Citrus Sinensis ID: 021837

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
MAFGTFHGRGHRLIACDMEDVQLNTNWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGVSPPSTSEVNSAANTQPMVSEDSCRPACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELRKHAQLEHPHSRPSKIDPARQLDWENFQQSSEIIDVLSTIHSEVPRGVVLGDYVIEYGDDETGDEFEDFPGDEGNWWTSCILYQVFDNLRNARNRRRSRVSDTRRGSRRSSYDTSNSDEGSVTSVDFAEYRIDETDDEFVSTSGPSRGSSSHRRLVVFISM
cccccccccccccccccccHHHHccccccccccccccccccEEEEEEccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccEEEcHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEccccccccccccccccccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEc
cccccccccccccccccccHHHHHccHHccccccEccccccEEEEEEccccccccccEccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHcccccccccccEcccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcEEEEccccccccccccccccccccHHHHHHHHHHccccccHHHHHHHHcccccccccccccccccccccccEEccccEEEccccccEEEEcccccccccccEEEEEEEc
mafgtfhgrghrliacdmedvqlntnwddvtcpicldfphngVLLLCSsyekgcrpfvcdtdhlhsncldrfknaygvsppstsevnsaantqpmvsedscrpacplcrgevtgwVVADKVRDYLNEKKrcceedqctfAGTYLELRKHaqlehphsrpskidparqldwenfQQSSEIIDVLSTIhsevprgvvlGDYVieygddetgdefedfpgdegnwwTSCILYQVFDNLRNArnrrrsrvsdtrrgsrrssydtsnsdegsvtsvdfaeyridetddefvstsgpsrgssshrrLVVFISM
mafgtfhgrghrlIACDMEDVQLNTNWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGVSPPSTSEVNSAANTQPMVSEDSCRPACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELRKHAQLEHPHSRPSKIDPARQLDWENFQQSSEIIDVLSTIHSEVPRGVVLGDYVIEYGDDETGDEFEDFPGDEGNWWTSCILYQVFdnlrnarnrrrsrvsdtrrgsrrssydtsnsdegsvtsvdFAEYRIDETddefvstsgpsrgssshrrlvvfism
MAFGTFHGRGHRLIACDMEDVQLNTNWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGVSPPSTSEVNSAANTQPMVSEDSCRPACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELRKHAQLEHPHSRPSKIDPARQLDWENFQQSSEIIDVLSTIHSEVPRGVVLGDYVIeygddetgdefedfpgdegNWWTSCILYQVFDnlrnarnrrrsrvsdtrrgsrrssYDTSNSDEGSVTSVDFAEYRIDETDDEFVstsgpsrgssshrrLVVFISM
****TFHGRGHRLIACDMEDVQLNTNWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYG***********************CRPACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELRK********************DWENFQQSSEIIDVLSTIHSEVPRGVVLGDYVIEYGDDETGDEFEDFPGDEGNWWTSCILYQVFDNLR***********************************************************************
*************************NWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNC***********************************ACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELRKHAQLEHPHSRPSKIDPARQLDWENFQQSSEIIDVLSTIHSEVPRGVVLGDYVI****************DEGNWWTSCILY***********************************************************************LVVFISM
********RGHRLIACDMEDVQLNTNWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGVS**********************RPACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELRKH************IDPARQLDWENFQQSSEIIDVLSTIHSEVPRGVVLGDYVIEYGDDETGDEFEDFPGDEGNWWTSCILYQVFDNLRNARN***************************VTSVDFAEYRIDETD***************HRRLVVFISM
***************CDMEDVQLNTNWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYG***********************CRPACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELRKHAQLEHPHSRPSKIDPARQLDWENFQQSSEIIDVLSTIHSEVPRGVVLGDYVIEYGDDET**E*EDFPGDEGNWWTSCILYQVFDNL*******************************SVTSVDFAEYRIDETDDEFVSTSGPSRGSSSHRRLVVFISM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFGTFHGRGHRLIACDMEDVQLNTNWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGVSPPSTSEVNSAANTQPMVSEDSCRPACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELRKHAQLEHPHSRPSKIDPARQLDWENFQQSSEIIDVLSTIHSEVPRGVVLGDYVIEYGDDETGDEFEDFPGDEGNWWTSCILYQVFDNLRNARNRRRSRVSDTRRGSRRSSYDTSNSDEGSVTSVDFAEYRIDETDDEFVSTSGPSRGSSSHRRLVVFISM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
255574097311 conserved hypothetical protein [Ricinus 0.947 0.935 0.790 1e-128
224121368311 predicted protein [Populus trichocarpa] 0.928 0.916 0.785 1e-126
224142095301 predicted protein [Populus trichocarpa] 0.977 0.996 0.783 1e-126
147794347325 hypothetical protein VITISV_027108 [Viti 0.996 0.941 0.765 1e-125
225429789321 PREDICTED: uncharacterized protein LOC10 0.928 0.887 0.784 1e-125
296081768292 unnamed protein product [Vitis vinifera] 0.869 0.914 0.776 1e-121
449441984294 PREDICTED: uncharacterized protein LOC10 0.885 0.925 0.761 1e-114
2827536380 hypothetical protein [Arabidopsis thalia 0.957 0.773 0.712 1e-109
297802886307 hypothetical protein ARALYDRAFT_491599 [ 0.895 0.895 0.744 1e-108
18417801308 uncharacterized protein [Arabidopsis tha 0.954 0.951 0.711 1e-107
>gi|255574097|ref|XP_002527964.1| conserved hypothetical protein [Ricinus communis] gi|223532590|gb|EEF34376.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 230/291 (79%), Positives = 256/291 (87%)

Query: 1   MAFGTFHGRGHRLIACDMEDVQLNTNWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCD 60
           MAF  ++       + +ME++QLNTNW++V CPICLDFPHN VLL CSSYEKGCRPFVCD
Sbjct: 1   MAFEPYYKGVPEASSFNMEEIQLNTNWEEVVCPICLDFPHNSVLLQCSSYEKGCRPFVCD 60

Query: 61  TDHLHSNCLDRFKNAYGVSPPSTSEVNSAANTQPMVSEDSCRPACPLCRGEVTGWVVADK 120
           TDHLHSNCLDRFK+A G+S PSTS+  + ANTQ  V + + R ACPLCRGEV+GWV  +K
Sbjct: 61  TDHLHSNCLDRFKSASGMSSPSTSDATTTANTQHSVVDGNSRLACPLCRGEVSGWVAIEK 120

Query: 121 VRDYLNEKKRCCEEDQCTFAGTYLELRKHAQLEHPHSRPSKIDPARQLDWENFQQSSEII 180
            R +L+EKKRCCEE+QCTF GTYLEL KHAQLEHPH+RPSKIDPARQLDWENFQQSSEII
Sbjct: 121 ARVHLDEKKRCCEEEQCTFTGTYLELCKHAQLEHPHARPSKIDPARQLDWENFQQSSEII 180

Query: 181 DVLSTIHSEVPRGVVLGDYVIEYGDDETGDEFEDFPGDEGNWWTSCILYQVFDNLRNARN 240
           DVLSTIHSEVPRGVVLGDYVIEYGDD+T DEFEDFPGDEGNWWTSCILYQVFDN RN+RN
Sbjct: 181 DVLSTIHSEVPRGVVLGDYVIEYGDDDTVDEFEDFPGDEGNWWTSCILYQVFDNFRNSRN 240

Query: 241 RRRSRVSDTRRGSRRSSYDTSNSDEGSVTSVDFAEYRIDETDDEFVSTSGP 291
           RRRSRV+DTRRGSRR SYD SNSDEGSVTSV+FAEYR+DETDDEF ST+GP
Sbjct: 241 RRRSRVTDTRRGSRRMSYDNSNSDEGSVTSVEFAEYRLDETDDEFASTTGP 291

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224121368|ref|XP_002330810.1| predicted protein [Populus trichocarpa] gi|222872612|gb|EEF09743.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224142095|ref|XP_002324394.1| predicted protein [Populus trichocarpa] gi|222865828|gb|EEF02959.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147794347|emb|CAN62770.1| hypothetical protein VITISV_027108 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225429789|ref|XP_002282756.1| PREDICTED: uncharacterized protein LOC100250872 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296081768|emb|CBI20773.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449441984|ref|XP_004138762.1| PREDICTED: uncharacterized protein LOC101205331 [Cucumis sativus] gi|449499550|ref|XP_004160846.1| PREDICTED: uncharacterized protein LOC101225456 [Cucumis sativus] Back     alignment and taxonomy information
>gi|2827536|emb|CAA16544.1| hypothetical protein [Arabidopsis thaliana] gi|7270044|emb|CAB79859.1| hypothetical protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297802886|ref|XP_002869327.1| hypothetical protein ARALYDRAFT_491599 [Arabidopsis lyrata subsp. lyrata] gi|297315163|gb|EFH45586.1| hypothetical protein ARALYDRAFT_491599 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18417801|ref|NP_567874.1| uncharacterized protein [Arabidopsis thaliana] gi|30689026|ref|NP_849480.1| uncharacterized protein [Arabidopsis thaliana] gi|18650602|gb|AAL75901.1| AT4g31410/F8F16_230 [Arabidopsis thaliana] gi|20453261|gb|AAM19869.1| AT4g31410/F8F16_230 [Arabidopsis thaliana] gi|21553568|gb|AAM62661.1| unknown [Arabidopsis thaliana] gi|222423192|dbj|BAH19573.1| AT4G31410 [Arabidopsis thaliana] gi|332660506|gb|AEE85906.1| uncharacterized protein [Arabidopsis thaliana] gi|332660507|gb|AEE85907.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
TAIR|locus:2128146308 AT4G31410 "AT4G31410" [Arabido 0.853 0.850 0.617 4.6e-89
TAIR|locus:2087303354 AT3G24740 "AT3G24740" [Arabido 0.433 0.375 0.4 6.8e-47
TAIR|locus:2203241265 AT1G77770 [Arabidopsis thalian 0.342 0.396 0.457 8.5e-43
TAIR|locus:2200166334 AT1G68140 "AT1G68140" [Arabido 0.592 0.544 0.425 1.4e-41
TAIR|locus:2133519274 AT4G08460 [Arabidopsis thalian 0.521 0.583 0.457 5.9e-41
TAIR|locus:2092140372 AT3G25910 [Arabidopsis thalian 0.273 0.225 0.476 7.3e-41
TAIR|locus:2037778259 AT1G15430 "AT1G15430" [Arabido 0.260 0.308 0.425 6.2e-33
TAIR|locus:2016219255 AT1G80220 [Arabidopsis thalian 0.504 0.607 0.356 6.1e-23
TAIR|locus:2057396221 AT2G26050 [Arabidopsis thalian 0.377 0.524 0.343 3.2e-17
TAIR|locus:2177371100 AT5G38370 [Arabidopsis thalian 0.201 0.62 0.328 0.00063
TAIR|locus:2128146 AT4G31410 "AT4G31410" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 889 (318.0 bits), Expect = 4.6e-89, P = 4.6e-89
 Identities = 166/269 (61%), Positives = 189/269 (70%)

Query:    19 EDVQLNTNWDDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGV 78
             ++ QL  NWDD+TCPICLDFPHNGVLL CSSY  GCR FVC+TDHLHSNCLDRF +A G 
Sbjct:    21 QEFQLTLNWDDLTCPICLDFPHNGVLLQCSSYGNGCRAFVCNTDHLHSNCLDRFISACGT 80

Query:    79 -SPPSTSEVNSAANTQPMVSEDSCRPACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQC 137
              SPP+  E  S       V E+SC+P CPLCRGEVTGW+V ++ R  L+EKKRCCEE++C
Sbjct:    81 ESPPAPDEPRSK------VLEESCKPVCPLCRGEVTGWLVVEEARLRLDEKKRCCEEERC 134

Query:   138 TFAGTYLELRKHAQLEHPHSRPSKIDPARQLDWENFQQSSEIIDVLSTIHSEVPRGVVLG 197
              F GTYLELRKHAQ EHP SRPS+IDPAR+LDWENFQQSSEIIDVLSTIHSEVPRGVVLG
Sbjct:   135 RFMGTYLELRKHAQSEHPDSRPSEIDPARKLDWENFQQSSEIIDVLSTIHSEVPRGVVLG 194

Query:   198 DYVIXXXXXXXXXXXXXXXXXXXNWWTSCILYQVFDXXXXXXXXXXXXXXXXXXXXXXXX 257
             DYVI                   NWWTSCILYQ+FD                        
Sbjct:   195 DYVIEYGDDDTGDEFEDVPNNEGNWWTSCILYQMFDNIRNARNRRRSRMSESRRGSRRSS 254

Query:   258 YDTSNSDEGSVTSVDFAEYRIDETDDEFV 286
             Y+ SNSD+ SV S++F EYR+DE DDEF+
Sbjct:   255 YENSNSDDSSVASIEFPEYRVDEIDDEFI 283
GO:0003674 "molecular_function" evidence=ND
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
GO:0048573 "photoperiodism, flowering" evidence=RCA
TAIR|locus:2087303 AT3G24740 "AT3G24740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2203241 AT1G77770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200166 AT1G68140 "AT1G68140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2133519 AT4G08460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2092140 AT3G25910 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037778 AT1G15430 "AT1G15430" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2016219 AT1G80220 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057396 AT2G26050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2177371 AT5G38370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00180614
hypothetical protein (301 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
pfam07800148 pfam07800, DUF1644, Protein of unknown function (D 2e-84
>gnl|CDD|219584 pfam07800, DUF1644, Protein of unknown function (DUF1644) Back     alignment and domain information 
 Score =  249 bits (639), Expect = 2e-84
 Identities = 88/157 (56%), Positives = 108/157 (68%), Gaps = 9/157 (5%)

Query: 28  DDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGVSPPSTSEVN 87
           +DVTCPICL+ PHN VLLLCSS++KGCRP++CDT H HSNCLD+FK AY     S  +  
Sbjct: 1   EDVTCPICLEHPHNAVLLLCSSHDKGCRPYMCDTSHRHSNCLDQFKKAYSKKRNSGKDSE 60

Query: 88  SAANTQPMVSEDSCRPACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELR 147
                     EDS    CPLCRGEV GW V +  R +LN KKR C ++ C+F+GTY ELR
Sbjct: 61  K---------EDSTELTCPLCRGEVKGWTVVEPARRFLNSKKRSCMQEGCSFSGTYRELR 111

Query: 148 KHAQLEHPHSRPSKIDPARQLDWENFQQSSEIIDVLS 184
           KHA+ EHP +RP ++DPARQ  WE  ++ SE  DVLS
Sbjct: 112 KHARSEHPGARPREVDPARQRRWERLERESEYQDVLS 148

This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, and is probably a zinc-binding domain. Length = 148

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 307
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 100.0
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.14
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 96.77
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 96.71
PHA02929238 N1R/p28-like protein; Provisional 94.27
KOG2164513 consensus Predicted E3 ubiquitin ligase [Posttrans 94.0
cd0016245 RING RING-finger (Really Interesting New Gene) dom 93.93
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 92.38
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 92.1
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 91.86
PHA02926242 zinc finger-like protein; Provisional 91.76
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 91.49
TIGR00599397 rad18 DNA repair protein rad18. This family is bas 91.22
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 87.09
KOG3002299 consensus Zn finger protein [General function pred 85.5
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 83.17
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 82.98
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 82.66
PF03145198 Sina: Seven in absentia protein family; InterPro: 82.56
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 82.27
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information 
Probab=100.00  E-value=1.2e-92  Score=614.33  Aligned_cols=157  Identities=57%  Similarity=1.092  Sum_probs=143.0

Q ss_pred             ccccccccccCCCceeeeecccCCCCCcccccCCCCCccchHHHHHHhhCCCCCCCCccCC----ccCC-CCCcCCCCCC
Q 021837           28 DDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGVSPPSTSEVNS----AANT-QPMVSEDSCR  102 (307)
Q Consensus        28 edvtCpICME~PHNAVLLlCSSh~KGCRPYMCdTS~RHSNCLDQFkka~~~~~~s~~~~~~----~~~~-~~~~~~~~~~  102 (307)
                      |||+||||||||||||||+||||+|||||||||||||||||||||||||+++.++++.+..    +.++ ....+..+++
T Consensus         1 ed~~CpICme~PHNAVLLlCSS~~kgcRpymc~Ts~rhSNCLdqfkka~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (162)
T PF07800_consen    1 EDVTCPICMEHPHNAVLLLCSSHEKGCRPYMCDTSYRHSNCLDQFKKAYGKSSSSSSQSSSSAPSDSSSSESSESQEQPE   80 (162)
T ss_pred             CCccCceeccCCCceEEEEeccccCCccccccCCccchhHHHHHHHHHhcCCCCccccccccCcCCCccccccccccccc
Confidence            7999999999999999999999999999999999999999999999999998754443322    1111 1233457889


Q ss_pred             ccCcccccccccEEEcchhHHhhccccCcCcccCccccccHHHHHHhhhhhCCCCCCCCCCchhHHHHHHhhhhhhhhhH
Q 021837          103 PACPLCRGEVTGWVVADKVRDYLNEKKRCCEEDQCTFAGTYLELRKHAQLEHPHSRPSKIDPARQLDWENFQQSSEIIDV  182 (307)
Q Consensus       103 L~CPLCRG~VkGWtVVe~AR~~LN~K~RsC~~e~CsF~GtY~eLrKHar~~HP~arP~eVDP~rq~~W~~lE~ere~~Dv  182 (307)
                      |+||||||+|+|||||++||+|||+|+|+||+|+|+|+|||.|||||||.+||++||++|||+||++|++||+|+||+||
T Consensus        81 L~CPLCRG~V~GWtvve~AR~~LN~K~RsC~~e~C~F~GtY~eLrKHar~~HP~~rP~~vDP~rq~~W~~le~~re~~D~  160 (162)
T PF07800_consen   81 LACPLCRGEVKGWTVVEPARRFLNAKKRSCSQESCSFSGTYSELRKHARSEHPSARPSEVDPQRQRDWERLEREREYGDV  160 (162)
T ss_pred             ccCccccCceeceEEchHHHHHhccCCccCcccccccccCHHHHHHHHHhhCCCCCCccCCHHHHHHHHHHHHhhhhhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HH
Q 021837          183 LS  184 (307)
Q Consensus       183 iS  184 (307)
                      ||
T Consensus       161 iS  162 (162)
T PF07800_consen  161 IS  162 (162)
T ss_pred             cC
Confidence            97

The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain.
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF03145 Sina: Seven in absentia protein family; InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.83
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.48
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.89
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.85
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.18
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.13
2ecw_A85 Tripartite motif-containing protein 30; metal bind 97.12
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.12
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 97.12
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 97.05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 97.03
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.03
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 97.03
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 97.0
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 96.98
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 96.87
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 96.86
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.85
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 96.8
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 96.75
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 96.71
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 96.68
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 96.65
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 96.6
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 96.59
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 96.53
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 96.47
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.47
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 96.33
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 96.3
2ea5_A68 Cell growth regulator with ring finger domain prot 96.29
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 96.28
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 96.27
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 96.25
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 96.23
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 96.21
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 96.18
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 96.17
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 96.12
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 95.96
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 95.91
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 95.87
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 95.86
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 95.84
1z6u_A150 NP95-like ring finger protein isoform B; structura 95.83
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 95.82
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 95.59
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 95.46
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 95.34
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 95.22
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 95.12
2ect_A78 Ring finger protein 126; metal binding protein, st 94.67
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 94.43
2ysj_A63 Tripartite motif-containing protein 31; ring-type 93.85
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 93.76
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 93.44
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 92.22
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 92.0
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 90.71
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 90.62
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 89.49
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 87.88
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 86.32
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 82.78
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 82.59
2a25_A193 Ubiquitin ligase SIAH1; protein-peptide complex, l 80.64
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
Probab=98.83  E-value=1.7e-09  Score=84.88  Aligned_cols=98  Identities=15%  Similarity=0.214  Sum_probs=72.2

Q ss_pred             ccccccccccCCCceeeeecccCCCCCcccccCCCCCccchHHHHHHhhCCCCCCCCccCCccCCCCCcCCCCCCccCcc
Q 021837           28 DDVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGVSPPSTSEVNSAANTQPMVSEDSCRPACPL  107 (307)
Q Consensus        28 edvtCpICME~PHNAVLLlCSSh~KGCRPYMCdTS~RHSNCLDQFkka~~~~~~s~~~~~~~~~~~~~~~~~~~~L~CPL  107 (307)
                      ++.+||||++...++|.|.|.            -.| +..|+.++-+...                         ..||+
T Consensus        17 ~~~~C~IC~~~~~~p~~~~Cg------------H~f-C~~Ci~~~~~~~~-------------------------~~CP~   58 (118)
T 3hct_A           17 SKYECPICLMALREAVQTPCG------------HRF-CKACIIKSIRDAG-------------------------HKCPV   58 (118)
T ss_dssp             GGGBCTTTCSBCSSEEECTTS------------CEE-EHHHHHHHHHHHC-------------------------SBCTT
T ss_pred             CCCCCCcCChhhcCeEECCcC------------Chh-hHHHHHHHHhhCC-------------------------CCCCC
Confidence            678999999999999987553            111 3578888765421                         27999


Q ss_pred             cccccccEE--EcchhHHhhccccCcCcccCccccccHHHHHHhhhhhCCCCCCCCCC
Q 021837          108 CRGEVTGWV--VADKVRDYLNEKKRCCEEDQCTFAGTYLELRKHAQLEHPHSRPSKID  163 (307)
Q Consensus       108 CRG~VkGWt--VVe~AR~~LN~K~RsC~~e~CsF~GtY~eLrKHar~~HP~arP~eVD  163 (307)
                      ||..+..-.  .....++.|+.-+-.|...+|.++|+|.+|.+|.++-|..+-|..+|
T Consensus        59 Cr~~~~~~~~~~~~~l~~~i~~l~v~C~n~gC~~~~~~~~l~~H~~~c~~~~~~~~~~  116 (118)
T 3hct_A           59 DNEILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALLEHHHH  116 (118)
T ss_dssp             TCCBCCGGGCEECHHHHHHHHTSEEECSSTTCCCEEEGGGSGGGTSSSCC--------
T ss_pred             CCCCcCHHhcccCHHHHHHHccceeECCCCCCCCEEeeHHHHHHHHHchhhhhhhccc
Confidence            999987633  34567788888888999999999999999999999999999887766
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2a25_A Ubiquitin ligase SIAH1; protein-peptide complex, ligase; 2.20A {Homo sapiens} PDB: 2an6_A 1k2f_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.27
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 97.23
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 96.52
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 96.38
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.37
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.75
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 95.64
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 95.06
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 95.0
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 94.72
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 90.51
d2c2la280 STIP1 homology and U box-containing protein 1, STU 88.9
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 86.22
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 86.02
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

Probab=97.27  E-value=4.8e-05  Score=55.49  Aligned_cols=51  Identities=24%  Similarity=0.523  Sum_probs=37.8

Q ss_pred             cccccccccCCCceeeeecccCCCCCcccccCCCCCccchHHHHHHhhCCCCCCCCccCCccCCCCCcCCCCCCccCccc
Q 021837           29 DVTCPICLDFPHNGVLLLCSSYEKGCRPFVCDTDHLHSNCLDRFKNAYGVSPPSTSEVNSAANTQPMVSEDSCRPACPLC  108 (307)
Q Consensus        29 dvtCpICME~PHNAVLLlCSSh~KGCRPYMCdTS~RHSNCLDQFkka~~~~~~s~~~~~~~~~~~~~~~~~~~~L~CPLC  108 (307)
                      ...||||+|.+.|+|+|-|            +-.| +.+|++++-+..                         ...||+|
T Consensus        23 ~~~C~IC~~~~~~~~~~~C------------gH~f-C~~Ci~~wl~~~-------------------------~~~CP~C   64 (79)
T d1fbva4          23 FQLCKICAENDKDVKIEPC------------GHLM-CTSCLTSWQESE-------------------------GQGCPFC   64 (79)
T ss_dssp             TTBCTTTSSSBCCEECSSS------------CCEE-CHHHHHHHHHTT-------------------------CCSCTTT
T ss_pred             CCCCccCCCcCCCeEEeCC------------CCee-eHHHHHHHHHHC-------------------------cCcCCCC
Confidence            3579999999999998855            3333 568998875421                         1349999


Q ss_pred             ccccccEEE
Q 021837          109 RGEVTGWVV  117 (307)
Q Consensus       109 RG~VkGWtV  117 (307)
                      |.+|++...
T Consensus        65 r~~i~~~~~   73 (79)
T d1fbva4          65 RCEIKGTEP   73 (79)
T ss_dssp             CCCCCCCCC
T ss_pred             CcCccCCce
Confidence            999998764
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure