~~fhc~~c~~c~~~~~~~~H~c~e~~~~~ncPic~e~l~~  170 (276)
T KOG1940|consen   92 NCHVELGEYYCLICKLFDDDPS-KQYHCDLCGICREGLGLDFFHCKKCKACLSAYLSNWHKCVERSSEFNCPICKEYLFL  170 (276)
T ss_pred             cchhhhhhhcCccccccccccc-ceeccccccccccccccchhHHhhhHhHHhhhcccccchhhhcccCCCchhHHHhcc
Confidence            9999999999999999999999 999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcceeEEcCCCCcccHHHHHHHHhcCCCCCCCCCcccCchhHHHHHhHHHHhcCCCChhhhcCceeEEcCCCCCCccccc
Q 021794          208 TRQDVIVLPCGHTIHKNCLKEMREHHQYACPICSKSVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQF  287 (307)
Q Consensus       208 s~~~v~~LpCGH~fH~~Cl~~wl~~~~~~CPiCrks~~dm~~~~~~lD~eia~~pmPeey~~~~~~IlCnDC~~~s~~~f  287 (307)
                      +...+..|+|||++|..|++++...+ |+||+|.+ +.||+.+|+++|.+|+++|||++|.+++++|+||||+..++++|
T Consensus       171 s~~~~~~~~CgH~~h~~cf~e~~~~~-y~CP~C~~-~~d~~~~~~~~d~~l~~~~~p~~y~~~~~~i~cndC~~~~~~k~  248 (276)
T KOG1940|consen  171 SFEDAGVLKCGHYMHSRCFEEMICEG-YTCPICSK-PGDMSHYFRKLDKELAGSPMPEEYKNKTQDILCNDCGSGTNVKY  248 (276)
T ss_pred             ccccCCccCcccchHHHHHHHHhccC-CCCCcccc-hHHHHHHHHHHHHHHhcCCCCchhhchhheeeccCCCCCCccce
Confidence            99999999999999999999999876 99999999 99999999999999999999999999999999999999999999


Q ss_pred             eeeeccCCCCCCccccccC
Q 021794          288 HVLAQKCPNCKSYNTRLTR  306 (307)
Q Consensus       288 H~lg~kC~~C~SYNT~~~~  306 (307)
                      |||++||+.|+|||||+++
T Consensus       249 ~~l~~kc~~c~~~~~r~~~  267 (276)
T KOG1940|consen  249 HILYHKCGKCGSYNTRMIS  267 (276)
T ss_pred             ehhhhhCCCcccceeeecc
Confidence            9999999999999999985



>PF14599 zinc_ribbon_6: Zinc-ribbon; PDB: 2K2D_A Back     alignment and domain information
>PF05495 zf-CHY: CHY zinc finger; InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00100 hypA hydrogenase nickel insertion protein HypA Back     alignment and domain information
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional Back     alignment and domain information
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PF01155 HypA: Hydrogenase expression/synthesis hypA family; InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
2k2d_A79 Solution Nmr Structure Of C-Terminal Domain Of Huma 3e-14
2k2c_A137 Solution Nmr Structure Of N-Terminal Domain Of Huma 7e-12
2dkt_A143 Solution Structure Of The Chy Zinc Finger Domain Of 9e-12
2ecm_A55 Solution Structure Of The Ring Domain Of The Ring F 1e-04
2jrj_A52 Solution Structure Of The Human Pirh2 Ring-H2 Domai 2e-04
>pdb|2K2D|A Chain A, Solution Nmr Structure Of C-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2c Length = 79 Back     alignment and structure

Iteration: 1

Score = 75.9 bits (185), Expect = 3e-14, Method: Compositional matrix adjust. Identities = 34/65 (52%), Positives = 40/65 (61%) Query: 243 SVCDMSKVWEKYDREIAATPMPEAYLNKKVWILCNDCGKTSNVQFHVLAQKCPNCKSYNT 302 S DM++ W + D E+A TPMP Y N V ILCNDC S VQFH+L KC C+SYNT Sbjct: 7 SALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKCKICESYNT 66 Query: 303 RLTRG 307 G Sbjct: 67 AQAGG 71
>pdb|2K2C|A Chain A, Solution Nmr Structure Of N-Terminal Domain Of Human Pirh2. Northeast Structural Genomics Consortium (Nesg) Target Ht2a Length = 137 Back     alignment and structure
>pdb|2DKT|A Chain A, Solution Structure Of The Chy Zinc Finger Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 143 Back     alignment and structure
>pdb|2ECM|A Chain A, Solution Structure Of The Ring Domain Of The Ring Finger And Chy Zinc Finger Domain-Containing Protein 1 From Mus Musculus Length = 55 Back     alignment and structure
>pdb|2JRJ|A Chain A, Solution Structure Of The Human Pirh2 Ring-H2 Domain. Northeast Structural Genomics Consortium Target Ht2b Length = 52 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
2dkt_A143 Ring finger and CHY zinc finger domain- containing 1e-34
2k2d_A79 Ring finger and CHY zinc finger domain- containing 3e-29
2ecm_A55 Ring finger and CHY zinc finger domain- containing 8e-15
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-06
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 1e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 1e-05
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 3e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 4e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-04
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 7e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 7e-04
>2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A Length = 143 Back     alignment and structure
 Score =  122 bits (306), Expect = 1e-34
 Identities = 51/129 (39%), Positives = 75/129 (58%), Gaps = 4/129 (3%)

Query: 69  MEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRH--EVNQVQQVC 126
              GC+HY R C ++APCC++++ CR CH+   ++     K++     +  ++   QQ C
Sbjct: 15  GPRGCEHYDRACLLKAPCCDKLYTCRLCHDTNEDHQLDRFKVKEVQCINCEKLQHAQQTC 74

Query: 127 VNCGVCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNS 186
            +C    GEY+C  C LFD D  K+QYHC+ CGICRIG  ++FFHC KC  C +  L+  
Sbjct: 75  EDCSTLFGEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGK 132

Query: 187 HPCVEGAMH 195
           H C+E    
Sbjct: 133 HKCIESGPS 141


>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
2dkt_A143 Ring finger and CHY zinc finger domain- containing 100.0
2k2d_A79 Ring finger and CHY zinc finger domain- containing 99.93
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.36
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.33
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.27
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.26
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.26
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.24
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.21
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.2
2ect_A78 Ring finger protein 126; metal binding protein, st 99.19
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.17
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.17
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.16
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.14
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.11
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.09
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.07
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.05
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.05
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.05
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.01
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.0
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.0
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 98.97
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.97
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 98.97
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.95
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.94
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.93
2ecw_A85 Tripartite motif-containing protein 30; metal bind 98.9
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.89
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.89
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.87
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.87
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.86
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.86
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.86
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.84
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.84
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.83
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.82
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.82
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.77
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.76
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.75
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.61
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.6
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.6
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.57
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.57
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.54
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.53
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.53
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.5
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.5
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.47
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.45
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.4
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.4
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.34
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.33
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.3
2ea5_A68 Cell growth regulator with ring finger domain prot 98.25
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.18
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.17
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.96
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 97.95
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.79
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.51
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.5
3nw0_A238 Non-structural maintenance of chromosomes element 96.02
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 91.76
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 90.62
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 88.59
3a43_A139 HYPD, hydrogenase nickel incorporation protein HYP 87.81
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 86.61
2kdx_A119 HYPA, hydrogenase/urease nickel incorporation prot 83.08
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 80.07
>2dkt_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.89.1.1 g.93.1.1 PDB: 2k2c_A Back     alignment and structure
Probab=100.00  E-value=1.3e-49  Score=340.86  Aligned_cols=124  Identities=42%  Similarity=1.059  Sum_probs=115.7

Q ss_pred             hhcccCCCcCCCcccccCceeEcCccCCeecCCccccccccCcCcCCcCCcccCcccccc-----------cccccccCC
Q 021794           62 ELLRKGFMEYGCQHYRRRCRIRAPCCNEIFDCRHCHNEAMNNINVDQKLRHDIPRHEVNQ-----------VQQVCVNCG  130 (307)
Q Consensus        62 ~~~~~~~~~~GC~HY~R~Cki~aPCC~~~y~CR~CHde~~~~~~~~~~~~H~l~R~~v~e-----------v~~~C~nCg  130 (307)
                      ..+|++.+++||+||+|+|+|+||||++|||||+||||+         ++|+|+|+++++           +++.|++||
T Consensus         8 ~~~~~~~~~~gC~HY~r~~~lr~pCC~k~y~Cr~CHde~---------~dH~l~r~~~~~vlCg~C~~~q~~~~~C~~Cg   78 (143)
T 2dkt_A            8 GVRNLAQGPRGCEHYDRACLLKAPCCDKLYTCRLCHDTN---------EDHQLDRFKVKEVQCINCEKLQHAQQTCEDCS   78 (143)
T ss_dssp             CCCCCCCCSSSCSSCCCSEEEEETTTTEEESSHHHHHHT---------SSSCCCSSSCCCEEESSSCCEECSCSBCSSSC
T ss_pred             cccccccCcCCCcccCCCeeEECCCCCCccchhhhhccc---------cccccchhccceeeecccCccccccCcCCCCC
Confidence            455778889999999999999999999999999999996         479999988865           789999999


Q ss_pred             cccceeecCccccccCCCCCCccccCCCCcccccCCcceeeccCCCcceeccccCCccccCCCCCC
Q 021794          131 VCMGEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVEGAMHH  196 (307)
Q Consensus       131 ~~f~~YfC~~Ckl~ddd~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~CiE~~~~~  196 (307)
                      +.||+|||+||||||  ++|+||||++|||||+|++++||||++||+|||++|+++|+|+|+++++
T Consensus        79 ~~f~~Y~C~~C~l~d--~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~C~e~~~~s  142 (143)
T 2dkt_A           79 TLFGEYYCSICHLFD--KDKRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIESGPSS  142 (143)
T ss_dssp             CBSCSEECSSSCCEE--CSSSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSCCCSCC
T ss_pred             ccceeeEeceeeccc--CCCceecCCCCCceeccCCcCcEECCcCCeeeccccCcCcccCccCccC
Confidence            999999999999996  4699999999999999999999999999999999999999999998864



>2k2d_A Ring finger and CHY zinc finger domain- containing protein 1; zinc-binding protein, cytoplasm, metal-binding, nucleus, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3a43_A HYPD, hydrogenase nickel incorporation protein HYPA; [NIFE] hydrogenase maturation, zinc-finger, nickel binding, metal-binding; HET: FME; 2.30A {Pyrococcus kodakaraensis} PDB: 3a44_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kdx_A HYPA, hydrogenase/urease nickel incorporation protein HYPA; metallochaperone, metal-binding, metal- binding protein; NMR {Helicobacter pylori} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 307
d2dkta256 g.93.1.1 (A:82-137) RING finger and CHY zinc finge 1e-20
d2dkta174 g.89.1.1 (A:8-81) RING finger and CHY zinc finger 2e-06
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 7e-05
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 6e-04
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.001
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 0.003
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 0.003
>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: Zinc hairpin stack
superfamily: Zinc hairpin stack
family: Zinc hairpin stack
domain: RING finger and CHY zinc finger domain-containing protein 1
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 81.3 bits (201), Expect = 1e-20
 Identities = 32/58 (55%), Positives = 40/58 (68%), Gaps = 2/58 (3%)

Query: 134 GEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVE 191
           GEY+C  C LFD D  K+QYHC+ CGICRIG  ++FFHC KC  C +  L+  H C+E
Sbjct: 1   GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE 56


>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
d2dkta256 RING finger and CHY zinc finger domain-containing 99.95
d2dkta174 RING finger and CHY zinc finger domain-containing 99.46
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.39
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.31
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.3
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.25
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.19
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.19
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.15
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.98
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.91
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.87
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.79
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.77
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.75
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.73
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.71
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.31
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.15
d2jnea171 Hypothetical protein YfgJ {Escherichia coli [TaxId 86.14
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 83.24
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 80.62
>d2dkta2 g.93.1.1 (A:82-137) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Zinc hairpin stack
superfamily: Zinc hairpin stack
family: Zinc hairpin stack
domain: RING finger and CHY zinc finger domain-containing protein 1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.95  E-value=5e-30  Score=185.64  Aligned_cols=56  Identities=57%  Similarity=1.394  Sum_probs=54.1

Q ss_pred             ceeecCccccccCCCCCCccccCCCCcccccCCcceeeccCCCcceeccccCCccccC
Q 021794          134 GEYFCESCKLFDDDTSKKQYHCDGCGICRIGGCDNFFHCNKCRCCYSMLLKNSHPCVE  191 (307)
Q Consensus       134 ~~YfC~~Ckl~ddd~~k~~yHC~~CgiCR~G~~~~ffHC~~C~~C~s~~l~~~H~CiE  191 (307)
                      |+|||+||||||||  |+||||++|||||||++++||||++|++||+++|+++|+|+|
T Consensus         1 G~YfC~iC~l~ddd--k~~yHC~~CgiCRvG~~~~ffHC~~C~~C~~~~l~~~H~CiE   56 (56)
T d2dkta2           1 GEYYCSICHLFDKD--KRQYHCESCGICRIGPKEDFFHCLKCNLCLTTNLRGKHKCIE   56 (56)
T ss_dssp             CSEECSSSCCEECS--SSEEEETTTTEEEESCGGGEEEETTTTEEEEGGGSSSSCCSC
T ss_pred             CceECCcCCcccCC--CCcccCCCCCceeecCCccccccCccccccCcccCCCccccC
Confidence            78999999999885  999999999999999999999999999999999999999997



>d2dkta1 g.89.1.1 (A:8-81) RING finger and CHY zinc finger domain-containing protein 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jnea1 g.41.18.1 (A:1-71) Hypothetical protein YfgJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure