Citrus Sinensis ID: 022076
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 303 | ||||||
| 255545170 | 318 | DNA binding protein, putative [Ricinus c | 0.940 | 0.896 | 0.756 | 1e-118 | |
| 307135909 | 280 | MYB transcription factor [Cucumis melo s | 0.907 | 0.982 | 0.708 | 1e-112 | |
| 224079756 | 317 | predicted protein [Populus trichocarpa] | 0.947 | 0.905 | 0.721 | 1e-112 | |
| 295883125 | 324 | putative MYB transcription factor [Rosa | 0.957 | 0.895 | 0.734 | 1e-112 | |
| 358248018 | 301 | uncharacterized protein LOC100783949 [Gl | 0.917 | 0.923 | 0.708 | 1e-112 | |
| 359490474 | 337 | PREDICTED: transcription factor ASG4-lik | 0.940 | 0.845 | 0.702 | 1e-111 | |
| 388501910 | 306 | unknown [Lotus japonicus] | 0.897 | 0.888 | 0.697 | 1e-109 | |
| 356576006 | 304 | PREDICTED: transcription factor ASG4 [Gl | 0.924 | 0.921 | 0.696 | 1e-109 | |
| 449456325 | 311 | PREDICTED: transcription factor ASG4-lik | 0.904 | 0.881 | 0.700 | 1e-109 | |
| 356534101 | 314 | PREDICTED: LOW QUALITY PROTEIN: transcri | 0.920 | 0.888 | 0.675 | 1e-108 |
| >gi|255545170|ref|XP_002513646.1| DNA binding protein, putative [Ricinus communis] gi|223547554|gb|EEF49049.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 431 bits (1108), Expect = e-118, Method: Compositional matrix adjust.
Identities = 227/300 (75%), Positives = 244/300 (81%), Gaps = 15/300 (5%)
Query: 1 MVSKIPNPAEGFYLDPNGMALPGLGPFASSATTPTAAAAAAGTSTVSTSEDPSKKIRKPY 60
MVSK PNP EGFYLDPNGMALPGLGPFA A TST S+SEDPSKKIRKPY
Sbjct: 1 MVSKNPNPPEGFYLDPNGMALPGLGPFA-------TTAPTTTTSTTSSSEDPSKKIRKPY 53
Query: 61 TITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTA 120
TITKSRESWTEPEHDKFLEALQLFDRDWKKIEAF+GSKTVIQIRSHAQKYFLKVQK+G
Sbjct: 54 TITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFVGSKTVIQIRSHAQKYFLKVQKSGAN 113
Query: 121 EHLPPPRPKRKAAHPYPQKASKNAPMLSQVSGSFQSSSAQLEPGHFLRPDSSSMLMIPMA 180
EHLPPPRPKRKAAHPYPQKASKNA ML Q S SFQSSSA LEPG+ RPDSSSM P+
Sbjct: 114 EHLPPPRPKRKAAHPYPQKASKNAQMLLQPSVSFQSSSALLEPGYIRRPDSSSMPTNPIT 173
Query: 181 S-AATSWTNNVQTVSLSPASKGPEVANNRSNSTDSTPKARVSGELTDQGGELTDQGNNSH 239
S AA SWTNN+ VS S +KGP V NN +ST+STP+ T GE + GN+SH
Sbjct: 174 SAAAASWTNNLPAVSFSNQAKGPIVTNNCCSSTESTPR-------TKPIGETAELGNHSH 226
Query: 240 PLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSINLTSPDFEDH 299
PLRVLPDF QVY+FIGSVFDPNA+ H+Q+LKKMDPIDVETVLLLMRNLS+NLTS DFEDH
Sbjct: 227 PLRVLPDFVQVYSFIGSVFDPNATGHLQRLKKMDPIDVETVLLLMRNLSVNLTSSDFEDH 286
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|307135909|gb|ADN33772.1| MYB transcription factor [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|224079756|ref|XP_002305938.1| predicted protein [Populus trichocarpa] gi|222848902|gb|EEE86449.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|295883125|gb|ADG56764.1| putative MYB transcription factor [Rosa rugosa] | Back alignment and taxonomy information |
|---|
| >gi|358248018|ref|NP_001240048.1| uncharacterized protein LOC100783949 [Glycine max] gi|255634506|gb|ACU17617.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359490474|ref|XP_002273319.2| PREDICTED: transcription factor ASG4-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388501910|gb|AFK39021.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356576006|ref|XP_003556126.1| PREDICTED: transcription factor ASG4 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449456325|ref|XP_004145900.1| PREDICTED: transcription factor ASG4-like [Cucumis sativus] gi|449497272|ref|XP_004160358.1| PREDICTED: transcription factor ASG4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356534101|ref|XP_003535596.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor ASG4-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 303 | ||||||
| TAIR|locus:2149589 | 331 | AT5G52660 [Arabidopsis thalian | 0.947 | 0.867 | 0.577 | 4.1e-81 | |
| TAIR|locus:2124928 | 303 | AT4G01280 [Arabidopsis thalian | 0.933 | 0.933 | 0.470 | 7.3e-59 | |
| TAIR|locus:2025411 | 287 | ASG4 "ALTERED SEED GERMINATION | 0.376 | 0.397 | 0.632 | 1.1e-56 | |
| TAIR|locus:2075049 | 298 | RVE8 "REVEILLE 8" [Arabidopsis | 0.792 | 0.805 | 0.524 | 2.3e-55 | |
| TAIR|locus:2151251 | 293 | LCL1 "LHY/CCA1-like 1" [Arabid | 0.798 | 0.825 | 0.512 | 4.3e-54 | |
| DICTYBASE|DDB_G0288783 | 423 | mybG "myb domain-containing pr | 0.234 | 0.167 | 0.774 | 5.7e-38 | |
| TAIR|locus:2044345 | 608 | CCA1 "circadian clock associat | 0.237 | 0.118 | 0.597 | 3e-21 | |
| TAIR|locus:2167210 | 387 | RVE1 "REVEILLE 1" [Arabidopsis | 0.227 | 0.178 | 0.608 | 1.1e-19 | |
| TAIR|locus:2169135 | 287 | RVE2 "REVEILLE 2" [Arabidopsis | 0.207 | 0.219 | 0.634 | 2.5e-19 | |
| TAIR|locus:504955668 | 336 | AT3G10113 [Arabidopsis thalian | 0.198 | 0.178 | 0.616 | 1.4e-18 |
| TAIR|locus:2149589 AT5G52660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 814 (291.6 bits), Expect = 4.1e-81, P = 4.1e-81
Identities = 179/310 (57%), Positives = 201/310 (64%)
Query: 1 MVSKIPNPAEGFYLDPNGMALPGLGP-FXXXXXXXXXXXXXXXXXX--------XXXXED 51
MVS+ N ++G++LDP GM +PGLGP F ED
Sbjct: 1 MVSR--N-SDGYFLDPTGMTVPGLGPSFTAAVSSSSSPTTSSTAVAVADVTAMVSSSEED 57
Query: 52 PSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF 111
SKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF
Sbjct: 58 LSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYF 117
Query: 112 LKVQKNGTAEHLXXXXXXXXXXXXXXQKASKNAPMLXXXXXXXXXXXXXLEPGHFLRPDS 171
LKVQK+GT EHL QKA KN + +P RP+S
Sbjct: 118 LKVQKSGTGEHLPPPRPKRKAAHPYPQKAHKNVQLQVPGSFKSTSEPN--DPSFMFRPES 175
Query: 172 SSMLMI-PMASAATSWTNNVQTVSLSPASKGPEVANNR-SNSTDSTPKARVSGELTDQGG 229
SSMLM P +AA WTNN QT+S +P K ANN S+S+++TP+ R
Sbjct: 176 SSMLMTSPTTAAAAPWTNNAQTISFTPLPKAGAGANNNCSSSSENTPRPR-------SNR 228
Query: 230 ELTDQGNNSHPLRVLPDFAQVYTFIGSVFDPNASDHVQKLKKMDPIDVETVLLLMRNLSI 289
+ D GN H LRVLPDFAQVY FIGSVFDP AS+H+QKLKKMDPIDVETVLLLMRNLSI
Sbjct: 229 DARDHGNVGHSLRVLPDFAQVYGFIGSVFDPYASNHLQKLKKMDPIDVETVLLLMRNLSI 288
Query: 290 NLTSPDFEDH 299
NL+SPDFEDH
Sbjct: 289 NLSSPDFEDH 298
|
|
| TAIR|locus:2124928 AT4G01280 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025411 ASG4 "ALTERED SEED GERMINATION 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075049 RVE8 "REVEILLE 8" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151251 LCL1 "LHY/CCA1-like 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0288783 mybG "myb domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044345 CCA1 "circadian clock associated 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167210 RVE1 "REVEILLE 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2169135 RVE2 "REVEILLE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:504955668 AT3G10113 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00037734001 | SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (325 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 303 | |||
| TIGR01557 | 57 | TIGR01557, myb_SHAQKYF, myb-like DNA-binding domai | 2e-16 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 4e-10 | |
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 2e-08 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 5e-08 |
| >gnl|CDD|130620 TIGR01557, myb_SHAQKYF, myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Score = 71.7 bits (176), Expect = 2e-16
Identities = 25/57 (43%), Positives = 31/57 (54%), Gaps = 6/57 (10%)
Query: 64 KSRESWTEPEHDKFLEALQLFDR-DW---KKI-EAFIGSK-TVIQIRSHAQKYFLKV 114
K R WTE HD+FL+A+Q DW K+I E + T Q+ SH QKY LK
Sbjct: 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLKQ 57
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. Length = 57 |
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 303 | |||
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 99.62 | |
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 99.5 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 99.47 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 99.19 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 99.15 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 99.03 | |
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 98.96 | |
| KOG0457 | 438 | consensus Histone acetyltransferase complex SAGA/A | 98.81 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.67 | |
| KOG1279 | 506 | consensus Chromatin remodeling factor subunit and | 98.63 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 98.62 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.58 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 98.46 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.29 | |
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 98.21 | |
| KOG0048 | 238 | consensus Transcription factor, Myb superfamily [T | 98.16 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 97.58 | |
| PLN03162 | 526 | golden-2 like transcription factor; Provisional | 97.24 | |
| KOG4468 | 782 | consensus Polycomb-group transcriptional regulator | 96.74 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 96.58 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 96.45 | |
| KOG4329 | 445 | consensus DNA-binding protein [General function pr | 96.19 | |
| KOG0051 | 607 | consensus RNA polymerase I termination factor, Myb | 95.52 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 95.52 | |
| KOG0049 | 939 | consensus Transcription factor, Myb superfamily [T | 95.44 | |
| KOG0724 | 335 | consensus Zuotin and related molecular chaperones | 95.29 | |
| KOG3841 | 455 | consensus TEF-1 and related transcription factor, | 94.13 | |
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 94.12 | |
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 94.07 | |
| KOG3554 | 693 | consensus Histone deacetylase complex, MTA1 compon | 93.8 | |
| KOG4167 | 907 | consensus Predicted DNA-binding protein, contains | 93.66 | |
| KOG1194 | 534 | consensus Predicted DNA-binding protein, contains | 93.51 | |
| PF13873 | 78 | Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | 93.33 | |
| PF09111 | 118 | SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain | 92.05 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 91.79 | |
| smart00426 | 68 | TEA TEA domain. | 91.43 | |
| COG5147 | 512 | REB1 Myb superfamily proteins, including transcrip | 90.39 | |
| KOG0050 | 617 | consensus mRNA splicing protein CDC5 (Myb superfam | 90.22 | |
| PF12776 | 96 | Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; | 87.48 | |
| KOG4282 | 345 | consensus Transcription factor GT-2 and related pr | 86.34 | |
| PF01285 | 431 | TEA: TEA/ATTS domain family; InterPro: IPR000818 T | 85.11 | |
| PF08914 | 65 | Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 | 82.74 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 81.62 |
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
Probab=99.62 E-value=5.5e-16 Score=115.22 Aligned_cols=50 Identities=48% Similarity=0.716 Sum_probs=46.1
Q ss_pred cCCCCCCHHHHHHHHHHHHHcCc-hH---HHHHHHhC-CC-CHHHHHHHHHHHHHH
Q 022076 64 KSRESWTEPEHDKFLEALQLFDR-DW---KKIEAFIG-SK-TVIQIRSHAQKYFLK 113 (303)
Q Consensus 64 k~r~~WT~EEh~lFLeaLe~yGr-dW---kkIA~~Vg-TR-T~~QIrSHaQKYf~k 113 (303)
|.+..||+|||.+||+||+.||+ +| ++|+++++ ++ |..||+||+||||++
T Consensus 1 k~r~~WT~eeh~~Fl~ai~~~G~g~~a~pk~I~~~~~~~~lT~~qV~SH~QKy~~k 56 (57)
T TIGR01557 1 KPRVVWTEDLHDRFLQAVQKLGGPDWATPKRILELMVVDGLTRDQVASHLQKYRLK 56 (57)
T ss_pred CCCCCCCHHHHHHHHHHHHHhCCCcccchHHHHHHcCCCCCCHHHHHHHHHHHHcc
Confidence 46789999999999999999998 99 99998776 67 999999999999986
|
This model describes a DNA-binding domain restricted to (but common in) plant proteins, many of which also contain a response regulator domain. The domain appears related to the Myb-like DNA-binding domain described by Pfam model pfam00249. It is distinguished in part by a well-conserved motif SH[AL]QKY[RF] at the C-terminal end of the motif. |
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0048 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >PLN03162 golden-2 like transcription factor; Provisional | Back alignment and domain information |
|---|
| >KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG4329 consensus DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0049 consensus Transcription factor, Myb superfamily [Transcription] | Back alignment and domain information |
|---|
| >KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] | Back alignment and domain information |
|---|
| >PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain | Back alignment and domain information |
|---|
| >PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >smart00426 TEA TEA domain | Back alignment and domain information |
|---|
| >COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains | Back alignment and domain information |
|---|
| >KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] | Back alignment and domain information |
|---|
| >PF01285 TEA: TEA/ATTS domain family; InterPro: IPR000818 Transcriptional enhancer activators are nuclear proteins that contain a TEA/ATTSdomain, a DNA-binding region of 66-68 amino acids | Back alignment and domain information |
|---|
| >PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 303 | ||||
| 2cu7_A | 72 | Solution Structure Of The Sant Domain Of Human Kiaa | 4e-06 |
| >pdb|2CU7|A Chain A, Solution Structure Of The Sant Domain Of Human Kiaa1915 Protein Length = 72 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 303 | |||
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 2e-26 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 2e-20 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 2e-19 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 2e-15 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 2e-13 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 5e-13 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 1e-10 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 3e-09 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 4e-09 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 8e-07 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 1e-06 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 7e-06 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 2e-05 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 2e-04 |
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
Score = 98.3 bits (245), Expect = 2e-26
Identities = 23/65 (35%), Positives = 35/65 (53%)
Query: 63 TKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGTAEH 122
+ WT E + F + L F R W KI IGS+TV+Q++S+A++YF K G +
Sbjct: 6 SGYSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGLDKE 65
Query: 123 LPPPR 127
P +
Sbjct: 66 TPNQK 70
|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Length = 235 | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 60 | Back alignment and structure |
|---|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Length = 64 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Length = 94 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 61 | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Length = 482 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 303 | |||
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 99.67 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 99.65 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 99.62 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 99.51 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 99.5 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 99.48 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 99.4 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 99.36 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 99.35 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.35 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 99.35 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 99.34 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 99.33 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 99.29 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 99.28 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 98.94 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 99.27 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 99.27 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 99.2 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 99.19 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 99.19 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.15 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 99.09 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.09 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 99.08 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.07 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 99.05 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 99.05 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 99.02 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 99.01 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 99.0 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.96 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 98.96 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.95 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.94 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 98.87 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 98.82 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 98.82 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.79 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 98.79 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 98.78 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 98.78 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 98.75 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 98.74 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 98.46 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 97.7 | |
| 1fex_A | 59 | TRF2-interacting telomeric RAP1 protein; helix tur | 97.45 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 97.38 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 97.14 | |
| 1ug2_A | 95 | 2610100B20RIK gene product; hypothetical protein, | 97.08 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 96.5 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.45 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 96.14 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 96.13 | |
| 2lr8_A | 70 | CAsp8-associated protein 2; structural genomics, n | 94.9 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 95.25 | |
| 1ig6_A | 107 | MRF-2, modulator recognition factor 2; DNA binding | 93.53 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 93.1 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 90.57 | |
| 2hzd_A | 82 | Transcriptional enhancer factor TEF-1; DNA-binding | 87.89 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 85.65 | |
| 2xb0_X | 270 | Chromo domain-containing protein 1; hydrolase, DNA | 85.26 | |
| 2cxy_A | 125 | BAF250B subunit, HBAF250B; DNA-binding domain, str | 83.67 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 83.09 |
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.67 E-value=4.5e-17 Score=126.33 Aligned_cols=62 Identities=26% Similarity=0.390 Sum_probs=57.4
Q ss_pred CCCCCCCCCcccccCCCCCCHHHHHHHHHHHHHcCchHHHHHHHhCCCCHHHHHHHHHHHHH
Q 022076 51 DPSKKIRKPYTITKSRESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFL 112 (303)
Q Consensus 51 ~~~kk~rkPyt~tk~r~~WT~EEh~lFLeaLe~yGrdWkkIA~~VgTRT~~QIrSHaQKYf~ 112 (303)
-+++|.++++.....+..||+||+++||+||++||++|++||++|++||..||+.||++|++
T Consensus 3 sg~~~~~~~~~~~~~~~~WT~eEd~~Ll~~v~~~G~~W~~IA~~v~~RT~~qcr~r~~~~~i 64 (79)
T 2yus_A 3 SGSSGTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILHFLRLPI 64 (79)
T ss_dssp CSSSCCCCCCCSSCCSCCCCHHHHHHHHHHHHHSSSCHHHHHHHHSSCCHHHHHHHHTTSCC
T ss_pred CcccCccCCccccccCCCcCHHHHHHHHHHHHHhCCCHHHHHHHcCCCCHHHHHHHHHHhcc
Confidence 36788899999999999999999999999999999999999999999999999999987743
|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
| >1ig6_A MRF-2, modulator recognition factor 2; DNA binding protein, DNA-binding motif, protein-DNA interaction; NMR {Homo sapiens} SCOP: a.4.3.1 PDB: 2oeh_A | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A | Back alignment and structure |
|---|
| >2cxy_A BAF250B subunit, HBAF250B; DNA-binding domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Homo sapiens} PDB: 2eh9_A 1ryu_A | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 303 | ||||
| d1irza_ | 64 | a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis th | 1e-14 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 9e-14 | |
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 1e-12 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 2e-12 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 3e-11 | |
| d1x41a1 | 47 | a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, T | 1e-08 | |
| d2cqra1 | 60 | a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 | 3e-06 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 2e-04 | |
| d2cqqa1 | 59 | a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 | 4e-04 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 0.002 |
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: GARP response regulators domain: Arr10-B species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 65.3 bits (159), Expect = 1e-14
Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 5/58 (8%)
Query: 64 KSRESWTEPEHDKFLEALQLFDRDWKKIEA-----FIGSKTVIQIRSHAQKYFLKVQK 116
K R WT H+KFL A+ + + + T + SH QK+ + ++K
Sbjct: 5 KPRVLWTHELHNKFLAAVDHLGVERAVPKKILDLMNVDKLTRENVASHLQKFRVALKK 62
|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Length = 47 | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 303 | |||
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.59 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 99.55 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 99.54 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 99.4 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.38 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 99.38 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 99.36 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.35 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 99.3 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 99.23 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 99.11 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 99.1 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 99.07 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 98.97 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 98.67 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 98.57 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.57 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 97.82 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 96.84 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 93.72 | |
| d1fexa_ | 59 | Rap1 {Human (Homo sapiens) [TaxId: 9606]} | 90.11 | |
| d1ig6a_ | 107 | MRF-2 DNA-binding domain {Human (Homo sapiens) [Ta | 89.06 | |
| d1ofcx2 | 128 | SLIDE domain of the nucleosome remodeling ATPase I | 87.05 | |
| d1kkxa_ | 102 | Transcription regulator Adr6 (Swi1) {Baker's yeast | 81.83 |
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: MYSM1 (KIAA1915) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.59 E-value=1.3e-15 Score=110.73 Aligned_cols=54 Identities=41% Similarity=0.706 Sum_probs=50.3
Q ss_pred CCCCCHHHHHHHHHHHHHcCchHHHHHHHhCCCCHHHHHHHHHHHHHHHhhcCC
Q 022076 66 RESWTEPEHDKFLEALQLFDRDWKKIEAFIGSKTVIQIRSHAQKYFLKVQKNGT 119 (303)
Q Consensus 66 r~~WT~EEh~lFLeaLe~yGrdWkkIA~~VgTRT~~QIrSHaQKYf~kl~k~g~ 119 (303)
...||.||+.+|+++|+.||++|..||.+|++||..||++||++|+.+..+.+.
T Consensus 2 ~~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~ry~~~~~~~~k~~~ 55 (65)
T d2cu7a1 2 SVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKCGL 55 (65)
T ss_dssp CCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHHSCSCT
T ss_pred CCCCCHHHHHHHHHHHHHhcchHHHHHHHcCCCCHHHHHHHHHHHHHHHHhcCC
Confidence 367999999999999999999999999999999999999999999999877654
|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ig6a_ a.4.3.1 (A:) MRF-2 DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|