Citrus Sinensis ID: 021874

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASDNSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETIEGLDSVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKM
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
cccEEEHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mnsvfsaddfsdsflsspspppasfhalpmnrsqSEWELEKFLQEvtvspraissssasdnsvpavigpsvmsksrayeigddDVVEIKkshrdqsldppvipsstapvdsdEYRAYLKTKLDLACAAVAlrtapvkpedksslienqtqaakpselgsqAMATVNVSTahdalgthpkadfrplgsadlpavqarpaaqvrqstsgssredsdddelegdtetiegldsVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKM
mnsvfsaddfsdsflsSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPraissssasdnsvpavigpsvmsksrAYEIGDDDVVEIKKshrdqsldppvipsstapvdsDEYRAYLKTKLDLACAAVALRtapvkpedksslIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPAVqarpaaqvrqstsgssredsdddelegdtetiegldsvddkrarrmlsnresarrsrrrkqAHLNEletqagqlraEHSSLLKGLTDvnqkydesavnnrilkaDIETLRAKM
MNSVfsaddfsdsflsspspppasfhalpMNRSQSEWELEKFLQEVTvspraissssasdnsvpavIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLpavqarpaaqvrqstsgssredsdddelegdtetiegLDSVDDKRARRMLsnresarrsrrrKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKM
*****************************************************************************************************************YRAYLKTKLDLACAAVALRT*****************************************************************************************************************************************************************************
*NSVFSADDFSDSF*******************************************************************************************************************************************************************************************************************************************RRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRA**
*******************PPPASFHALPMNRSQSEWELEKFLQEVTV***************PAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPA******************************ETIEGLDSVDDKRARRM***************AHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKM
****FSADDFSDSFLS********************WELEKFLQEVTV*********************************************************TAPVDSDEYRAYLKTKLDLACAAVALRTAP********************************************************************************************************************RKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLR***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASDNSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETIEGLDSVDDKRARRMLSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
Q99090 401 Light-inducible protein C N/A no 0.882 0.673 0.480 3e-47
O22763 411 Basic leucine zipper 10 O yes no 0.911 0.678 0.433 2e-39
Q9M1G6403 Basic leucine zipper 25 O no no 0.905 0.687 0.448 2e-34
B9DGI8314 Basic leucine zipper 63 O no no 0.656 0.640 0.417 1e-31
Q9FUD3277 Basic leucine zipper 9 OS no no 0.385 0.425 0.488 1e-21
P12959 453 Regulatory protein opaque N/A no 0.294 0.198 0.527 2e-19
P23922349 Transcription factor HBP- N/A no 0.300 0.263 0.382 1e-07
Q9SJN0442 Protein ABSCISIC ACID-INS no no 0.245 0.169 0.412 9e-07
P42777270 G-box-binding factor 4 OS no no 0.183 0.207 0.482 5e-06
P24068151 Ocs element-binding facto N/A no 0.254 0.516 0.392 1e-05
>sp|Q99090|CPRF2_PETCR Light-inducible protein CPRF2 OS=Petroselinum crispum GN=CPRF2 PE=2 SV=2 Back     alignment and function desciption
 Score =  188 bits (478), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 148/308 (48%), Positives = 198/308 (64%), Gaps = 38/308 (12%)

Query: 1   MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASD 60
           M+ VFS +D SD F S P+   +S   L MNRS SEW  + FLQ+          +SA +
Sbjct: 1   MDRVFSVEDISDQFWSPPAREDSS--KLVMNRSDSEWAFQSFLQQ----------ASALE 48

Query: 61  NSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKT 120
           +S P    P  ++       GD     +K        +P  IP++  PVDS++Y+AYLK+
Sbjct: 49  SSQPLPSDPVPVA-------GD-----VK--------NPVEIPANV-PVDSEDYQAYLKS 87

Query: 121 KLDLACAAVAL-RTAPVKPEDKSSLIENQTQAAKPSELGSQAMATVNVSTAHDALGTHPK 179
           +LDLACAAVAL R + +KP+D ++L++N +QA+  S+L SQ        + HD      K
Sbjct: 88  RLDLACAAVALTRASSLKPQDSAALLDNGSQASNTSQLVSQVPPK---GSGHDLSKEEDK 144

Query: 180 ADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDD-ELEGDTETIEGLDSVDDKRARR 238
                  +  LPA+Q + A QV+ +TSGSSR+ SDDD ELEG+TET    D  D KR RR
Sbjct: 145 EALAATATPLLPALQKKSAIQVKSTTSGSSRDHSDDDDELEGETETTRNGDPSDAKRVRR 204

Query: 239 MLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKAD 298
           MLSNRESARRSRRRKQAH+ ELETQ  QLR E+SSLLK LTD++Q+Y+++AV+NR+LKAD
Sbjct: 205 MLSNRESARRSRRRKQAHMTELETQVSQLRVENSSLLKRLTDISQRYNDAAVDNRVLKAD 264

Query: 299 IETLRAKM 306
           IET+RAK+
Sbjct: 265 IETMRAKV 272
Binds to the G-box-like motif (5'-ACGTGGC-3') of the chalcone synthase (CHS) gene promoter. G-box and G-box-like motifs are defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control.
Petroselinum crispum (taxid: 4043)
>sp|O22763|BZP10_ARATH Basic leucine zipper 10 OS=Arabidopsis thaliana GN=BZIP10 PE=1 SV=2 Back     alignment and function description
>sp|Q9M1G6|BZP25_ARATH Basic leucine zipper 25 OS=Arabidopsis thaliana GN=BZIP25 PE=1 SV=1 Back     alignment and function description
>sp|B9DGI8|BZP63_ARATH Basic leucine zipper 63 OS=Arabidopsis thaliana GN=BZIP63 PE=1 SV=1 Back     alignment and function description
>sp|Q9FUD3|BZIP9_ARATH Basic leucine zipper 9 OS=Arabidopsis thaliana GN=BZIP9 PE=1 SV=1 Back     alignment and function description
>sp|P12959|OP2_MAIZE Regulatory protein opaque-2 OS=Zea mays GN=O2 PE=1 SV=1 Back     alignment and function description
>sp|P23922|HBP1A_WHEAT Transcription factor HBP-1a OS=Triticum aestivum PE=2 SV=1 Back     alignment and function description
>sp|Q9SJN0|ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis thaliana GN=ABI5 PE=1 SV=1 Back     alignment and function description
>sp|P42777|GBF4_ARATH G-box-binding factor 4 OS=Arabidopsis thaliana GN=GBF4 PE=1 SV=1 Back     alignment and function description
>sp|P24068|OCS1_MAIZE Ocs element-binding factor 1 OS=Zea mays GN=OBF1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
298204854383 unnamed protein product [Vitis vinifera] 0.908 0.725 0.485 3e-55
225451342 423 PREDICTED: light-inducible protein CPRF2 0.908 0.657 0.485 4e-55
16797791 450 bZIP transcription factor [Nicotiana tab 0.937 0.637 0.467 2e-53
147796457 446 hypothetical protein VITISV_022136 [Viti 0.911 0.625 0.459 8e-53
255559911 441 DNA binding protein, putative [Ricinus c 0.921 0.639 0.509 2e-52
444300790 444 bZIP transcription factor family protein 0.928 0.639 0.446 2e-51
351720703 417 bZIP protein [Glycine max] gi|183014149| 0.937 0.688 0.463 8e-50
351725229404 bZIP transcription factor bZIP89 [Glycin 0.937 0.710 0.459 4e-48
224123412371 predicted protein [Populus trichocarpa] 0.764 0.630 0.467 1e-47
118486477 445 unknown [Populus trichocarpa] 0.944 0.649 0.541 6e-47
>gi|298204854|emb|CBI34161.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  221 bits (563), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 156/321 (48%), Positives = 205/321 (63%), Gaps = 43/321 (13%)

Query: 1   MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASD 60
           M+ VFS D+  + F +SP    +S     MNRS SEW  ++FLQE +  P + S S++  
Sbjct: 1   MDRVFSVDEIPEQFWASPPS--SSKEPSQMNRSASEWAFQRFLQESSSPPSSSSVSASGP 58

Query: 61  NSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRD--------------QSLDPPVIPSST 106
           ++                   ++DVVE+K    D               SLDPP      
Sbjct: 59  SA-------------------ENDVVELKVPIDDPKPTPAPPAPPAPATSLDPP----PN 95

Query: 107 APVDSDEYRAYLKTKLDLACAAVAL-RTAPVKPEDKSSLIENQTQAAKPSELGSQAMATV 165
            P+DS+EY+A+LK++L+LACAAVAL R + VKP+D ++L +  +QA+K S+L SQA    
Sbjct: 96  VPIDSEEYQAFLKSRLNLACAAVALSRASFVKPQDSAALADTGSQASKTSQLRSQAPCK- 154

Query: 166 NVSTAHDALGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETI 225
              + +D  G   K    PLG   LPA+Q +  AQ+R +TS SSRE SDDDE+EG+TETI
Sbjct: 155 --GSGYDLSGAPDKEAGGPLGIPSLPAMQKKAGAQLRPTTSESSREHSDDDEVEGETETI 212

Query: 226 EGLDSVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKY 285
           E +D  D KR RRMLSNRESARRSRRRKQAHL ELETQ  QLR E+SSLLK LTD++QKY
Sbjct: 213 ENMDPADAKRVRRMLSNRESARRSRRRKQAHLTELETQVAQLRLENSSLLKRLTDISQKY 272

Query: 286 DESAVNNRILKADIETLRAKM 306
           +E+AV+NR+LKAD+ETLRAK+
Sbjct: 273 NEAAVDNRVLKADVETLRAKV 293

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225451342|ref|XP_002279520.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|16797791|gb|AAL27150.1| bZIP transcription factor [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|147796457|emb|CAN74806.1| hypothetical protein VITISV_022136 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255559911|ref|XP_002520974.1| DNA binding protein, putative [Ricinus communis] gi|223539811|gb|EEF41391.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|444300790|gb|AGD98704.1| bZIP transcription factor family protein 6 [Camellia sinensis] Back     alignment and taxonomy information
>gi|351720703|ref|NP_001237953.1| bZIP protein [Glycine max] gi|183014149|dbj|BAG24402.1| bZIP protein [Glycine max] Back     alignment and taxonomy information
>gi|351725229|ref|NP_001237085.1| bZIP transcription factor bZIP89 [Glycine max] gi|113367196|gb|ABI34655.1| bZIP transcription factor bZIP89 [Glycine max] Back     alignment and taxonomy information
>gi|224123412|ref|XP_002319072.1| predicted protein [Populus trichocarpa] gi|222857448|gb|EEE94995.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118486477|gb|ABK95078.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
TAIR|locus:505006398403 BZIP25 "basic leucine zipper 2 0.254 0.193 0.564 3.9e-34
TAIR|locus:2184251314 BZO2H3 "AT5G28770" [Arabidopsi 0.238 0.232 0.561 1.5e-33
TAIR|locus:2149403277 BZIP9 "AT5G24800" [Arabidopsis 0.254 0.281 0.410 1.9e-09
TAIR|locus:2053124171 bZIP2 "AT2G18160" [Arabidopsis 0.251 0.450 0.285 0.00032
TAIR|locus:505006398 BZIP25 "basic leucine zipper 25" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 218 (81.8 bits), Expect = 3.9e-34, Sum P(2) = 3.9e-34
 Identities = 44/78 (56%), Positives = 54/78 (69%)

Query:   229 DSVDDKRARRMLXXXXXXXXXXXXKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDES 288
             D  D KRARRML            KQ  +NE +TQ GQLRAEHS+L+  L+D+N KYD +
Sbjct:   226 DPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAA 285

Query:   289 AVNNRILKADIETLRAKM 306
             AV+NRIL+ADIETLR K+
Sbjct:   286 AVDNRILRADIETLRTKV 303
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS;IDA
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:2000693 "positive regulation of seed maturation" evidence=IDA
GO:0007165 "signal transduction" evidence=RCA
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0009723 "response to ethylene stimulus" evidence=RCA
GO:0009755 "hormone-mediated signaling pathway" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2184251 BZO2H3 "AT5G28770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149403 BZIP9 "AT5G24800" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XIII1499
hypothetical protein (372 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
smart0033865 smart00338, BRLZ, basic region leucin zipper 3e-14
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 9e-10
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 3e-05
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 4e-05
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 66.0 bits (162), Expect = 3e-14
 Identities = 25/62 (40%), Positives = 37/62 (59%)

Query: 232 DDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVN 291
           D+KR RR   NRE+ARRSR RK+A + ELE +  QL AE+  L K +  + ++ ++    
Sbjct: 3   DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSE 62

Query: 292 NR 293
             
Sbjct: 63  LE 64

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
smart0033865 BRLZ basic region leucin zipper. 99.38
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.36
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 99.28
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 99.25
KOG0709 472 consensus CREB/ATF family transcription factor [Tr 99.14
KOG3584348 consensus cAMP response element binding protein an 99.14
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.06
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.17
KOG0837279 consensus Transcriptional activator of the JUN fam 98.06
KOG4571294 consensus Activating transcription factor 4 [Trans 97.56
KOG4196135 consensus bZIP transcription factor MafK [Transcri 97.27
KOG3119269 consensus Basic region leucine zipper transcriptio 96.95
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 96.71
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 96.02
TIGR0244965 conserved hypothetical protein TIGR02449. Members 95.88
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 95.81
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.32
PRK13169110 DNA replication intiation control protein YabA; Re 95.28
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 95.25
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 94.66
PRK10884206 SH3 domain-containing protein; Provisional 94.33
COG307479 Uncharacterized protein conserved in bacteria [Fun 94.28
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.2
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 94.15
PRK13169110 DNA replication intiation control protein YabA; Re 94.1
PRK10884206 SH3 domain-containing protein; Provisional 93.89
COG4467114 Regulator of replication initiation timing [Replic 93.77
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 93.73
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 93.53
TIGR0244965 conserved hypothetical protein TIGR02449. Members 93.03
PRK1542279 septal ring assembly protein ZapB; Provisional 92.67
PF0798975 Microtub_assoc: Microtubule associated; InterPro: 92.61
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 92.54
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 91.35
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.08
PRK11637 428 AmiB activator; Provisional 90.9
TIGR00219 283 mreC rod shape-determining protein MreC. MreC (mur 90.6
COG4467114 Regulator of replication initiation timing [Replic 90.45
PF1374789 DUF4164: Domain of unknown function (DUF4164) 90.33
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 90.0
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 90.0
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 89.95
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 89.17
smart0034044 HALZ homeobox associated leucin zipper. 89.14
PRK0211973 hypothetical protein; Provisional 88.81
PRK1542279 septal ring assembly protein ZapB; Provisional 88.47
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 88.44
KOG1414 395 consensus Transcriptional activator FOSB/c-Fos and 88.42
PRK11637 428 AmiB activator; Provisional 88.28
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 87.97
PF06785 401 UPF0242: Uncharacterised protein family (UPF0242); 87.83
COG4026290 Uncharacterized protein containing TOPRIM domain, 87.63
PRK0440675 hypothetical protein; Provisional 87.45
PRK0279372 phi X174 lysis protein; Provisional 87.25
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 87.12
PRK0211973 hypothetical protein; Provisional 87.09
PRK0029568 hypothetical protein; Provisional 87.06
KOG4005 292 consensus Transcription factor XBP-1 [Transcriptio 87.02
PF15294 278 Leu_zip: Leucine zipper 86.76
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 86.71
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 86.46
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 86.37
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 86.32
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 86.29
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 86.13
PRK0432574 hypothetical protein; Provisional 85.93
PRK13922 276 rod shape-determining protein MreC; Provisional 85.81
PRK0440675 hypothetical protein; Provisional 85.62
PF10186 302 Atg14: UV radiation resistance protein and autopha 85.6
PF0864796 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 85.55
PRK0432574 hypothetical protein; Provisional 85.5
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 85.45
PRK10803 263 tol-pal system protein YbgF; Provisional 85.34
KOG1962216 consensus B-cell receptor-associated protein and r 85.14
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 85.06
PRK0073668 hypothetical protein; Provisional 84.99
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 84.97
smart0033865 BRLZ basic region leucin zipper. 84.95
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 84.94
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 84.7
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 84.58
PHA03162135 hypothetical protein; Provisional 84.33
COG4942 420 Membrane-bound metallopeptidase [Cell division and 84.15
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 84.08
PF05278269 PEARLI-4: Arabidopsis phospholipase-like protein ( 83.8
PF13851201 GAS: Growth-arrest specific micro-tubule binding 83.3
PRK0279372 phi X174 lysis protein; Provisional 83.24
PHA03155115 hypothetical protein; Provisional 83.22
PRK00888105 ftsB cell division protein FtsB; Reviewed 83.19
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 83.12
PRK09039 343 hypothetical protein; Validated 83.1
PF09755 310 DUF2046: Uncharacterized conserved protein H4 (DUF 83.03
PRK0029568 hypothetical protein; Provisional 82.87
PRK0084677 hypothetical protein; Provisional 82.5
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 82.37
PRK00888105 ftsB cell division protein FtsB; Reviewed 82.35
PF07407 420 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: 81.95
PF14662193 CCDC155: Coiled-coil region of CCDC155 81.79
PF09726 697 Macoilin: Transmembrane protein; InterPro: IPR0191 81.77
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 81.74
PF15035182 Rootletin: Ciliary rootlet component, centrosome c 81.57
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 80.77
PF06810155 Phage_GP20: Phage minor structural protein GP20; I 80.72
KOG4797123 consensus Transcriptional regulator [Transcription 80.72
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 80.72
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 80.66
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 80.61
PF0489970 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th 80.58
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 80.51
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 80.47
COG4026 290 Uncharacterized protein containing TOPRIM domain, 80.41
PF09304107 Cortex-I_coil: Cortexillin I, coiled coil; InterPr 80.31
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 80.28
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 80.26
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.38  E-value=3.4e-12  Score=95.75  Aligned_cols=61  Identities=41%  Similarity=0.566  Sum_probs=55.2

Q ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 021874          232 DDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNN  292 (306)
Q Consensus       232 e~KR~RR~lsNRESArRSR~RKk~~l~eLE~qV~~Le~EN~~L~~~l~~L~qk~~~l~~EN  292 (306)
                      +.|+.||+++||+||++||.||++|+.+||.+|..|+.+|..|..++..|..++..+..+|
T Consensus         3 ~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338        3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             cHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5799999999999999999999999999999999999999999999988777666666554

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking Back     alignment and domain information
>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PHA03162 hypothetical protein; Provisional Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>PF05278 PEARLI-4: Arabidopsis phospholipase-like protein (PEARLI 4); InterPro: IPR007942 This family contains several phospholipase-like proteins from Arabidopsis thaliana and other members of the Streptophyta which are homologous to PEARLI 4 Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PHA03155 hypothetical protein; Provisional Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length Back     alignment and domain information
>KOG4797 consensus Transcriptional regulator [Transcription] Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 5e-13
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 2e-09
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 4e-08
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 1e-07
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 2e-07
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 2e-07
2wt7_B90 Transcription factor MAFB; transcription, transcri 2e-06
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 2e-06
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 6e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 2e-04
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 61.7 bits (150), Expect = 5e-13
 Identities = 18/52 (34%), Positives = 32/52 (61%)

Query: 234 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKY 285
           KR  R++ NRE+AR SRR+K+ ++  LE +   L  ++ +L++ L  +   Y
Sbjct: 1   KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.54
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.31
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.25
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.22
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.17
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 99.02
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 98.92
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.57
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.56
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.47
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.26
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.32
1deb_A54 APC protein, adenomatous polyposis coli protein; c 96.22
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 96.04
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 95.18
2w6a_A63 ARF GTPase-activating protein GIT1; PIX, zinc, sig 94.82
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 94.44
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 94.0
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 93.33
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 92.63
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 91.74
3m48_A33 General control protein GCN4; leucine zipper, synt 91.73
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 91.61
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 91.41
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 91.23
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 90.23
1p9i_A31 Cortexillin I/GCN4 hybrid peptide; coiled-coil, un 90.21
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 90.13
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 89.81
2eqb_B97 RAB guanine nucleotide exchange factor SEC2; coile 89.72
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 89.7
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 89.57
3a7p_A152 Autophagy protein 16; coiled-coil, coiled coil, cy 89.51
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 89.43
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 88.83
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 88.47
3swy_A46 Cyclic nucleotide-gated cation channel alpha-3; co 88.4
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 88.16
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 88.14
1uo4_A34 General control protein GCN4; four helix bundle, c 87.93
2bni_A34 General control protein GCN4; four helix bundle, a 87.78
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 87.65
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 87.6
2hy6_A34 General control protein GCN4; protein design, para 87.4
3bas_A89 Myosin heavy chain, striated muscle/general contro 87.36
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 87.3
3cve_A72 Homer protein homolog 1; coiled coil, alternative 87.15
3u06_A 412 Protein claret segregational; motor domain, stalk 87.04
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 86.78
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 86.74
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 86.61
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 86.45
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 86.45
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 85.93
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 85.78
2v66_B111 Nuclear distribution protein NUDE-like 1; structur 85.23
3cvf_A79 Homer-3, homer protein homolog 3; coiled coil, alt 85.17
2w83_C77 C-JUN-amino-terminal kinase-interacting protein 4; 85.15
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 84.93
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 84.92
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 84.59
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 84.44
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 83.95
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 83.72
3m9b_A 251 Proteasome-associated ATPase; coil COIL with 5 bet 83.54
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 83.11
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 82.96
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 82.91
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 82.9
2ve7_C250 Kinetochore protein NUF2, kinetochore protein SPC; 82.9
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 82.88
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 82.71
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 82.63
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 82.52
3a7o_A75 Autophagy protein 16; coiled-coil, coiled coil, cy 82.16
2oa5_A110 Hypothetical protein BQLF2; MHR28B, NESG, structur 82.01
1t6f_A37 Geminin; coiled-coil, cell cycle; 1.47A {Synthetic 81.91
2xdj_A83 Uncharacterized protein YBGF; unknown function; 1. 81.53
3swf_A74 CGMP-gated cation channel alpha-1; coiled-coil, as 81.03
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 80.9
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 80.72
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 80.64
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.54  E-value=7.9e-15  Score=107.20  Aligned_cols=53  Identities=34%  Similarity=0.596  Sum_probs=49.6

Q ss_pred             HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 021874          234 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYD  286 (306)
Q Consensus       234 KR~RR~lsNRESArRSR~RKk~~l~eLE~qV~~Le~EN~~L~~~l~~L~qk~~  286 (306)
                      ||.+||++||+||++||.||++|+++||.+|..|+.||..|..++..|++.|.
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~~   53 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLYS   53 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTST
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            58899999999999999999999999999999999999999999998887653
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>3swy_A Cyclic nucleotide-gated cation channel alpha-3; coiled-coil, assembly domain, transport protein; 1.90A {Homo sapiens} Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} Back     alignment and structure
>3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} Back     alignment and structure
>2w83_C C-JUN-amino-terminal kinase-interacting protein 4; golgi apparatus, protein transport, ER-golgi transport, ARF, GTPase, effector, myristate; HET: GTP; 1.93A {Homo sapiens} Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>2ve7_C Kinetochore protein NUF2, kinetochore protein SPC; mitosis, centromere, cell cycle, microtubule, C division, calponin homology; 2.88A {Homo sapiens} PDB: 3iz0_D* Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3a7o_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2oa5_A Hypothetical protein BQLF2; MHR28B, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: PE5; 2.10A {Murid herpesvirus 4} SCOP: d.362.1.1 PDB: 2h3r_A* Back     alignment and structure
>1t6f_A Geminin; coiled-coil, cell cycle; 1.47A {Synthetic} SCOP: h.1.28.1 Back     alignment and structure
>2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A Back     alignment and structure
>3swf_A CGMP-gated cation channel alpha-1; coiled-coil, assembly domain, transport protein; 2.14A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 91.55
d2oa5a196 Uncharacterized protein BQLF2 {Murid herpesvirus 4 83.34
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 80.98
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=91.55  E-value=0.043  Score=40.34  Aligned_cols=28  Identities=25%  Similarity=0.338  Sum_probs=23.9

Q ss_pred             HHHHHHHHHHhHHHHHHHHHHHHHHHHH
Q 021874          232 DDKRARRMLSNRESARRSRRRKQAHLNE  259 (306)
Q Consensus       232 e~KR~RR~lsNRESArRSR~RKk~~l~e  259 (306)
                      -.+-.||.=+||.+||++|+||....++
T Consensus        46 lirDIRRRGKNKvAAqnCRKRKld~~d~   73 (74)
T d1sknp_          46 LIRKIRRRGKNKVAARTCRQRRTDRHDK   73 (74)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence            4678899999999999999999876543
>d2oa5a1 d.362.1.1 (A:7-102) Uncharacterized protein BQLF2 {Murid herpesvirus 4 [TaxId: 33708]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure