Citrus Sinensis ID: 022005
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 304 | ||||||
| 449438283 | 425 | PREDICTED: DUF21 domain-containing prote | 0.924 | 0.661 | 0.914 | 1e-147 | |
| 255562092 | 425 | conserved hypothetical protein [Ricinus | 0.924 | 0.661 | 0.914 | 1e-146 | |
| 224056311 | 432 | predicted protein [Populus trichocarpa] | 0.940 | 0.662 | 0.881 | 1e-144 | |
| 359475517 | 430 | PREDICTED: DUF21 domain-containing prote | 0.924 | 0.653 | 0.886 | 1e-144 | |
| 357476069 | 425 | Metal transporter CNNM4 [Medicago trunca | 0.924 | 0.661 | 0.889 | 1e-143 | |
| 356524776 | 425 | PREDICTED: DUF21 domain-containing prote | 0.924 | 0.661 | 0.871 | 1e-142 | |
| 42569036 | 423 | CBS and transporter associated domain-co | 0.924 | 0.664 | 0.871 | 1e-140 | |
| 224103813 | 430 | predicted protein [Populus trichocarpa] | 0.924 | 0.653 | 0.868 | 1e-139 | |
| 356521267 | 425 | PREDICTED: DUF21 domain-containing prote | 0.924 | 0.661 | 0.882 | 1e-137 | |
| 449478800 | 425 | PREDICTED: LOW QUALITY PROTEIN: DUF21 do | 0.914 | 0.654 | 0.873 | 1e-137 |
| >gi|449438283|ref|XP_004136918.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 527 bits (1357), Expect = e-147, Method: Compositional matrix adjust.
Identities = 257/281 (91%), Positives = 270/281 (96%)
Query: 1 MAVEYSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAA 60
MAVEY CC F IHI++IV LV+FAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDR HAA
Sbjct: 1 MAVEYECCTPNFFIHILIIVLLVLFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRIHAA 60
Query: 61 KILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVC 120
KILPVV+NQHLLLCTLLICNAAAMEALPIFLD LV+AWGAILISVTLILLFGEIIPQSVC
Sbjct: 61 KILPVVKNQHLLLCTLLICNAAAMEALPIFLDSLVTAWGAILISVTLILLFGEIIPQSVC 120
Query: 121 SRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNE 180
SRYGLAIG+TVAPFVRVLVWIC+PVA+PISKLLD LLGHGRVALFRRAELKTLVNLHGNE
Sbjct: 121 SRYGLAIGATVAPFVRVLVWICFPVAYPISKLLDFLLGHGRVALFRRAELKTLVNLHGNE 180
Query: 181 AGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSR 240
AGKGGELTHDETTIIAGALEL+EKTA DAMTPI+ETFAIDINAKLD+ LMNL+LEKGHSR
Sbjct: 181 AGKGGELTHDETTIIAGALELSEKTAGDAMTPISETFAIDINAKLDRNLMNLVLEKGHSR 240
Query: 241 VPVYYEEPTNIIGLILVKNLLTIHPEDEVPVKSVTIRRIPR 281
VPVYYEEPTNIIGLILVKNLLTIHP+DEVPVKSVTIRRIPR
Sbjct: 241 VPVYYEEPTNIIGLILVKNLLTIHPDDEVPVKSVTIRRIPR 281
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255562092|ref|XP_002522054.1| conserved hypothetical protein [Ricinus communis] gi|223538653|gb|EEF40254.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224056311|ref|XP_002298798.1| predicted protein [Populus trichocarpa] gi|222846056|gb|EEE83603.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|359475517|ref|XP_002272975.2| PREDICTED: DUF21 domain-containing protein At2g14520-like [Vitis vinifera] gi|147815300|emb|CAN61244.1| hypothetical protein VITISV_016135 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357476069|ref|XP_003608320.1| Metal transporter CNNM4 [Medicago truncatula] gi|355509375|gb|AES90517.1| Metal transporter CNNM4 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356524776|ref|XP_003531004.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|42569036|ref|NP_179058.3| CBS and transporter associated domain-containing protein [Arabidopsis thaliana] gi|342179473|sp|Q9ZQR4.2|Y2452_ARATH RecName: Full=DUF21 domain-containing protein At2g14520; AltName: Full=CBS domain-containing protein CBSDUF3 gi|330251214|gb|AEC06308.1| CBS and transporter associated domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224103813|ref|XP_002313203.1| predicted protein [Populus trichocarpa] gi|222849611|gb|EEE87158.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356521267|ref|XP_003529278.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449478800|ref|XP_004155421.1| PREDICTED: LOW QUALITY PROTEIN: DUF21 domain-containing protein At2g14520-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 304 | ||||||
| TAIR|locus:2055155 | 423 | AT2G14520 "AT2G14520" [Arabido | 0.924 | 0.664 | 0.782 | 1.4e-112 | |
| TAIR|locus:2134273 | 424 | AT4G33700 "AT4G33700" [Arabido | 0.924 | 0.662 | 0.761 | 7e-109 | |
| TAIR|locus:2203746 | 527 | AT1G47330 "AT1G47330" [Arabido | 0.924 | 0.533 | 0.572 | 9.4e-82 | |
| TAIR|locus:2149659 | 500 | AT5G52790 "AT5G52790" [Arabido | 0.842 | 0.512 | 0.601 | 8.5e-81 | |
| TAIR|locus:2129540 | 494 | AT4G14240 "AT4G14240" [Arabido | 0.786 | 0.483 | 0.629 | 1.6e-79 | |
| TAIR|locus:2014520 | 499 | AT1G03270 "AT1G03270" [Arabido | 0.786 | 0.478 | 0.608 | 3.9e-76 | |
| TAIR|locus:2129535 | 495 | AT4G14230 "AT4G14230" [Arabido | 0.786 | 0.482 | 0.595 | 3.5e-75 | |
| ASPGD|ASPL0000049101 | 716 | AN1876 [Emericella nidulans (t | 0.786 | 0.333 | 0.448 | 2e-49 | |
| CGD|CAL0000380 | 780 | orf19.6979 [Candida albicans ( | 0.779 | 0.303 | 0.442 | 2.3e-48 | |
| UNIPROTKB|Q59YU4 | 780 | CaO19.6979 "Putative uncharact | 0.779 | 0.303 | 0.442 | 2.3e-48 |
| TAIR|locus:2055155 AT2G14520 "AT2G14520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1111 (396.2 bits), Expect = 1.4e-112, P = 1.4e-112
Identities = 220/281 (78%), Positives = 240/281 (85%)
Query: 1 MAVEYSCCGMGXXXXXXXXXXXXXXAXXXXXXXXXXXXXXXVDLEVLAKSGTPKDRKHAA 60
MAVEY CCG A VDLEVLAKSGTP+DR HAA
Sbjct: 1 MAVEYECCGTSFFIHIAVIVLLVLFAGLMSGLTLGLMSMSLVDLEVLAKSGTPRDRIHAA 60
Query: 61 KILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVC 120
KILPVV+NQHLLLCTLLICNAAAMEALPIFLD LV+AWGAILISVTLILLFGEIIPQSVC
Sbjct: 61 KILPVVKNQHLLLCTLLICNAAAMEALPIFLDALVTAWGAILISVTLILLFGEIIPQSVC 120
Query: 121 SRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNE 180
SR+GLAIG+TVAPFVRVLVWIC PVA+PISKLLD LLGHGRVALFRRAELKTLV+LHGNE
Sbjct: 121 SRHGLAIGATVAPFVRVLVWICLPVAWPISKLLDFLLGHGRVALFRRAELKTLVDLHGNE 180
Query: 181 AGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSR 240
AGKGGELTHDETTIIAGALEL+EK A DAMTPI++TF IDINAKLD++LMNLIL+KGHSR
Sbjct: 181 AGKGGELTHDETTIIAGALELSEKMAKDAMTPISDTFVIDINAKLDRDLMNLILDKGHSR 240
Query: 241 VPVYYEEPTNIIGLILVKNLLTIHPEDEVPVKSVTIRRIPR 281
VPVYYE+ TNIIGL+LVKNLLTI+P++E+ VK+VTIRRIPR
Sbjct: 241 VPVYYEQRTNIIGLVLVKNLLTINPDEEIQVKNVTIRRIPR 281
|
|
| TAIR|locus:2134273 AT4G33700 "AT4G33700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2203746 AT1G47330 "AT1G47330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149659 AT5G52790 "AT5G52790" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129540 AT4G14240 "AT4G14240" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014520 AT1G03270 "AT1G03270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129535 AT4G14230 "AT4G14230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000049101 AN1876 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000380 orf19.6979 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q59YU4 CaO19.6979 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 304 | |||
| COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins con | 3e-41 | |
| pfam01595 | 182 | pfam01595, DUF21, Domain of unknown function DUF21 | 3e-31 | |
| COG4536 | 423 | COG4536, CorB, Putative Mg2+ and Co2+ transporter | 4e-25 | |
| TIGR03520 | 408 | TIGR03520, GldE, gliding motility-associated prote | 3e-18 | |
| COG4535 | 293 | COG4535, CorC, Putative Mg2+ and Co2+ transporter | 3e-10 | |
| cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain | 5e-09 | |
| PRK15094 | 292 | PRK15094, PRK15094, magnesium/cobalt efflux protei | 5e-06 | |
| PRK11573 | 413 | PRK11573, PRK11573, hypothetical protein; Provisio | 9e-05 |
| >gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
Score = 147 bits (373), Expect = 3e-41
Identities = 73/284 (25%), Positives = 135/284 (47%), Gaps = 21/284 (7%)
Query: 13 IIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLL 72
I+ +++I+ L+ + S L+S+ LE LA+ G + A L ++ +
Sbjct: 4 ILTLLLILLLIALSAFFSAAEFALVSLRRSRLEQLAEEGNKR----AKAALKLIERLNRY 59
Query: 73 LCTLLICN-----------AAAMEAL--PIFLDGLVSAWGAILISVTLILLFGEIIPQSV 119
L T+ + A+ AL P+ +SA + I L ++FGE++P+S+
Sbjct: 60 LSTVQLGITLVSLLLGAVGEPALAALLEPLLEALGLSAALSFAIITFLHVVFGELVPKSI 119
Query: 120 CSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHG- 178
R + +AP +R + YP+ + ++++ + +L V L +
Sbjct: 120 AIRNPEKVALLIAPPLRFFYRLLYPLIWLLNRIANAILRLFGVEPVEEEALTSTEEELEL 179
Query: 179 -NEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKG 237
+E+ + G L +E +I L+L ++T + MTP + A+D+ ++ EL+ LILE G
Sbjct: 180 VSESAEEGVLEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESG 238
Query: 238 HSRVPVYYEEPTNIIGLILVKNLLTIHPEDE-VPVKSVTIRRIP 280
HSR+PVY + NIIG++ VK+LL + + V +R
Sbjct: 239 HSRIPVYDGDLDNIIGIVHVKDLLRALLDGQSDLDLRVLVRPPL 282
|
Length = 429 |
| >gnl|CDD|216595 pfam01595, DUF21, Domain of unknown function DUF21 | Back alignment and domain information |
|---|
| >gnl|CDD|226911 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >gnl|CDD|226910 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236933 PRK11573, PRK11573, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 304 | |||
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 100.0 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 100.0 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 100.0 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 100.0 | |
| PF01595 | 183 | DUF21: Domain of unknown function DUF21; InterPro: | 99.97 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 99.95 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.88 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 99.86 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.24 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.24 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.14 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.06 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.02 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.01 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 98.88 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.85 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 98.75 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 98.75 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 98.71 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 98.69 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 98.68 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 98.68 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.67 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 98.67 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 98.66 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 98.63 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 98.63 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 98.62 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 98.61 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 98.61 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 98.59 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 98.58 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 98.58 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 98.56 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 98.56 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 98.56 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 98.53 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.53 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 98.53 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 98.53 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 98.53 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 98.52 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 98.5 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 98.5 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 98.5 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 98.49 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 98.49 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 98.48 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 98.48 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 98.48 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 98.47 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 98.47 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 98.47 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 98.47 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 98.46 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 98.45 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 98.45 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 98.44 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 98.44 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 98.44 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 98.44 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 98.43 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 98.43 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 98.42 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 98.42 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 98.42 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 98.41 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 98.4 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 98.39 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 98.39 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 98.39 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 98.38 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 98.38 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 98.38 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 98.36 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 98.36 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 98.36 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 98.35 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 98.35 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 98.33 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 98.33 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 98.33 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 98.28 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 98.28 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 98.27 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 98.24 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 98.22 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 98.21 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 98.18 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 98.17 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.13 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 98.11 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 98.09 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.09 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 98.06 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 98.05 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 98.03 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 98.02 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 97.89 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 97.88 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 97.88 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.86 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.85 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.85 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.82 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 97.81 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.78 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.77 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.77 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.76 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 97.75 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.73 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 97.73 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 97.73 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 97.72 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.71 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.7 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 97.69 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 97.69 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.68 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 97.68 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.68 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 97.68 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 97.67 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 97.67 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 97.67 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 97.66 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 97.65 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 97.65 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 97.64 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 97.64 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.63 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 97.61 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.61 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 97.61 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 97.6 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 97.6 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 97.6 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 97.6 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 97.59 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 97.58 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 97.58 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 97.58 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.57 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 97.57 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 97.56 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.56 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.55 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 97.52 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.51 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 97.49 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 97.49 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 97.48 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 97.47 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.46 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 97.41 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 97.4 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 97.39 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.38 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 97.37 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 97.35 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 97.34 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 97.33 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 97.32 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 97.32 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.3 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 97.28 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 97.27 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 97.17 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 97.14 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 97.12 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 97.1 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 96.97 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 96.97 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 96.96 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 96.9 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 96.88 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 96.75 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 96.75 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 96.73 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 96.09 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 96.03 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 95.87 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 95.62 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 95.53 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 95.5 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 95.27 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 94.26 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 94.11 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 94.06 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 94.02 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 93.95 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 93.82 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 93.47 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 87.9 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 86.59 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 86.13 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 85.53 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 82.79 |
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-56 Score=403.13 Aligned_cols=277 Identities=25% Similarity=0.381 Sum_probs=243.6
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHcCChhhHHHHHHHHHHHHchhHHHHHHHHHHHHHHHHHHHHH
Q 022005 12 FIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFL 91 (304)
Q Consensus 12 ~~~~~~~~~~ll~lsa~fs~~E~Al~s~~~~rl~~l~~~g~~~~~~~a~~~~~l~~~~~~~l~t~lign~~~~~~~~~~~ 91 (304)
.|..++++++|+++||||||+|||++++||.|++.++++|+++ |+++.+++++|++++++++||||++|+..+.+.
T Consensus 2 ~~~l~~~iiili~iSAfFSgSETal~a~nr~Rlr~la~~G~~~----Akrv~kLL~k~drlig~iLIGNNLvNilasala 77 (423)
T COG4536 2 TWILIIAIIILIIISAFFSGSETALTALNRYRLRHLAKQGNRG----AKRVEKLLEKPDRLIGTILIGNNLVNILASALA 77 (423)
T ss_pred cchHHHHHHHHHHHHHHhcccHHHHhhccHHHHHHHHHccchh----hHHHHHHhcCchheeeeeeecccHHHHHHHHHH
Confidence 4788889999999999999999999999999999999999964 789999999999999999999999998655433
Q ss_pred h----HHHH---HHHHHHHHhHHHHhhhhhhhHHHHHHhhHHHHHhHhHHHHHHHHHHHHHHHHHHHHHHH---HhcCCC
Q 022005 92 D----GLVS---AWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDV---LLGHGR 161 (304)
Q Consensus 92 ~----~~~~---~~~a~l~~~~l~lvfgEiiPK~la~~~~~~i~~~~a~~l~~~~~l~~P~~~~~~~~~~~---l~~~~~ 161 (304)
+ .++| ..+|+.++|+++++|+|++||++|+.|||+++..+++++.++.++|+|++|+++++++. +||.+.
T Consensus 78 T~~~irl~Gd~GvaIAt~~mT~vilvFaEVlPKt~Aa~~perva~~~s~~l~~l~~l~~Plv~lln~it~~llrl~gi~~ 157 (423)
T COG4536 78 TILGIRLYGDAGVAIATGVLTFVILVFAEVLPKTIAALYPERVALPSSFILAILVRLFGPLVWLLNAITRRLLRLLGINL 157 (423)
T ss_pred HHHHHHHhccchHHHHHHHHHHHHHHHHHhcchHHhhhChhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcCc
Confidence 2 2333 23577788999999999999999999999999999999999999999999999988765 466542
Q ss_pred ----cccccHHHHHHHHHhhcccccCCCCCChhHHHHHhhhhccccccccccccccceEEEEeCCCCccHHHHHHHHhcC
Q 022005 162 ----VALFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKG 237 (304)
Q Consensus 162 ----~~~~s~eEl~~lv~~~~~e~~~~g~l~~~e~~~i~~~l~l~~~~V~diMtpr~~v~~l~~~~t~~~e~~~~~~~~~ 237 (304)
+...|.||+|.+++. ++++|...+++++|+-+++++++++|+|||+||.++..++.|++++ ++++.+.++.
T Consensus 158 ~~~~~~~~s~EElR~~v~~----~~~e~~~~~~~rdmL~gvLDLe~~tV~DIMvpR~~i~~id~d~~~e-~iv~ql~~s~ 232 (423)
T COG4536 158 DQAVSQLSSKEELRTAVNE----SGSEGSVNKIDRDMLLGVLDLENLTVSDIMVPRNEIIGIDIDDPWE-EIVRQLLHSP 232 (423)
T ss_pred ccccccccCHHHHHHHHHH----hhcccccccccHHHHhcccccccceeeeeeccccceeeecCCCCHH-HHHHHHhhCC
Confidence 346799999999994 4445777788999999999999999999999999999999999998 9999999999
Q ss_pred CceeeeeeCCCCcEEEEEEechhcccCCccc-c---CcccccccccceecCCCCCchhHHHHHHHHHhhc
Q 022005 238 HSRVPVYYEEPTNIIGLILVKNLLTIHPEDE-V---PVKSVTIRRIPRYLISLGKCSCALFRSLSLFSTS 303 (304)
Q Consensus 238 ~sr~PV~~~~~~~ivGiv~~kDll~~~~~~~-~---~v~~~~~~~~~~v~~~~~~~~~~l~~~l~~m~~~ 303 (304)
|+|+|||+++.|+++|++|.||+++...+.+ . ++..+ .++|+|||++++ +.+.|..||++
T Consensus 233 HtRiplyr~~~DnIiGvlh~r~llr~l~e~~~~~k~d~~~~-a~epyFVPe~Tp-----l~~QL~~F~~~ 296 (423)
T COG4536 233 HTRIPLYRDDLDNIIGVLHVRDLLRLLNEKNEFTKEDILRA-ADEPYFVPEGTP-----LSDQLVAFQRN 296 (423)
T ss_pred CCceeeecCChhHhhhhhhHHHHHHHhhccCcccHhHHHHH-hcCCeecCCCCc-----HHHHHHHHHHh
Confidence 9999999999999999999999998764432 2 33333 589999999999 99999999875
|
|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >PF01595 DUF21: Domain of unknown function DUF21; InterPro: IPR002550 This transmembrane region has no known function | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 304 | ||||
| 3jtf_A | 129 | The Cbs Domain Pair Structure Of A Magnesium And Co | 9e-06 | ||
| 4hg0_A | 292 | Crystal Structure Of Magnesium And Cobalt Efflux Pr | 5e-05 | ||
| 3lhh_A | 172 | The Crystal Structure Of Cbs Domain Protein From Sh | 5e-04 |
| >pdb|3JTF|A Chain A, The Cbs Domain Pair Structure Of A Magnesium And Cobalt Efflux Protein From Bordetella Parapertussis In Complex With Amp Length = 129 | Back alignment and structure |
|
| >pdb|4HG0|A Chain A, Crystal Structure Of Magnesium And Cobalt Efflux Protein Corc, Northeast Structural Genomics Consortium (nesg) Target Er40 Length = 292 | Back alignment and structure |
| >pdb|3LHH|A Chain A, The Crystal Structure Of Cbs Domain Protein From Shewanella Oneidensis Mr-1 Length = 172 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 304 | |||
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 1e-22 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 4e-22 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 9e-21 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 1e-20 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 2e-19 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 9e-17 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 6e-16 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 1e-15 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 3e-15 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 2e-14 |
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Length = 156 | Back alignment and structure |
|---|
Score = 91.0 bits (227), Expect = 1e-22
Identities = 20/109 (18%), Positives = 48/109 (44%), Gaps = 6/109 (5%)
Query: 167 RAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLD 226
++ L+ +A + D + L+ ++ DAM + + N ++
Sbjct: 5 AEDVLNLLR----QAHEQEVFDADTLLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIE 60
Query: 227 KELMNLILEKGHSRVPVYYEEPTNIIGLILVKNLLT-IHPEDEVPVKSV 274
+ +++ HSR PV E+ ++G++ K+LL + ++ +KS+
Sbjct: 61 -RITAYVIDTAHSRFPVIGEDKDEVLGILHAKDLLKYMFNPEQFHLKSI 108
|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Length = 172 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Length = 148 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Length = 173 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Length = 153 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Length = 129 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Length = 130 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Length = 130 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Length = 136 | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Length = 127 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 304 | |||
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.86 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.82 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.76 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.74 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.65 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.59 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.57 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.55 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.54 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.53 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.51 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.51 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.46 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.46 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.43 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.42 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.4 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.4 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.39 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.38 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.37 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.35 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.32 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.3 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.29 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.29 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.28 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.27 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.26 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.25 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.25 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.25 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.22 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.21 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.21 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.2 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.19 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.18 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.16 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.16 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.16 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.16 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.15 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.12 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.12 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.11 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.1 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.09 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.07 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.05 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.04 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.02 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.0 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.0 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 98.97 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 98.95 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 98.95 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.91 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.89 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.88 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 98.83 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.8 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 98.79 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 98.78 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 98.75 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.63 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 98.58 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 98.58 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 98.56 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.51 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.48 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.39 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 98.38 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 98.38 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.37 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.37 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 98.34 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.29 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.28 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 98.28 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.27 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.27 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 98.27 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.25 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.24 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.23 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.23 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.22 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.22 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.22 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.22 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 98.21 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 98.2 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 98.2 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.19 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 98.19 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.19 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.18 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.13 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.13 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 98.09 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.09 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.09 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.06 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.03 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.01 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 97.98 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 97.95 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 97.93 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.9 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 97.85 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 97.84 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 97.81 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 97.79 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 97.74 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 97.66 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.66 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.62 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 97.61 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 97.41 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 97.38 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 97.3 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.29 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 97.14 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 97.0 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 96.9 |
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
Probab=99.86 E-value=1.3e-21 Score=161.45 Aligned_cols=129 Identities=19% Similarity=0.264 Sum_probs=116.1
Q ss_pred cccHHHHHHHHHhhcccccCCCCCChhHHHHHhhhhccccccccccccccceEEEEeCCCCccHHHHHHHHhcCCceeee
Q 022005 164 LFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPV 243 (304)
Q Consensus 164 ~~s~eEl~~lv~~~~~e~~~~g~l~~~e~~~i~~~l~l~~~~V~diMtpr~~v~~l~~~~t~~~e~~~~~~~~~~sr~PV 243 (304)
.+|++||+.+++. +.++|.++++|++++++++++.+.+|+|+|+|+.+++++++++++. ++++.+.+++++++||
T Consensus 2 ~~t~~el~~li~~----~~~~g~l~~~e~~~i~~~~~l~~~~v~diM~~~~~~~~v~~~~~i~-~a~~~m~~~~~~~~pV 76 (156)
T 3oi8_A 2 NASAEDVLNLLRQ----AHEQEVFDADTLLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIE-RITAYVIDTAHSRFPV 76 (156)
T ss_dssp CCCHHHHHHHHHH----HHHTTSSCHHHHHHHHHHHHHTTCBGGGTCEEGGGCCCEETTCCHH-HHHHHHHHHCCSEEEE
T ss_pred CCCHHHHHHHHHh----HHhcCCcCHHHHHHHHHHhccCCCCHhheeeeHHHeEEECCCCCHH-HHHHHHHHCCCCEEEE
Confidence 4789999999984 4557999999999999999999999999999998999999999998 9999999999999999
Q ss_pred eeCCCCcEEEEEEechhcccCCc-cccCcccccccccceecCCCCCchhHHHHHHHHHhhc
Q 022005 244 YYEEPTNIIGLILVKNLLTIHPE-DEVPVKSVTIRRIPRYLISLGKCSCALFRSLSLFSTS 303 (304)
Q Consensus 244 ~~~~~~~ivGiv~~kDll~~~~~-~~~~v~~~~~~~~~~v~~~~~~~~~~l~~~l~~m~~~ 303 (304)
++++.|+++|+|+.+|+++...+ ...+++++| +++.+++++++ +.++++.|+++
T Consensus 77 vd~~~~~lvGivt~~dl~~~~~~~~~~~v~~im-~~~~~v~~~~~-----l~~a~~~m~~~ 131 (156)
T 3oi8_A 77 IGEDKDEVLGILHAKDLLKYMFNPEQFHLKSIL-RPAVFVPEGKS-----LTALLKEFREQ 131 (156)
T ss_dssp ESSSTTCEEEEEEGGGGGGGSSCGGGCCHHHHC-BCCCEEETTSB-----HHHHHHHHHHT
T ss_pred EcCCCCcEEEEEEHHHHHHHHHcCCcccHHHHc-CCCEEECCCCC-----HHHHHHHHHhc
Confidence 98754699999999999987543 456899995 78999999999 99999999764
|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 304 | ||||
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 4e-05 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 0.002 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 0.003 |
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 41.0 bits (95), Expect = 4e-05
Identities = 7/68 (10%), Positives = 27/68 (39%), Gaps = 1/68 (1%)
Query: 201 LTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVKNL 260
+ D + ++ D + ++ K+ ++ G P++ + + +G++ + +
Sbjct: 10 MKSHRCYDLIPTSSKLVVFDTSLQV-KKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDF 68
Query: 261 LTIHPEDE 268
+ I
Sbjct: 69 INILHRYY 76
|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 304 | |||
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.52 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.39 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.33 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.33 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.31 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.31 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.3 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.3 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.29 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.28 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.28 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.27 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.22 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.21 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.08 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.07 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.07 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.07 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.07 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.06 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.98 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.98 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.94 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.9 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.89 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 98.75 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 98.59 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.52 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.51 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.5 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.46 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 98.39 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 98.39 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.31 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.3 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.3 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.29 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.25 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.23 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.2 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 98.19 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 98.18 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.1 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.1 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.07 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.05 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.96 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 97.91 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 97.89 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.84 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 97.77 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.52 |
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Hypothetical protein YkuL species: Bacillus subtilis [TaxId: 1423]
Probab=99.52 E-value=2.9e-15 Score=118.13 Aligned_cols=94 Identities=18% Similarity=0.322 Sum_probs=82.8
Q ss_pred cccccccccccceEEEEeCCCCccHHHHHHHHhcCCceeeeeeCCCCcEEEEEEechhcccCCc---------cccCccc
Q 022005 203 EKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVKNLLTIHPE---------DEVPVKS 273 (304)
Q Consensus 203 ~~~V~diMtpr~~v~~l~~~~t~~~e~~~~~~~~~~sr~PV~~~~~~~ivGiv~~kDll~~~~~---------~~~~v~~ 273 (304)
+.+|+|+|+|.++++++++++|++ ++++.|.++||+++||+|++ |+++|+++.+|+++.... ...++++
T Consensus 1 e~tv~~~mip~~~v~~v~~~~tl~-~a~~~m~~~~~s~~pVvd~~-~~~vGiit~~di~~~~~~~~~~~~~~~~~~~v~~ 78 (132)
T d1yava3 1 EATVGQFMIEADKVAHVQVGNNLE-HALLVLTKTGYTAIPVLDPS-YRLHGLIGTNMIMNSIFGLERIEFEKLDQITVEE 78 (132)
T ss_dssp TCBHHHHSEEGGGSCCEETTCBHH-HHHHHHHHHCCSEEEEECTT-CBEEEEEEHHHHHHHHBCSSSBCGGGTTTSBHHH
T ss_pred CCCHHHccccccceEEEcCCCCHH-HHHHHHHhhCCCceEEeecc-cccccEEEcchhHHHhhccccccccccccccccc
Confidence 468999999999999999999998 99999999999999999865 899999999999864211 2357888
Q ss_pred ccccccceecCCCCCchhHHHHHHHHHhhc
Q 022005 274 VTIRRIPRYLISLGKCSCALFRSLSLFSTS 303 (304)
Q Consensus 274 ~~~~~~~~v~~~~~~~~~~l~~~l~~m~~~ 303 (304)
+|.+++.+++++++ +.++++.|.++
T Consensus 79 ~m~~~~~~v~~~~~-----l~~~~~~~~~~ 103 (132)
T d1yava3 79 VMLTDIPRLHINDP-----IMKGFGMVINN 103 (132)
T ss_dssp HSBCSCCEEETTSB-----HHHHHHHTTTC
T ss_pred cccccccccccchh-----HHHHHHHHHhC
Confidence 98889999999999 99999999754
|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|