Citrus Sinensis ID: 021999

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MVAEAETANEAERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWRKSQGILMEGDDELLADMEVKAPPKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWTDTPSDRAQKAKMNYLEAYSETSALASTEEEKKGARADADLVDKYNKEKRSKSLVQKHQEEGKTRAKKKSKQQPEKEEWVGEHPWKPWDREKDLVAGRQNIKFDSENMAEGLSSRFSSGNFQRNFL
cccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHcHHHHHHcccccccccccccccc
ccccHHcccHHHHHHHHHHHHHccccccHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccccccccHHHHHHcccHHccccccccccccEEEEEccccccccccEccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHccccccccccccccHHHcccccccccccHHHHHccccccccccccHcccc
MVAEAETANEAERFEEVTRImgvegdcpydviganhnmsAENIKKRYWKLSlfvhpdkcphpqaHQAFIKLNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWRKSQGILMEGDDELLAdmevkappkrdewmttlpperkpgggvpmhstktfsrtskegrgdtsvwtdtpsdrAQKAKMNYLEAYSETSALASTEEEKKGARADADLVDKYNKEKRSKSLVQKHQEEGKTRakkkskqqpekeewvgehpwkpwdrekdlvagrqnikfdsenmaEGLSsrfssgnfqrnfl
mvaeaetaneaerfeeVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWRKSQGILMEGDDELLADMEVKappkrdewmttlpperkpgggvpmhstktfsrtskegrgdtsvwtdtpsdraQKAKMNYLEAYSEtsalasteeekkgaradadlvdkynkekrskslvqkhqeegktrakkkskqqpekeewvgehpwkpwdreKDLVAGRQNIKFDsenmaeglssrfssgnfqrnfl
MVAEAETANEAERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWRKSQGILMEGDDELLADMEVKAPPKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWTDTPSDRAQKAKMNYleaysetsalasteeeKKGARADADLVDKYNKEKRSKSLVQKHQEEGKTRAkkkskqqpekeeWVGEHPWKPWDREKDLVAGRQNIKFDSENMAEGLSSRFSSGNFQRNFL
***************EVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKA**************************************************************************************************************************************************************************************************************************************
***************EVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKAFKELQDPEKRKALDE********************GAQWRKSQGILMEGDDELLAD*************************************************************************************************************************************KPWDREKDL********************************
***********ERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWRKSQGILMEGDDELLADMEVKAPPKRDEWMTTLPPERKPGGGVPMHS******************TDTPSDRAQKAKMNYLEAYSE***************ADADLVDKYNKEK********************************EHPWKPWDREKDLVAGRQNIKFDSENMAEGLSSRFSSGNFQRNFL
***********ERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWR***********EL**D****APPK*DEWMTTLPPERKPGGGVPMHSTKTFSRT****RGDTSVWTDTPSDRAQKAKMNYLEAYSETS***********A*ADADLVDKYNKEKRSKSLVQKHQEEGKTRAK***************HPWKPWDREKDLVAG*****************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAEAETANEAERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKAFKELQDPExxxxxxxxxxxxxxxxxxxxxLKAMQEGAQWRKSQGILMEGDDELLADMEVKAPPKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWTDTPSDRAQKAKMNYLEAYSETSALASTEEEKKGARADADLVDKYNKEKRSKSLVQKHQEEGKTRAKKKSKQQPEKEEWVGEHPWKPWDREKDLVAGRQNIKFDSENMAEGLSSRFSSGNFQRNFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query304 2.2.26 [Sep-21-2011]
Q4V893348 Uncharacterized protein K yes no 0.496 0.433 0.352 9e-13
Q69ZC8346 Uncharacterized protein K yes no 0.496 0.436 0.342 8e-12
Q8IXQ4340 Uncharacterized protein K yes no 0.496 0.444 0.347 5e-11
Q5R863344 Uncharacterized protein K yes no 0.496 0.438 0.347 5e-10
O66921376 Chaperone protein DnaJ 2 yes no 0.197 0.159 0.433 1e-07
P56101195 Cysteine string protein O N/A no 0.230 0.358 0.436 2e-07
P87239 528 DnaJ homolog 1, mitochond yes no 0.200 0.115 0.409 5e-07
Q28I38375 DnaJ homolog subfamily B no no 0.197 0.16 0.45 6e-07
Q921R4703 DnaJ homolog subfamily C no no 0.25 0.108 0.382 7e-07
Q7ZXQ8371 DnaJ homolog subfamily B N/A no 0.197 0.161 0.45 9e-07
>sp|Q4V893|K1704_RAT Uncharacterized protein KIAA1704 homolog OS=Rattus norvegicus PE=2 SV=1 Back     alignment and function desciption
 Score = 74.3 bits (181), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 92/187 (49%), Gaps = 36/187 (19%)

Query: 120 LMEGDDELLADMEVKAPPKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWT 179
           L +GDD+         P  R+ WMT LPPE K  G  P    +TF R + +  GD SVWT
Sbjct: 183 LTKGDDD------SPKPVTRESWMTELPPEMKDFGLGP----RTFKRRADDKSGDRSVWT 232

Query: 180 DTPSDRAQKAKMNYLEAYSETSALASTEEEKKGARAD---ADLVDKYNKEKRSKSLVQKH 236
           DTP+DR +KAK    E      +L+  +EE   +  D   A+ V  YN+ KRS+SL+  H
Sbjct: 233 DTPADRERKAK----EIQEARKSLSKKDEENMLSGRDKRLAEQVSSYNESKRSESLMDIH 288

Query: 237 QEEGKTRAKKKSKQQPEKEEWVGEHPWKPWDREKDLVAGRQNIKFDSEN------MAEGL 290
            +  KT+A +   +  E+          P+DR+KDL   R    FD          +  L
Sbjct: 289 HKRLKTKAAEDKNRHQER---------TPFDRDKDLKVNR----FDEAQKKALIKKSREL 335

Query: 291 SSRFSSG 297
           ++RFS G
Sbjct: 336 NTRFSHG 342

Rattus norvegicus (taxid: 10116)
>sp|Q69ZC8|K1704_MOUSE Uncharacterized protein KIAA1704 OS=Mus musculus GN=Kiaa1704 PE=1 SV=2 Back     alignment and function description
>sp|Q8IXQ4|K1704_HUMAN Uncharacterized protein KIAA1704 OS=Homo sapiens GN=KIAA1704 PE=1 SV=1 Back     alignment and function description
>sp|Q5R863|K1704_PONAB Uncharacterized protein KIAA1704 homolog OS=Pongo abelii PE=2 SV=1 Back     alignment and function description
>sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 Back     alignment and function description
>sp|P56101|CSP_TORCA Cysteine string protein OS=Torpedo californica PE=1 SV=1 Back     alignment and function description
>sp|P87239|MDJ1_SCHPO DnaJ homolog 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mdj1 PE=4 SV=1 Back     alignment and function description
>sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 Back     alignment and function description
>sp|Q921R4|DJC14_MOUSE DnaJ homolog subfamily C member 14 OS=Mus musculus GN=Dnajc14 PE=2 SV=2 Back     alignment and function description
>sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
255571754 582 conserved hypothetical protein [Ricinus 0.993 0.518 0.822 1e-134
225460732 571 PREDICTED: uncharacterized protein LOC10 0.950 0.506 0.8 1e-134
356535705 573 PREDICTED: uncharacterized protein LOC10 0.993 0.527 0.761 1e-133
356576153 569 PREDICTED: uncharacterized protein LOC10 0.993 0.530 0.756 1e-127
224146396 584 predicted protein [Populus trichocarpa] 0.953 0.496 0.773 1e-123
449465354 597 PREDICTED: uncharacterized protein LOC10 0.986 0.502 0.749 1e-122
297837907 590 hypothetical protein ARALYDRAFT_475539 [ 0.993 0.511 0.689 1e-121
449496866 596 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.986 0.503 0.742 1e-121
145337191 588 DNAJ heat shock N-terminal domain-contai 0.993 0.513 0.682 1e-120
3335336 605 Contains similarity to DnaJ gene YM8520. 0.993 0.499 0.667 1e-118
>gi|255571754|ref|XP_002526820.1| conserved hypothetical protein [Ricinus communis] gi|223533824|gb|EEF35555.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 251/305 (82%), Positives = 269/305 (88%), Gaps = 3/305 (0%)

Query: 1   MVAEAETANEAERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCP 60
           MVAEAE+ANEAERFEEVTRIM VE D PYDV+G NHNMSAENIKKRYWK+SL VHPDKC 
Sbjct: 280 MVAEAESANEAERFEEVTRIMAVEDDSPYDVVGVNHNMSAENIKKRYWKMSLLVHPDKCS 339

Query: 61  HPQAHQAFIKLNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWRKSQGIL 120
           HPQAHQAFIKLNKAFKELQDP+KRK LDE+IKLKEEQE FKVELKAM+E AQWR+ QGI 
Sbjct: 340 HPQAHQAFIKLNKAFKELQDPDKRKLLDEQIKLKEEQEAFKVELKAMREAAQWRRLQGIS 399

Query: 121 MEGDDELLADMEVKAPPKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWTD 180
           MEGDDELLA+MEVK  P+RDEWMTTLPPERKP  G+ M ST  F + SKEGRGDTSVWTD
Sbjct: 400 MEGDDELLAEMEVKVAPQRDEWMTTLPPERKP--GMTMQSTTRFGKCSKEGRGDTSVWTD 457

Query: 181 TPSDRAQKAKMNYLEAYSETSALASTEEEKKGARADADLVDKYNKEKRSKSLVQKHQEEG 240
           TPSDRAQKAKMNYLEAY+E +AL S EEEK    ADADLVDKYNK KRSKSLVQKHQEE 
Sbjct: 458 TPSDRAQKAKMNYLEAYNEAAALVSNEEEKTKMSADADLVDKYNKAKRSKSLVQKHQEEA 517

Query: 241 KTR-AKKKSKQQPEKEEWVGEHPWKPWDREKDLVAGRQNIKFDSENMAEGLSSRFSSGNF 299
             R  KK  +QQP+KEEWVG+HPWKPWDREKDLVAGRQNIKFDS+NMA+GLSSRFSSGNF
Sbjct: 518 VNRSKKKSKQQQPQKEEWVGQHPWKPWDREKDLVAGRQNIKFDSDNMAQGLSSRFSSGNF 577

Query: 300 QRNFL 304
           QRNFL
Sbjct: 578 QRNFL 582

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225460732|ref|XP_002267868.1| PREDICTED: uncharacterized protein LOC100255442 [Vitis vinifera] gi|147843178|emb|CAN80552.1| hypothetical protein VITISV_004743 [Vitis vinifera] gi|296081144|emb|CBI18170.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356535705|ref|XP_003536384.1| PREDICTED: uncharacterized protein LOC100788598 [Glycine max] Back     alignment and taxonomy information
>gi|356576153|ref|XP_003556198.1| PREDICTED: uncharacterized protein LOC100796738 [Glycine max] Back     alignment and taxonomy information
>gi|224146396|ref|XP_002325992.1| predicted protein [Populus trichocarpa] gi|222862867|gb|EEF00374.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449465354|ref|XP_004150393.1| PREDICTED: uncharacterized protein LOC101213388 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297837907|ref|XP_002886835.1| hypothetical protein ARALYDRAFT_475539 [Arabidopsis lyrata subsp. lyrata] gi|297332676|gb|EFH63094.1| hypothetical protein ARALYDRAFT_475539 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449496866|ref|XP_004160248.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213388 [Cucumis sativus] Back     alignment and taxonomy information
>gi|145337191|ref|NP_176707.3| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] gi|110741606|dbj|BAE98751.1| hypothetical protein [Arabidopsis thaliana] gi|332196232|gb|AEE34353.1| DNAJ heat shock N-terminal domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|3335336|gb|AAC27138.1| Contains similarity to DnaJ gene YM8520.10 gb|825566 from from S. cerevisiae cosmid gb|Z49705. ESTs gb|Z47720 and gb|Z29879 come from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
TAIR|locus:2206285588 AT1G65280 [Arabidopsis thalian 0.993 0.513 0.631 1.7e-105
MGI|MGI:1914717346 1200011I18Rik "RIKEN cDNA 1200 0.549 0.482 0.326 2.6e-13
TAIR|locus:504956462246 AT5G22080 [Arabidopsis thalian 0.378 0.467 0.333 5.7e-11
DICTYBASE|DDB_G0290017176 DDB_G0290017 "DnaJ homolog sub 0.282 0.488 0.37 9.7e-10
ZFIN|ZDB-GENE-040801-212405 zgc:91844 "zgc:91844" [Danio r 0.493 0.370 0.311 3.8e-09
FB|FBgn0037151128 CG7130 [Drosophila melanogaste 0.200 0.476 0.426 6e-09
GENEDB_PFALCIPARUM|PF13_0036322 PF13_0036 "DNAJ protein, putat 0.348 0.329 0.296 8e-09
UNIPROTKB|Q8IEP3322 PF13_0036 "DNAJ protein, putat 0.348 0.329 0.296 8e-09
FB|FBgn0052640132 CG32640 [Drosophila melanogast 0.213 0.492 0.369 1e-08
FB|FBgn0052641132 CG32641 [Drosophila melanogast 0.213 0.492 0.369 1e-08
TAIR|locus:2206285 AT1G65280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1044 (372.6 bits), Expect = 1.7e-105, P = 1.7e-105
 Identities = 197/312 (63%), Positives = 234/312 (75%)

Query:     1 MVAEAETANEAERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCP 60
             +VAE  ++NEAERFEEVTRIM  + + PYDV+G NHNM+A+N+KKRYWKLSL VHPDKC 
Sbjct:   279 VVAEVASSNEAERFEEVTRIMEADANSPYDVLGVNHNMAADNMKKRYWKLSLLVHPDKCS 338

Query:    61 HPQAHQAFIKLNKAFKELQDPEKRKALDEKIKLKEEQEKFKVELKAMQEGAQWRKSQGIL 120
             HPQA +AF+ LNKAFKELQDPEKRKA+D+KIKLKEEQE FKVEL++MQE AQWR+SQGI 
Sbjct:   339 HPQAQEAFVLLNKAFKELQDPEKRKAMDDKIKLKEEQEAFKVELRSMQEAAQWRRSQGIS 398

Query:   121 MEGDDELLADMEVKAPPKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWTD 180
             MEGD ELLA  EVK  PKRDEWMTTLPPERK G  V +  + TFSR ++EGRGDT+ WTD
Sbjct:   399 MEGDAELLAATEVKPEPKRDEWMTTLPPERKVG--VAVQQSTTFSRNAREGRGDTTAWTD 456

Query:   181 TPSDRAQKAKMNYXXXXXXXXXXXXXXXXKKGARADADLVDKYNKEKRSKSLVQKHQEEG 240
             TP D+A++AKMNY                      DA+LVDKYNKEKR+KSLV+KH+E+ 
Sbjct:   457 TPMDKAERAKMNYLEAYNKASALASNEGENMKRSMDAELVDKYNKEKRAKSLVEKHREDS 516

Query:   241 --------KTRAXXXXXXXXXXXXWVGEHPWKPWDREKDLVAGRQNIKFDSENMAEGLSS 292
                     K +             WVG+HPWKPWDRE DL AGRQN+K D++ MAEGL+S
Sbjct:   517 SSSSSRLKKKKKLSSSKEKTEKDEWVGKHPWKPWDRENDLTAGRQNVKLDADGMAEGLAS 576

Query:   293 RFSSGNFQRNFL 304
             +FSSGNFQR+FL
Sbjct:   577 KFSSGNFQRSFL 588
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=ISS
GO:0031072 "heat shock protein binding" evidence=IEA
GO:0007346 "regulation of mitotic cell cycle" evidence=RCA
GO:0010048 "vernalization response" evidence=RCA
MGI|MGI:1914717 1200011I18Rik "RIKEN cDNA 1200011I18 gene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:504956462 AT5G22080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290017 DDB_G0290017 "DnaJ homolog subfamily C member 5B" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-212 zgc:91844 "zgc:91844" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0037151 CG7130 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PF13_0036 PF13_0036 "DNAJ protein, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IEP3 PF13_0036 "DNAJ protein, putative" [Plasmodium falciparum 3D7 (taxid:36329)] Back     alignment and assigned GO terms
FB|FBgn0052640 CG32640 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0052641 CG32641 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
pfam12572148 pfam12572, DUF3752, Protein of unknown function (D 5e-32
pfam0022663 pfam00226, DnaJ, DnaJ domain 6e-16
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 1e-14
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 8e-13
COG0484371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-11
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-10
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 9e-10
PRK14292371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-08
PRK14298377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 5e-08
PRK14276380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 5e-08
PRK14301373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 2e-07
PRK14278378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 2e-07
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 2e-07
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 4e-07
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 5e-07
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 5e-07
PRK14294366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 9e-07
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 1e-06
PRK14287371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 2e-06
PRK14283378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 3e-06
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 5e-06
PRK10767371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 6e-06
PRK14290365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 6e-06
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 7e-06
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 9e-06
PRK14297380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 1e-05
PRK14293374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 1e-05
PRK14280376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 1e-05
PRK14286372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-05
PRK14296372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 2e-05
PRK14300372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 8e-05
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 8e-05
PRK14282369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 9e-05
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 6e-04
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 0.001
>gnl|CDD|221643 pfam12572, DUF3752, Protein of unknown function (DUF3752) Back     alignment and domain information 
 Score =  115 bits (291), Expect = 5e-32
 Identities = 52/157 (33%), Positives = 82/157 (52%), Gaps = 16/157 (10%)

Query: 147 PPERKPGGGVPMHS---TKTFSRTSKEGRGDTSVWTDTPSDRAQKAKMNYLEAYSETSAL 203
           PPER         +    + FS  +K  RGD S WT+TP ++A++ +   L   +  SA 
Sbjct: 1   PPERSDLNSRVDPTKLRNRKFSTGTKSARGDDSSWTETPEEKAKRLQDEVLGVEAGASAP 60

Query: 204 A-STEEEKKGARADADLVDKYNKEKRSKSLVQKHQEEGKTRAKKKSKQQPEKEEWVGEHP 262
           A ++ +  K  +  A  V +YN++KR KSLV++HQ++         +++ +KEE   +  
Sbjct: 61  AAASAKASKRDKEMARKVKEYNEKKRGKSLVEQHQKK---------QKKKKKEEENDDPS 111

Query: 263 WKPWDREKDLVAGRQNIKFDSENM---AEGLSSRFSS 296
            +P+DREKDL  G +  K     +   A  L SRFSS
Sbjct: 112 RRPFDREKDLAVGGKISKAQRRELINKAAELGSRFSS 148

This domain family is found in eukaryotes, and is typically between 140 and 163 amino acids in length. Length = 148
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 304
KOG4188159 consensus Uncharacterized conserved protein [Funct 100.0
PF12572152 DUF3752: Protein of unknown function (DUF3752); In 100.0
COG0484371 DnaJ DnaJ-class molecular chaperone with C-termina 99.89
KOG0713336 consensus Molecular chaperone (DnaJ superfamily) [ 99.87
KOG0712337 consensus Molecular chaperone (DnaJ superfamily) [ 99.8
PRK14296372 chaperone protein DnaJ; Provisional 99.78
PRK14288369 chaperone protein DnaJ; Provisional 99.77
KOG0691296 consensus Molecular chaperone (DnaJ superfamily) [ 99.75
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.75
PRK14286372 chaperone protein DnaJ; Provisional 99.74
PRK14279 392 chaperone protein DnaJ; Provisional 99.73
PRK14287371 chaperone protein DnaJ; Provisional 99.73
PRK14276380 chaperone protein DnaJ; Provisional 99.73
PRK14283378 chaperone protein DnaJ; Provisional 99.72
PRK14299291 chaperone protein DnaJ; Provisional 99.72
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.71
PRK14280376 chaperone protein DnaJ; Provisional 99.71
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.71
PRK14282369 chaperone protein DnaJ; Provisional 99.71
PRK14298377 chaperone protein DnaJ; Provisional 99.71
PRK14291 382 chaperone protein DnaJ; Provisional 99.71
PRK14278378 chaperone protein DnaJ; Provisional 99.7
KOG0717 508 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
PRK14294366 chaperone protein DnaJ; Provisional 99.7
KOG0718 546 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
KOG0716279 consensus Molecular chaperone (DnaJ superfamily) [ 99.7
PRK14277 386 chaperone protein DnaJ; Provisional 99.69
PRK14285365 chaperone protein DnaJ; Provisional 99.69
KOG0719264 consensus Molecular chaperone (DnaJ superfamily) [ 99.69
PRK14297380 chaperone protein DnaJ; Provisional 99.69
PRK14301373 chaperone protein DnaJ; Provisional 99.69
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.69
PRK14284 391 chaperone protein DnaJ; Provisional 99.68
PRK10767371 chaperone protein DnaJ; Provisional 99.67
PRK14295389 chaperone protein DnaJ; Provisional 99.67
PRK14281 397 chaperone protein DnaJ; Provisional 99.66
KOG0715288 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
PRK14300372 chaperone protein DnaJ; Provisional 99.66
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.66
PRK14293374 chaperone protein DnaJ; Provisional 99.65
PRK14292371 chaperone protein DnaJ; Provisional 99.65
PRK14289 386 chaperone protein DnaJ; Provisional 99.64
PRK14290365 chaperone protein DnaJ; Provisional 99.63
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.61
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.58
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.56
PHA03102153 Small T antigen; Reviewed 99.56
KOG0721230 consensus Molecular chaperone (DnaJ superfamily) [ 99.53
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.5
KOG0720490 consensus Molecular chaperone (DnaJ superfamily) [ 99.5
PRK01356166 hscB co-chaperone HscB; Provisional 99.43
PRK05014171 hscB co-chaperone HscB; Provisional 99.43
PRK00294173 hscB co-chaperone HscB; Provisional 99.42
KOG0722329 consensus Molecular chaperone (DnaJ superfamily) [ 99.39
PRK03578176 hscB co-chaperone HscB; Provisional 99.38
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.32
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.29
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.23
KOG1150250 consensus Predicted molecular chaperone (DnaJ supe 99.22
KOG0714306 consensus Molecular chaperone (DnaJ superfamily) [ 99.2
PTZ00100116 DnaJ chaperone protein; Provisional 99.19
PHA02624 647 large T antigen; Provisional 99.14
PRK01773173 hscB co-chaperone HscB; Provisional 99.09
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 98.97
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.91
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.86
KOG0568342 consensus Molecular chaperone (DnaJ superfamily) [ 98.14
KOG1789 2235 consensus Endocytosis protein RME-8, contains DnaJ 98.13
KOG0723112 consensus Molecular chaperone (DnaJ superfamily) [ 97.81
KOG3192168 consensus Mitochondrial J-type chaperone [Posttran 97.35
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.56
KOG0431453 consensus Auxilin-like protein and related protein 96.17
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 95.74
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 93.29
>KOG4188 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information 
Probab=100.00  E-value=7.8e-38  Score=254.90  Aligned_cols=156  Identities=49%  Similarity=0.804  Sum_probs=127.2

Q ss_pred             CCcccccccCCCCCCCCCCCCCCcccccccCCCCCCCCCCCCCCChHHHHHHHHhhhhhhhhhcccccccHHHHhhhhhh
Q 021999          137 PKRDEWMTTLPPERKPGGGVPMHSTKTFSRTSKEGRGDTSVWTDTPSDRAQKAKMNYLEAYSETSALASTEEEKKGARAD  216 (304)
Q Consensus       137 ~~reeWM~~lPp~~~~~~~~~~~~~R~F~~~~~~~~~~~s~WTeTP~ek~~rl~~~~~~~~~~~~~~~~~~~~~~~~~~~  216 (304)
                      |.||+||+.|||....+ |++.+ +|+|.++.-.++||+|+||+||.+|.+|.++..+..+...++..+.+.+..++.++
T Consensus         2 pkReeWMt~lP~e~~~~-gl~~~-~rTFkrga~~~sgd~ssWtdtP~dke~rak~t~~ars~sskale~~~~~~~~~~rd   79 (159)
T KOG4188|consen    2 PKREEWMTTLPPERKVF-GLGQQ-SRTFKRGAREGSGDRSSWTDTPMDKERRAKETYLARSNSSKALESNEGENMKRSRD   79 (159)
T ss_pred             chHHHHHHhCCchhccc-ccccc-chhhhcccccCCCcccccccCcccHHHHHHhhhhhhhhhhHHHHHhhhhhhhhhhh
Confidence            58999999999998765 66654 89999998878899999999999999999888776655444443334444566788


Q ss_pred             HHHHHHHHhhhcChhhHHhhHHhhhhhhhhhcCCCcccccccCCCCCCCCChhhhhhcCcCCc--hhcHHHHhcccCCCC
Q 021999          217 ADLVDKYNKEKRSKSLVQKHQEEGKTRAKKKSKQQPEKEEWVGEHPWKPWDREKDLVAGRQNI--KFDSENMAEGLSSRF  294 (304)
Q Consensus       217 ~~~v~~~~~~~R~~SL~e~Hq~k~~~~~~~~~~~~~~~~~~~~~~~~r~FDrekDm~~~~~~~--~~~~~~ka~~l~sRF  294 (304)
                      +++|+.||+++|++||||+||+++..+.+.         ++...++|||||||+||.|++...  ..+.+.+|+.|++||
T Consensus        80 aeqvs~~nkkkr~eSLvEiHqkk~~sK~kd---------~~~~q~errPfdRekDlkv~r~d~n~kk~avdkak~latkF  150 (159)
T KOG4188|consen   80 AEQVSKYNKKKRAESLVEIHQKKLSSKEKD---------EWKPQHERRPFDREKDLKVNRQDPNQKKDAVDKAKELATKF  150 (159)
T ss_pred             HHHHHHHHhhhcchHHHHHHHHHHhHHHHh---------cccCcccCCCccccccccccccCcchhHHHHHHHHHHHHHh
Confidence            999999999999999999999999865322         122345899999999999999754  456789999999999


Q ss_pred             CCCccccCCC
Q 021999          295 SSGNFQRNFL  304 (304)
Q Consensus       295 ~~g~~~~~FL  304 (304)
                      |+|+|| .||
T Consensus       151 s~gk~q-rfl  159 (159)
T KOG4188|consen  151 SSGKFQ-RFL  159 (159)
T ss_pred             ccCccc-ccC
Confidence            999999 666

>PF12572 DUF3752: Protein of unknown function (DUF3752); InterPro: IPR022226 This domain family is found in eukaryotes, and is typically between 140 and 163 amino acids in length Back     alignment and domain information
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0712 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0691 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0716 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0720 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0722 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG1150 consensus Predicted molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0714 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0568 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789 consensus Endocytosis protein RME-8, contains DnaJ domain [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0723 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192 consensus Mitochondrial J-type chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0431 consensus Auxilin-like protein and related proteins containing DnaJ domain [General function prediction only] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 2e-07
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 8e-07
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 9e-07
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-06
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 4e-06
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 2e-05
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 4e-05
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 5e-05
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 1e-04
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 1e-04
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 2e-04
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure 
Iteration: 1

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
Query: 19 RIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCP-HPQAHQAFIKLNKAFKE 77
          R +   G+  Y V+G + N ++++IKK Y KL+L  HPDK P +P+A   F ++N A   
Sbjct: 10 RSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAI 69
Query: 78 LQDPEKRKALD 88
          L D  KR   D
Sbjct: 70 LTDATKRNIYD 80
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 1e-13
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-11
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 8e-11
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 1e-10
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-10
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 4e-10
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 2e-09
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 3e-09
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 5e-09
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 6e-09
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 6e-09
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 1e-08
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 1e-08
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 1e-08
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 6e-08
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 7e-08
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 9e-08
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 1e-07
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-07
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 2e-07
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 4e-07
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 1e-06
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 2e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-06
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 4e-06
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 6e-06
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 7e-06
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 2e-05
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 4e-05
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 7e-05
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 4e-04
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
 Score = 64.7 bits (158), Expect = 1e-13
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 11 AERFEEVTRIMGVEGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIK 70
           E+ + + RI   +    +D++G     S + + K Y KL++ +HPDKC  P +  AF  
Sbjct: 14 KEQADAIRRIRNSKD--SWDMLGVKPGASRDEVNKAYRKLAVLLHPDKCVAPGSEDAFKA 71

Query: 71 LNKAFKELQDPEKRK 85
          +  A   L    K  
Sbjct: 72 VVNARTALLKNIKSG 86
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Length = 106 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.82
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.81
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.81
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.8
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.8
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.79
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.79
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.78
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.78
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.78
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.78
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.77
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.77
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.77
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.76
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.76
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.75
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.7
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.68
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.66
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.66
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.63
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.62
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.59
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.59
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.59
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.59
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.58
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.56
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.54
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.54
2guz_A71 Mitochondrial import inner membrane translocase su 99.53
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.48
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.89
2guz_B65 Mitochondrial import inner membrane translocase su 98.7
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 87.51
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.82  E-value=2e-20  Score=140.31  Aligned_cols=70  Identities=33%  Similarity=0.527  Sum_probs=66.5

Q ss_pred             CCCcccccCCCCCCCHHHHHHHHHHHHHhhCCCCCCCchHHHHHHHHHHHHHHcCChhhhhHHHHHhhhH
Q 021999           25 GDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQAFIKLNKAFKELQDPEKRKALDEKIKLK   94 (304)
Q Consensus        25 ~~d~Y~iLgv~~~as~~eIkkaYr~l~~~~HPDk~~~~~a~~~f~~i~~Ay~vL~dp~~R~~YD~~~~~~   94 (304)
                      ..|||+||||+++++..+|+++|++|+++||||+++.+.+.+.|+.|++||++|+||.+|..||.++..+
T Consensus         2 ~~~~y~iLgv~~~as~~~Ik~ayr~l~~~~HPD~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~Yd~~~~~~   71 (77)
T 1hdj_A            2 GKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEG   71 (77)
T ss_dssp             CCCSHHHHTCCTTCCHHHHHHHHHHHHHTTCTTTCCCTTHHHHHHHHHHHHHHTTCHHHHHHHHHTCGGG
T ss_pred             CCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCccHHHHHHHHHHHHHHHCCHHHHHHHHHHcccc
Confidence            3689999999999999999999999999999999998889999999999999999999999999998654
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 304
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 3e-09
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 2e-08
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-07
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 2e-07
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 2e-06
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 7e-06
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 3e-04
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 0.004
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 51.5 bits (123), Expect = 3e-09
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 24 EGDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPHPQAHQA----FIKLNKAFKELQ 79
           G+  +  +G    ++ E +KK Y K  L VHPDK       Q     F++LN A+ E +
Sbjct: 31 AGETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFE 90

Query: 80 DPEKRKA 86
          +  ++  
Sbjct: 91 NQGQKPL 97
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.85
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.77
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.73
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.66
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.64
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.57
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.48
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.85  E-value=6.3e-22  Score=146.39  Aligned_cols=69  Identities=26%  Similarity=0.473  Sum_probs=64.6

Q ss_pred             CCCcccccCCCCCCCHHHHHHHHHHHHHhhCCCCCCC-chHHHHHHHHHHHHHHcCChhhhhHHHHHhhh
Q 021999           25 GDCPYDVIGANHNMSAENIKKRYWKLSLFVHPDKCPH-PQAHQAFIKLNKAFKELQDPEKRKALDEKIKL   93 (304)
Q Consensus        25 ~~d~Y~iLgv~~~as~~eIkkaYr~l~~~~HPDk~~~-~~a~~~f~~i~~Ay~vL~dp~~R~~YD~~~~~   93 (304)
                      ..|||+||||+++||..+|++||++++++||||+++. +.+.+.|..|++||+||+||.+|..||.+|..
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~~   71 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHA   71 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTTS
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCcc
Confidence            4799999999999999999999999999999999984 66788999999999999999999999999854
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure