Citrus Sinensis ID: 022184


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-
MEGGGTVTCGSWIKRPENVNLVVLGKSSRASSSPSVLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQR
cccccEEEEEEEEccccEEEEEEccccEEEEccccEEEEEEEcccEEEEEEcccEEEccccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEcccccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEccccccccEEEEEEcccccEEEEccccccEEEEEccccEEEEEccccccccEEEEEEccccccccccEEEEEEcccEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccEEEEEccccEEEEEEccccccccEEEEEEccccc
cccccEEEEEEEEEcccccEEEEEEcccccccccccEEEEEEccccccccccccccccccccccEEEEEEEcccccEEEEEccccEEEEEEcccccccccccccccccccccccEEEEEEcccccEEEEEccccEEEEEEccccccccccccccccEEEEEEcccccEEEEEccccEEEEEEcccccEccccccccccEEEEEEEcccccEEEEEEEEccccccEEEEEEcccccEcccccccccEEEEEEEcccccEEEEEccccEEEEEEcccccEcccccccccccEEEEEEEccccc
megggtvtcgswikrpenvnLVVLGkssrassspsvleifsfdpkttsvytsplvtyvfdesegdpmtiavnpsgddfvcsttnggcklfevyggatdinllakkmpplqdagpqkclsfsvdgsrfaaggvdghlrimhwpslriildepkahksvldmdfsldSEFLattstdgsariwktEDGVAWTFltrnsdekielcrfskdgtkpflfctvqrgdKALLAVYDISTwnkighkrllrkpasvlsISLDGKylamgskdgdicvvDVKKMEINHWSKRLHLGTSIALvefcptqr
megggtvtcgswikrpenVNLVVLGkssrassspsvleifsfdpkttsvytSPLVTYVFDESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLAttstdgsariwkteDGVAWTFLTRNSDEKIELCrfskdgtkpflFCTVQRGDKALLAVYDISTwnkighkrllrkpasvLSISLDGKYLAMGSKDGDICVVDVKKMEINHwskrlhlgtsialvefcptqr
MEGGGTVTCGSWIKRPENVNLVVLGKSSRASSSPSVLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQR
******VTCGSWIKRPENVNLVVLG**********VLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFC****
*EGGGTVTCGSWIKRPENVNLVVLGKSSRASSSPSVLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQ*
MEGGGTVTCGSWIKRPENVNLVVLGKS********VLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQR
***GGTVTCGSWIKRPENVNLVVLGKSSRASSSPSVLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGGGTVTCGSWIKRPENVNLVVLGKSSRASSSPSVLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query301 2.2.26 [Sep-21-2011]
Q8GYE0398 SEC12-like protein 1 OS=A yes no 0.986 0.746 0.647 1e-115
Q39221393 SEC12-like protein 2 OS=A no no 0.863 0.661 0.302 1e-25
Q9WTV0417 Prolactin regulatory elem yes no 0.601 0.434 0.275 1e-08
Q9WUQ2417 Prolactin regulatory elem yes no 0.601 0.434 0.28 2e-08
Q9HCU5417 Prolactin regulatory elem yes no 0.601 0.434 0.26 1e-07
Q5ZME8 513 WD40 repeat-containing pr yes no 0.548 0.321 0.247 2e-07
Q99M63 513 WD40 repeat-containing pr no no 0.548 0.321 0.235 5e-07
Q6NRT3 513 WD40 repeat-containing pr N/A no 0.548 0.321 0.235 5e-07
Q3UKJ7 513 WD40 repeat-containing pr no no 0.548 0.321 0.235 5e-07
Q2TAY7 513 WD40 repeat-containing pr no no 0.548 0.321 0.235 5e-07
>sp|Q8GYE0|PHF1_ARATH SEC12-like protein 1 OS=Arabidopsis thaliana GN=PHF1 PE=2 SV=2 Back     alignment and function desciption
 Score =  415 bits (1066), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/301 (64%), Positives = 242/301 (80%), Gaps = 4/301 (1%)

Query: 5   GTVTCGSWIKRPENVNLVVLGKSSR----ASSSPSVLEIFSFDPKTTSVYTSPLVTYVFD 60
           G V CGSWI+RP+ VN V++ K+S+    + SSP++L IFSFDP T S+ +SPL T+   
Sbjct: 11  GHVVCGSWIRRPKKVNWVLIAKASKRRGSSVSSPALLNIFSFDPITASLSSSPLATHTLK 70

Query: 61  ESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSF 120
           +S+GDP+ ++V+P GD FVCST+ GGCKLFE+ GGAT I +LAK++ PLQ+AG QKC++F
Sbjct: 71  DSDGDPVAVSVHPGGDYFVCSTSKGGCKLFELVGGATGITILAKELLPLQNAGLQKCMAF 130

Query: 121 SVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARI 180
           S DGS+ A GGVDG LRIM WP+L +ILDEPKAHKS+ DMDFSLDSEFLATTSTDGSARI
Sbjct: 131 SFDGSKLAVGGVDGCLRIMEWPNLSVILDEPKAHKSIRDMDFSLDSEFLATTSTDGSARI 190

Query: 181 WKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHK 240
           WK EDG   + L R+ DE IELCRFSKDGTKPFLFC  QRGD  ++ VYDISTW K+G K
Sbjct: 191 WKAEDGFPLSTLERSGDENIELCRFSKDGTKPFLFCAAQRGDTPMVNVYDISTWKKLGFK 250

Query: 241 RLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQ 300
           +L RK AS +++SLDGKY+A+G KDGD+ V +VK MEI H+SKRLHLG SIA +EFCP++
Sbjct: 251 KLSRKTASTMAVSLDGKYIALGGKDGDVSVAEVKTMEIYHYSKRLHLGQSIASLEFCPSE 310

Query: 301 R 301
           R
Sbjct: 311 R 311




Involved in Pi uptake by facilitating the trafficking of PHT1-1/PHT1;1 from the endoplasmic reticulum to the plasma membrane.
Arabidopsis thaliana (taxid: 3702)
>sp|Q39221|STLP2_ARATH SEC12-like protein 2 OS=Arabidopsis thaliana GN=STL2P PE=1 SV=4 Back     alignment and function description
>sp|Q9WTV0|PREB_RAT Prolactin regulatory element-binding protein OS=Rattus norvegicus GN=Preb PE=2 SV=2 Back     alignment and function description
>sp|Q9WUQ2|PREB_MOUSE Prolactin regulatory element-binding protein OS=Mus musculus GN=Preb PE=1 SV=1 Back     alignment and function description
>sp|Q9HCU5|PREB_HUMAN Prolactin regulatory element-binding protein OS=Homo sapiens GN=PREB PE=1 SV=2 Back     alignment and function description
>sp|Q5ZME8|SMU1_CHICK WD40 repeat-containing protein SMU1 OS=Gallus gallus GN=SMU1 PE=2 SV=1 Back     alignment and function description
>sp|Q99M63|SMU1_RAT WD40 repeat-containing protein SMU1 OS=Rattus norvegicus GN=Smu1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NRT3|SMU1_XENLA WD40 repeat-containing protein SMU1 OS=Xenopus laevis GN=smu1 PE=2 SV=1 Back     alignment and function description
>sp|Q3UKJ7|SMU1_MOUSE WD40 repeat-containing protein SMU1 OS=Mus musculus GN=Smu1 PE=2 SV=2 Back     alignment and function description
>sp|Q2TAY7|SMU1_HUMAN WD40 repeat-containing protein SMU1 OS=Homo sapiens GN=SMU1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query301
356535527394 PREDICTED: SEC12-like protein 1-like [Gl 0.986 0.753 0.764 1e-134
356576347394 PREDICTED: SEC12-like protein 1-like [Gl 0.986 0.753 0.754 1e-133
388521319390 unknown [Lotus japonicus] 0.986 0.761 0.744 1e-132
224113177385 predicted protein [Populus trichocarpa] 0.986 0.771 0.749 1e-132
225448865391 PREDICTED: SEC12-like protein 1-like [Vi 0.986 0.759 0.745 1e-131
255584376303 nucleotide binding protein, putative [Ri 1.0 0.993 0.734 1e-127
217073440392 unknown [Medicago truncatula] 0.986 0.757 0.707 1e-123
449441826393 PREDICTED: SEC12-like protein 1-like [Cu 0.986 0.755 0.686 1e-121
449522724393 PREDICTED: LOW QUALITY PROTEIN: SEC12-li 0.986 0.755 0.680 1e-119
297819930397 hypothetical protein ARALYDRAFT_485583 [ 0.986 0.748 0.654 1e-114
>gi|356535527|ref|XP_003536296.1| PREDICTED: SEC12-like protein 1-like [Glycine max] Back     alignment and taxonomy information
 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 227/297 (76%), Positives = 264/297 (88%)

Query: 5   GTVTCGSWIKRPENVNLVVLGKSSRASSSPSVLEIFSFDPKTTSVYTSPLVTYVFDESEG 64
           G VTCGSWI+RPEN+NLVVLG+S R SS PS+LEIFSFDPKTTS+ TSPL TYV +  EG
Sbjct: 10  GPVTCGSWIRRPENLNLVVLGRSRRGSSCPSLLEIFSFDPKTTSLSTSPLTTYVLEAEEG 69

Query: 65  DPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDG 124
           DP+ I V+PSGDDFVC+ +NG CKLFE+YG  T++ LLAK++ PLQ  GPQKC+SFSVDG
Sbjct: 70  DPVAITVHPSGDDFVCALSNGSCKLFELYGRETNMKLLAKELAPLQGIGPQKCISFSVDG 129

Query: 125 SRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARIWKTE 184
           S+FAAGG+DGHLRIM WPS+R+ILDEP+AH SV DMDFSLDSEFLA+TSTDGSARIWKTE
Sbjct: 130 SKFAAGGMDGHLRIMEWPSMRVILDEPRAHNSVQDMDFSLDSEFLASTSTDGSARIWKTE 189

Query: 185 DGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKRLLR 244
           DGV    L+RNSDEKIELCRFSKDGTKPFLFC+VQ+GD ++ AVYDISTWNKIGHKRL+R
Sbjct: 190 DGVPLNTLSRNSDEKIELCRFSKDGTKPFLFCSVQKGDTSVTAVYDISTWNKIGHKRLIR 249

Query: 245 KPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQR 301
           K ASV+SIS DGKYL++GSKDGDICVV+VKKM+I H+SKRLHLGT+IA +EFCP +R
Sbjct: 250 KSASVMSISNDGKYLSLGSKDGDICVVEVKKMQIYHYSKRLHLGTNIASLEFCPGER 306




Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356576347|ref|XP_003556294.1| PREDICTED: SEC12-like protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|388521319|gb|AFK48721.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224113177|ref|XP_002316416.1| predicted protein [Populus trichocarpa] gi|222865456|gb|EEF02587.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225448865|ref|XP_002262948.1| PREDICTED: SEC12-like protein 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|255584376|ref|XP_002532922.1| nucleotide binding protein, putative [Ricinus communis] gi|223527315|gb|EEF29464.1| nucleotide binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|217073440|gb|ACJ85079.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449441826|ref|XP_004138683.1| PREDICTED: SEC12-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449522724|ref|XP_004168376.1| PREDICTED: LOW QUALITY PROTEIN: SEC12-like protein 1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297819930|ref|XP_002877848.1| hypothetical protein ARALYDRAFT_485583 [Arabidopsis lyrata subsp. lyrata] gi|297323686|gb|EFH54107.1| hypothetical protein ARALYDRAFT_485583 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query301
TAIR|locus:2083850398 PHF1 "AT3G52190" [Arabidopsis 0.986 0.746 0.654 9.2e-107
TAIR|locus:2159697383 AT5G50550 "AT5G50550" [Arabido 0.897 0.704 0.321 1.8e-32
TAIR|locus:2832497383 AT5G50650 "AT5G50650" [Arabido 0.897 0.704 0.321 1.8e-32
TAIR|locus:2049582393 STL2P "AT2G01470" [Arabidopsis 0.887 0.679 0.318 3.1e-28
MGI|MGI:1355326417 Preb "prolactin regulatory ele 0.601 0.434 0.28 4.1e-09
RGD|61929417 Preb "prolactin regulatory ele 0.598 0.431 0.283 6.9e-09
UNIPROTKB|E2RBH1418 PREB "Uncharacterized protein" 0.644 0.464 0.286 1.5e-08
UNIPROTKB|F1SED4415 PREB "Uncharacterized protein" 0.591 0.428 0.280 1.3e-07
UNIPROTKB|E1BL12418 PREB "Uncharacterized protein" 0.591 0.425 0.285 1.7e-07
UNIPROTKB|Q5ZME8 513 SMU1 "WD40 repeat-containing p 0.574 0.337 0.255 1.9e-07
TAIR|locus:2083850 PHF1 "AT3G52190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1056 (376.8 bits), Expect = 9.2e-107, P = 9.2e-107
 Identities = 197/301 (65%), Positives = 242/301 (80%)

Query:     5 GTVTCGSWIKRPENVNLVVLGKSS--RASS--SPSVLEIFSFDPKTTSVYTSPLVTYVFD 60
             G V CGSWI+RP+ VN V++ K+S  R SS  SP++L IFSFDP T S+ +SPL T+   
Sbjct:    11 GHVVCGSWIRRPKKVNWVLIAKASKRRGSSVSSPALLNIFSFDPITASLSSSPLATHTLK 70

Query:    61 ESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSF 120
             +S+GDP+ ++V+P GD FVCST+ GGCKLFE+ GGAT I +LAK++ PLQ+AG QKC++F
Sbjct:    71 DSDGDPVAVSVHPGGDYFVCSTSKGGCKLFELVGGATGITILAKELLPLQNAGLQKCMAF 130

Query:   121 SVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSARI 180
             S DGS+ A GGVDG LRIM WP+L +ILDEPKAHKS+ DMDFSLDSEFLATTSTDGSARI
Sbjct:   131 SFDGSKLAVGGVDGCLRIMEWPNLSVILDEPKAHKSIRDMDFSLDSEFLATTSTDGSARI 190

Query:   181 WKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHK 240
             WK EDG   + L R+ DE IELCRFSKDGTKPFLFC  QRGD  ++ VYDISTW K+G K
Sbjct:   191 WKAEDGFPLSTLERSGDENIELCRFSKDGTKPFLFCAAQRGDTPMVNVYDISTWKKLGFK 250

Query:   241 RLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQ 300
             +L RK AS +++SLDGKY+A+G KDGD+ V +VK MEI H+SKRLHLG SIA +EFCP++
Sbjct:   251 KLSRKTASTMAVSLDGKYIALGGKDGDVSVAEVKTMEIYHYSKRLHLGQSIASLEFCPSE 310

Query:   301 R 301
             R
Sbjct:   311 R 311




GO:0000166 "nucleotide binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0006817 "phosphate ion transport" evidence=IMP
GO:0006888 "ER to Golgi vesicle-mediated transport" evidence=RCA;IMP
GO:0016036 "cellular response to phosphate starvation" evidence=IEP
GO:0005886 "plasma membrane" evidence=IDA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0006820 "anion transport" evidence=RCA
GO:0006862 "nucleotide transport" evidence=RCA
GO:0006865 "amino acid transport" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0015696 "ammonium transport" evidence=RCA
GO:0015802 "basic amino acid transport" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0043090 "amino acid import" evidence=RCA
GO:0043269 "regulation of ion transport" evidence=RCA
TAIR|locus:2159697 AT5G50550 "AT5G50550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2832497 AT5G50650 "AT5G50650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2049582 STL2P "AT2G01470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1355326 Preb "prolactin regulatory element binding" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61929 Preb "prolactin regulatory element binding" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBH1 PREB "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SED4 PREB "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BL12 PREB "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZME8 SMU1 "WD40 repeat-containing protein SMU1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8GYE0PHF1_ARATHNo assigned EC number0.64780.98670.7462yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query301
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-09
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-09
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-08
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-08
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 5e-08
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-07
cd00200 289 cd00200, WD40, WD40 domain, found in a number of e 3e-07
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 3e-07
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 6e-06
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-05
COG2319 466 COG2319, COG2319, FOG: WD40 repeat [General functi 1e-04
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 0.002
smart0032040 smart00320, WD40, WD40 repeats 0.003
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score = 57.0 bits (138), Expect = 2e-09
 Identities = 46/170 (27%), Positives = 76/170 (44%), Gaps = 18/170 (10%)

Query: 117 CLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHK-SVLDMDFSLDSEFLATTSTD 175
           C++FS DG   A G  DG +++    +  ++    K H   V D+  S D  +LA+ S+D
Sbjct: 14  CVAFSPDGKLLATGSGDGTIKVWDLETGELLR-TLKGHTGPVRDVAASADGTYLASGSSD 72

Query: 176 GSARIWKTEDG-VAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTW 234
            + R+W  E G    T     S   +    FS DG    L  +    DK  + V+D+ T 
Sbjct: 73  KTIRLWDLETGECVRTLTGHTSY--VSSVAFSPDG--RILSSS--SRDKT-IKVWDVETG 125

Query: 235 NKI----GHKRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINH 280
             +    GH        + ++ S DG ++A  S+DG I + D++  +   
Sbjct: 126 KCLTTLRGHT----DWVNSVAFSPDGTFVASSSQDGTIKLWDLRTGKCVA 171


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 301
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 100.0
KOG0271480 consensus Notchless-like WD40 repeat-containing pr 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0284 464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0279315 consensus G protein beta subunit-like protein [Sig 100.0
KOG0286343 consensus G-protein beta subunit [General function 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0263707 consensus Transcription initiation factor TFIID, s 100.0
KOG0315311 consensus G-protein beta subunit-like protein (con 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0296399 consensus Angio-associated migratory cell protein 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0284464 consensus Polyadenylation factor I complex, subuni 100.0
KOG0282503 consensus mRNA splicing factor [Function unknown] 100.0
PTZ00421 493 coronin; Provisional 100.0
KOG0318603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0265338 consensus U5 snRNP-specific protein-like factor an 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0973 942 consensus Histone transcription regulator HIRA, WD 100.0
KOG0293519 consensus WD40 repeat-containing protein [Function 100.0
KOG0645312 consensus WD40 repeat protein [General function pr 100.0
KOG0316307 consensus Conserved WD40 repeat-containing protein 100.0
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 100.0
KOG0266456 consensus WD40 repeat-containing protein [General 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 100.0
KOG0318 603 consensus WD40 repeat stress protein/actin interac 100.0
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 100.0
KOG1407313 consensus WD40 repeat protein [Function unknown] 100.0
PTZ00420 568 coronin; Provisional 100.0
KOG0283 712 consensus WD40 repeat-containing protein [Function 100.0
KOG0275508 consensus Conserved WD40 repeat-containing protein 100.0
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 100.0
KOG0640430 consensus mRNA cleavage stimulating factor complex 100.0
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 100.0
KOG0285460 consensus Pleiotropic regulator 1 [RNA processing 100.0
KOG0281499 consensus Beta-TrCP (transducin repeats containing 100.0
KOG0310 487 consensus Conserved WD40 repeat-containing protein 100.0
KOG0295406 consensus WD40 repeat-containing protein [Function 100.0
PLN00181793 protein SPA1-RELATED; Provisional 100.0
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 100.0
KOG0643327 consensus Translation initiation factor 3, subunit 100.0
KOG0278334 consensus Serine/threonine kinase receptor-associa 100.0
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 100.0
KOG0641350 consensus WD40 repeat protein [General function pr 100.0
KOG0288459 consensus WD40 repeat protein TipD [General functi 100.0
KOG1407313 consensus WD40 repeat protein [Function unknown] 100.0
KOG0283 712 consensus WD40 repeat-containing protein [Function 100.0
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 100.0
KOG0313423 consensus Microtubule binding protein YTM1 (contai 100.0
KOG0313423 consensus Microtubule binding protein YTM1 (contai 100.0
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 100.0
KOG0294362 consensus WD40 repeat-containing protein [Function 100.0
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.98
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.98
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.98
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.97
KOG0296399 consensus Angio-associated migratory cell protein 99.97
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.97
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.97
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.97
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.97
KOG0275508 consensus Conserved WD40 repeat-containing protein 99.97
KOG0643327 consensus Translation initiation factor 3, subunit 99.97
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.97
KOG0306 888 consensus WD40-repeat-containing subunit of the 18 99.97
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.97
KOG0281499 consensus Beta-TrCP (transducin repeats containing 99.97
KOG0289506 consensus mRNA splicing factor [General function p 99.97
PTZ00421 493 coronin; Provisional 99.97
KOG0282503 consensus mRNA splicing factor [Function unknown] 99.97
KOG0278334 consensus Serine/threonine kinase receptor-associa 99.97
KOG0293519 consensus WD40 repeat-containing protein [Function 99.97
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.97
KOG0640430 consensus mRNA cleavage stimulating factor complex 99.97
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.97
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.97
KOG2096420 consensus WD40 repeat protein [General function pr 99.97
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.97
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.97
KOG0771398 consensus Prolactin regulatory element-binding pro 99.96
KOG0289506 consensus mRNA splicing factor [General function p 99.96
KOG0288459 consensus WD40 repeat protein TipD [General functi 99.96
PTZ00420 568 coronin; Provisional 99.96
KOG0267 825 consensus Microtubule severing protein katanin p80 99.96
KOG2055514 consensus WD40 repeat protein [General function pr 99.96
KOG0639705 consensus Transducin-like enhancer of split protei 99.96
KOG0646 476 consensus WD40 repeat protein [General function pr 99.96
KOG0300481 consensus WD40 repeat-containing protein [Function 99.96
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.96
KOG1274 933 consensus WD40 repeat protein [General function pr 99.96
KOG0268 433 consensus Sof1-like rRNA processing protein (conta 99.96
KOG0269 839 consensus WD40 repeat-containing protein [Function 99.96
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.96
KOG1446311 consensus Histone H3 (Lys4) methyltransferase comp 99.96
KOG1539 910 consensus WD repeat protein [General function pred 99.96
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 99.96
KOG2048 691 consensus WD40 repeat protein [General function pr 99.95
KOG0641350 consensus WD40 repeat protein [General function pr 99.95
KOG0308 735 consensus Conserved WD40 repeat-containing protein 99.95
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.95
KOG0639705 consensus Transducin-like enhancer of split protei 99.95
KOG1332299 consensus Vesicle coat complex COPII, subunit SEC1 99.95
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.95
KOG4328498 consensus WD40 protein [Function unknown] 99.95
KOG4283397 consensus Transcription-coupled repair protein CSA 99.94
KOG2106 626 consensus Uncharacterized conserved protein, conta 99.94
KOG0270463 consensus WD40 repeat-containing protein [Function 99.94
KOG1036323 consensus Mitotic spindle checkpoint protein BUB3, 99.94
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.94
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.94
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.94
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.94
KOG4283397 consensus Transcription-coupled repair protein CSA 99.94
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.94
KOG0267 825 consensus Microtubule severing protein katanin p80 99.94
KOG0302440 consensus Ribosome Assembly protein [General funct 99.94
KOG0299479 consensus U3 snoRNP-associated protein (contains W 99.94
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.94
KOG1273405 consensus WD40 repeat protein [General function pr 99.94
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.94
KOG0270463 consensus WD40 repeat-containing protein [Function 99.93
KOG0647347 consensus mRNA export protein (contains WD40 repea 99.93
KOG0268 433 consensus Sof1-like rRNA processing protein (conta 99.93
KOG0302440 consensus Ribosome Assembly protein [General funct 99.93
KOG2055514 consensus WD40 repeat protein [General function pr 99.93
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.93
KOG1408 1080 consensus WD40 repeat protein [Function unknown] 99.93
KOG2096420 consensus WD40 repeat protein [General function pr 99.93
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.93
KOG0307 1049 consensus Vesicle coat complex COPII, subunit SEC3 99.93
KOG0301 745 consensus Phospholipase A2-activating protein (con 99.92
KOG1274 933 consensus WD40 repeat protein [General function pr 99.92
KOG0300481 consensus WD40 repeat-containing protein [Function 99.92
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.92
KOG1009434 consensus Chromatin assembly complex 1 subunit B/C 99.92
KOG2445361 consensus Nuclear pore complex component (sc Seh1) 99.92
KOG0646476 consensus WD40 repeat protein [General function pr 99.92
KOG1063764 consensus RNA polymerase II elongator complex, sub 99.92
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.91
KOG1273 405 consensus WD40 repeat protein [General function pr 99.91
KOG2048 691 consensus WD40 repeat protein [General function pr 99.91
KOG1007370 consensus WD repeat protein TSSC1, WD repeat super 99.91
KOG4378 673 consensus Nuclear protein COP1 [Signal transductio 99.91
KOG4328498 consensus WD40 protein [Function unknown] 99.91
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.9
KOG1539 910 consensus WD repeat protein [General function pred 99.9
KOG2106626 consensus Uncharacterized conserved protein, conta 99.89
KOG2919406 consensus Guanine nucleotide-binding protein [Gene 99.89
KOG1034385 consensus Transcriptional repressor EED/ESC/FIE, r 99.89
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.89
PRK01742429 tolB translocation protein TolB; Provisional 99.89
KOG0290364 consensus Conserved WD40 repeat-containing protein 99.89
KOG0294362 consensus WD40 repeat-containing protein [Function 99.88
KOG0649325 consensus WD40 repeat protein [General function pr 99.88
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.88
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.88
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.88
KOG0321 720 consensus WD40 repeat-containing protein L2DTL [Fu 99.87
PRK11028330 6-phosphogluconolactonase; Provisional 99.87
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.86
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.86
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.86
PRK11028330 6-phosphogluconolactonase; Provisional 99.86
PRK03629429 tolB translocation protein TolB; Provisional 99.86
KOG2139445 consensus WD40 repeat protein [General function pr 99.85
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.85
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.85
KOG1009 434 consensus Chromatin assembly complex 1 subunit B/C 99.84
KOG0771398 consensus Prolactin regulatory element-binding pro 99.84
COG2319 466 FOG: WD40 repeat [General function prediction only 99.84
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.84
KOG0649325 consensus WD40 repeat protein [General function pr 99.84
KOG0650733 consensus WD40 repeat nucleolar protein Bop1, invo 99.83
PRK05137435 tolB translocation protein TolB; Provisional 99.83
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.82
KOG1188376 consensus WD40 repeat protein [General function pr 99.82
KOG1524 737 consensus WD40 repeat-containing protein CHE-2 [Ge 99.82
PRK02889427 tolB translocation protein TolB; Provisional 99.82
PRK04922433 tolB translocation protein TolB; Provisional 99.82
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.81
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 99.81
KOG0642577 consensus Cell-cycle nuclear protein, contains WD- 99.81
COG2319 466 FOG: WD40 repeat [General function prediction only 99.81
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.8
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.8
KOG1523361 consensus Actin-related protein Arp2/3 complex, su 99.8
KOG1587555 consensus Cytoplasmic dynein intermediate chain [C 99.8
KOG1310 758 consensus WD40 repeat protein [General function pr 99.8
KOG2139445 consensus WD40 repeat protein [General function pr 99.79
KOG2394 636 consensus WD40 protein DMR-N9 [General function pr 99.78
KOG1963 792 consensus WD40 repeat protein [General function pr 99.78
PRK01742429 tolB translocation protein TolB; Provisional 99.78
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.78
KOG2110 391 consensus Uncharacterized conserved protein, conta 99.77
KOG1188 376 consensus WD40 repeat protein [General function pr 99.77
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.77
KOG1272 545 consensus WD40-repeat-containing subunit of the 18 99.77
KOG1445 1012 consensus Tumor-specific antigen (contains WD repe 99.77
KOG4227 609 consensus WD40 repeat protein [General function pr 99.76
PRK00178430 tolB translocation protein TolB; Provisional 99.76
PRK01029428 tolB translocation protein TolB; Provisional 99.76
PRK02889427 tolB translocation protein TolB; Provisional 99.75
KOG4227 609 consensus WD40 repeat protein [General function pr 99.75
KOG12401431 consensus Protein kinase containing WD40 repeats [ 99.75
PRK05137435 tolB translocation protein TolB; Provisional 99.75
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.75
PRK04792448 tolB translocation protein TolB; Provisional 99.74
KOG15171387 consensus Guanine nucleotide binding protein MIP1 99.74
KOG2111346 consensus Uncharacterized conserved protein, conta 99.73
PRK04922433 tolB translocation protein TolB; Provisional 99.73
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.73
PRK03629429 tolB translocation protein TolB; Provisional 99.73
KOG1963 792 consensus WD40 repeat protein [General function pr 99.73
KOG0644 1113 consensus Uncharacterized conserved protein, conta 99.73
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.72
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.72
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.72
KOG4497447 consensus Uncharacterized conserved protein WDR8, 99.7
KOG2111346 consensus Uncharacterized conserved protein, conta 99.7
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.7
KOG0322323 consensus G-protein beta subunit-like protein GNB1 99.69
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.69
KOG2321 703 consensus WD40 repeat protein [General function pr 99.69
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.66
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.66
PRK00178430 tolB translocation protein TolB; Provisional 99.66
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.65
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.64
PRK04792448 tolB translocation protein TolB; Provisional 99.62
PRK01029428 tolB translocation protein TolB; Provisional 99.62
KOG1310 758 consensus WD40 repeat protein [General function pr 99.62
KOG2321 703 consensus WD40 repeat protein [General function pr 99.61
KOG1334 559 consensus WD40 repeat protein [General function pr 99.61
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.59
COG4946668 Uncharacterized protein related to the periplasmic 99.58
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.56
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 99.55
KOG4547 541 consensus WD40 repeat-containing protein [General 99.55
PRK04043419 tolB translocation protein TolB; Provisional 99.54
COG4946 668 Uncharacterized protein related to the periplasmic 99.54
KOG4547 541 consensus WD40 repeat-containing protein [General 99.54
KOG3881412 consensus Uncharacterized conserved protein [Funct 99.53
KOG2315 566 consensus Predicted translation initiation factor 99.51
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.51
KOG0280339 consensus Uncharacterized conserved protein [Amino 99.5
KOG1354433 consensus Serine/threonine protein phosphatase 2A, 99.49
PRK04043419 tolB translocation protein TolB; Provisional 99.49
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.48
KOG1334 559 consensus WD40 repeat protein [General function pr 99.48
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.47
KOG0974 967 consensus WD-repeat protein WDR6, WD repeat superf 99.44
KOG1409404 consensus Uncharacterized conserved protein, conta 99.44
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 99.43
KOG2314 698 consensus Translation initiation factor 3, subunit 99.4
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.4
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.4
KOG2315 566 consensus Predicted translation initiation factor 99.4
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 99.38
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 99.38
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.36
KOG4532344 consensus WD40-like repeat containing protein [Gen 99.33
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.33
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.33
KOG1409 404 consensus Uncharacterized conserved protein, conta 99.31
KOG41901034 consensus Uncharacterized conserved protein [Funct 99.3
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.3
COG5354 561 Uncharacterized protein, contains Trp-Asp (WD) rep 99.29
KOG2041 1189 consensus WD40 repeat protein [General function pr 99.29
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 99.28
KOG2314 698 consensus Translation initiation factor 3, subunit 99.28
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.28
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 99.28
KOG10642439 consensus RAVE (regulator of V-ATPase assembly) co 99.23
KOG3914390 consensus WD repeat protein WDR4 [Function unknown 99.21
KOG0309 1081 consensus Conserved WD40 repeat-containing protein 99.21
KOG1912 1062 consensus WD40 repeat protein [General function pr 99.19
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 99.17
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 99.17
KOG4714319 consensus Nucleoporin [Nuclear structure] 99.17
COG5170 460 CDC55 Serine/threonine protein phosphatase 2A, reg 99.16
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 99.14
KOG2695425 consensus WD40 repeat protein [General function pr 99.11
KOG4190 1034 consensus Uncharacterized conserved protein [Funct 99.06
PF11768 545 DUF3312: Protein of unknown function (DUF3312); In 98.99
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.99
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.99
KOG2695425 consensus WD40 repeat protein [General function pr 98.99
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.94
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.94
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.94
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.93
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.92
KOG1645463 consensus RING-finger-containing E3 ubiquitin liga 98.91
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.91
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.9
KOG1912 1062 consensus WD40 repeat protein [General function pr 98.9
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.89
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.89
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.89
KOG4714319 consensus Nucleoporin [Nuclear structure] 98.86
KOG0882 558 consensus Cyclophilin-related peptidyl-prolyl cis- 98.85
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.81
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 98.8
COG3391381 Uncharacterized conserved protein [Function unknow 98.79
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 98.78
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 98.76
KOG2066 846 consensus Vacuolar assembly/sorting protein VPS41 98.76
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 98.73
KOG1832 1516 consensus HIV-1 Vpr-binding protein [Cell cycle co 98.72
COG0823425 TolB Periplasmic component of the Tol biopolymer t 98.71
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 98.69
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 98.69
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 98.63
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.63
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.62
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.6
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.56
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 98.56
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.55
PRK02888 635 nitrous-oxide reductase; Validated 98.55
KOG1008 783 consensus Uncharacterized conserved protein, conta 98.53
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 98.49
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.46
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 98.43
COG3391 381 Uncharacterized conserved protein [Function unknow 98.43
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 98.42
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.41
PRK02888 635 nitrous-oxide reductase; Validated 98.4
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.4
KOG3621 726 consensus WD40 repeat-containing protein [General 98.37
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 98.34
PRK13616591 lipoprotein LpqB; Provisional 98.33
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.31
KOG4640 665 consensus Anaphase-promoting complex (APC), subuni 98.3
KOG3621 726 consensus WD40 repeat-containing protein [General 98.28
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 98.27
KOG1275 1118 consensus PAB-dependent poly(A) ribonuclease, subu 98.27
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 98.27
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.26
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.26
PF04053 443 Coatomer_WDAD: Coatomer WD associated region ; Int 98.26
COG3386307 Gluconolactonase [Carbohydrate transport and metab 98.14
PF08553 794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 98.12
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 98.12
KOG4649354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.11
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 98.07
PRK13616591 lipoprotein LpqB; Provisional 98.06
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 98.05
COG3490366 Uncharacterized protein conserved in bacteria [Fun 98.01
KOG4649 354 consensus PQQ (pyrrolo-quinoline quinone) repeat p 98.0
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.98
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.98
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.94
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.93
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.88
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 97.88
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.86
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 97.86
PF14583 386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.86
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 97.81
smart0032040 WD40 WD40 repeats. Note that these repeats are per 97.78
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 97.74
PHA02713557 hypothetical protein; Provisional 97.68
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 97.61
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.59
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.53
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 97.52
KOG2395644 consensus Protein involved in vacuole import and d 97.51
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 97.5
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 97.49
KOG2395 644 consensus Protein involved in vacuole import and d 97.48
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 97.44
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 97.42
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.42
PRK10115 686 protease 2; Provisional 97.38
KOG4499310 consensus Ca2+-binding protein Regucalcin/SMP30 [I 97.34
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 97.32
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 97.29
KOG2444238 consensus WD40 repeat protein [General function pr 97.28
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 97.27
PF14655 415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 97.23
KOG2079 1206 consensus Vacuolar assembly/sorting protein VPS8 [ 97.22
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 97.21
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.19
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 97.18
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 97.16
COG3204316 Uncharacterized protein conserved in bacteria [Fun 97.03
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 97.02
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 96.95
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.93
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.93
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 96.88
PRK10115 686 protease 2; Provisional 96.87
KOG2444238 consensus WD40 repeat protein [General function pr 96.86
KOG4441571 consensus Proteins containing BTB/POZ and Kelch do 96.76
TIGR02604 367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.71
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 96.7
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.69
PHA03098534 kelch-like protein; Provisional 96.69
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 96.66
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 96.61
PHA02713557 hypothetical protein; Provisional 96.58
PF12234 631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 96.55
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 96.55
KOG3630 1405 consensus Nuclear pore complex, Nup214/CAN compone 96.53
PHA03098534 kelch-like protein; Provisional 96.44
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 96.41
KOG2280 829 consensus Vacuolar assembly/sorting protein VPS16 96.27
PLN00033398 photosystem II stability/assembly factor; Provisio 96.23
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 96.12
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 96.07
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 96.0
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.8
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 95.79
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 95.64
PF10168 717 Nup88: Nuclear pore component; InterPro: IPR019321 95.63
PRK13684334 Ycf48-like protein; Provisional 95.5
COG5167776 VID27 Protein involved in vacuole import and degra 95.35
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 95.32
PF12768281 Rax2: Cortical protein marker for cell polarity 95.25
PHA02790480 Kelch-like protein; Provisional 95.17
PF08728 717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 94.94
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 94.93
KOG2377 657 consensus Uncharacterized conserved protein [Funct 94.88
KOG1897 1096 consensus Damage-specific DNA binding complex, sub 94.87
PF07569219 Hira: TUP1-like enhancer of split; InterPro: IPR01 94.87
PF13449326 Phytase-like: Esterase-like activity of phytase 94.8
PRK13684334 Ycf48-like protein; Provisional 94.62
PF10214 765 Rrn6: RNA polymerase I-specific transcription-init 94.61
KOG2247 615 consensus WD40 repeat-containing protein [General 94.56
COG4590 733 ABC-type uncharacterized transport system, permeas 94.35
KOG2377 657 consensus Uncharacterized conserved protein [Funct 94.33
COG5167 776 VID27 Protein involved in vacuole import and degra 94.32
PHA02790480 Kelch-like protein; Provisional 94.27
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 94.13
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 94.1
KOG4460 741 consensus Nuclear pore complex, Nup88/rNup84 compo 94.0
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 93.71
PF13449326 Phytase-like: Esterase-like activity of phytase 93.57
KOG1916 1283 consensus Nuclear protein, contains WD40 repeats [ 93.48
COG4257 353 Vgb Streptogramin lyase [Defense mechanisms] 93.41
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 93.18
KOG2247 615 consensus WD40 repeat-containing protein [General 93.17
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 93.15
TIGR03606 454 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH 93.15
COG3823262 Glutamine cyclotransferase [Posttranslational modi 93.1
PLN00033398 photosystem II stability/assembly factor; Provisio 92.84
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 92.75
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 92.47
COG1520370 FOG: WD40-like repeat [Function unknown] 92.4
PF12657173 TFIIIC_delta: Transcription factor IIIC subunit de 92.18
KOG1983 993 consensus Tomosyn and related SNARE-interacting pr 92.08
PF0767639 PD40: WD40-like Beta Propeller Repeat; InterPro: I 91.95
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 91.74
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 91.63
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 91.43
PF11715 547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 91.39
KOG1900 1311 consensus Nuclear pore complex, Nup155 component ( 90.96
PF10395 670 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an 90.69
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 90.64
COG1520 370 FOG: WD40-like repeat [Function unknown] 90.31
TIGR0227642 beta_rpt_yvtn 40-residue YVTN family beta-propelle 89.95
PF14781136 BBS2_N: Ciliary BBSome complex subunit 2, N-termin 89.76
COG5276370 Uncharacterized conserved protein [Function unknow 89.34
PF02333381 Phytase: Phytase; InterPro: IPR003431 Phytase (3.1 89.3
TIGR03074 764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 89.06
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 88.8
COG4590 733 ABC-type uncharacterized transport system, permeas 88.04
PRK13613599 lipoprotein LpqB; Provisional 87.3
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 86.48
PLN02193470 nitrile-specifier protein 86.26
PRK13615557 lipoprotein LpqB; Provisional 85.88
KOG1898 1205 consensus Splicing factor 3b, subunit 3 [RNA proce 85.66
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 85.43
KOG1520376 consensus Predicted alkaloid synthase/Surface muci 85.38
KOG3616 1636 consensus Selective LIM binding factor [Transcript 85.38
PF05935 477 Arylsulfotrans: Arylsulfotransferase (ASST); Inter 85.37
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 84.82
COG1770 682 PtrB Protease II [Amino acid transport and metabol 83.96
PF0308889 Str_synth: Strictosidine synthase; InterPro: IPR01 83.47
PF0143628 NHL: NHL repeat; InterPro: IPR001258 The NHL repea 83.41
smart0056433 PQQ beta-propeller repeat. Beta-propeller repeat o 82.59
TIGR02171 912 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou 82.48
COG3292 671 Predicted periplasmic ligand-binding sensor domain 82.2
PF03022287 MRJP: Major royal jelly protein; InterPro: IPR0035 81.93
PF14269299 Arylsulfotran_2: Arylsulfotransferase (ASST) 81.57
PF11635 753 Med16: Mediator complex subunit 16; InterPro: IPR0 81.45
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=3.8e-49  Score=297.55  Aligned_cols=268  Identities=18%  Similarity=0.234  Sum_probs=233.6

Q ss_pred             CCceeEEEeeeecCCCccEEEecCCccccCCcCceeEeeeCCCcceeeeCCceeccccccCCcceEEEECCCCCeEEEEe
Q 022184            3 GGGTVTCGSWIKRPENVNLVVLGKSSRASSSPSVLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCST   82 (301)
Q Consensus         3 ~~~~v~~~~w~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~~~~   82 (301)
                      .+++|.|++|+|+   +..+|.|++      |.++++|+.+.++.        .++.++|...|.|++|+|||+.||+|+
T Consensus       114 H~e~Vl~~~fsp~---g~~l~tGsG------D~TvR~WD~~TeTp--------~~t~KgH~~WVlcvawsPDgk~iASG~  176 (480)
T KOG0271|consen  114 HGEAVLSVQFSPT---GSRLVTGSG------DTTVRLWDLDTETP--------LFTCKGHKNWVLCVAWSPDGKKIASGS  176 (480)
T ss_pred             CCCcEEEEEecCC---CceEEecCC------CceEEeeccCCCCc--------ceeecCCccEEEEEEECCCcchhhccc
Confidence            4689999999987   788999884      55669999987663        345789999999999999999999999


Q ss_pred             cCCcEEEEEEcCCccccccccccCCCCCCCCCeeEEEEee-----CCCEEEEeecCCeEEEEeCCCcceecccccCCccE
Q 022184           83 TNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSV-----DGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSV  157 (301)
Q Consensus        83 ~d~~i~~w~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~s~-----~~~~l~~~~~dg~i~v~d~~~~~~~~~~~~~~~~i  157 (301)
                      .||+|++||.++++...+.+      ..|...|++++|.|     ..++|++++.||.++|||+..+.++..+.+|..+|
T Consensus       177 ~dg~I~lwdpktg~~~g~~l------~gH~K~It~Lawep~hl~p~~r~las~skDg~vrIWd~~~~~~~~~lsgHT~~V  250 (480)
T KOG0271|consen  177 KDGSIRLWDPKTGQQIGRAL------RGHKKWITALAWEPLHLVPPCRRLASSSKDGSVRIWDTKLGTCVRTLSGHTASV  250 (480)
T ss_pred             cCCeEEEecCCCCCcccccc------cCcccceeEEeecccccCCCccceecccCCCCEEEEEccCceEEEEeccCccce
Confidence            99999999999888744332      34788999999976     56789999999999999999999999999999999


Q ss_pred             EEEEecCCCcEEEEEeCCCcEEEEeCCCCceEEEEeec------------------------------------------
Q 022184          158 LDMDFSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRN------------------------------------------  195 (301)
Q Consensus       158 ~~~~~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~------------------------------------------  195 (301)
                      +|+.|--+| +|++++.|++|++|+...|.+.+.+++|                                          
T Consensus       251 TCvrwGG~g-liySgS~DrtIkvw~a~dG~~~r~lkGHahwvN~lalsTdy~LRtgaf~~t~~~~~~~se~~~~Al~rY~  329 (480)
T KOG0271|consen  251 TCVRWGGEG-LIYSGSQDRTIKVWRALDGKLCRELKGHAHWVNHLALSTDYVLRTGAFDHTGRKPKSFSEEQKKALERYE  329 (480)
T ss_pred             EEEEEcCCc-eEEecCCCceEEEEEccchhHHHhhcccchheeeeeccchhhhhccccccccccCCChHHHHHHHHHHHH
Confidence            999997544 8999999999999998765433222111                                          


Q ss_pred             ------------------------------------CCCCeeEEEEccCCCcceEEEEEEeCCcceEEEEEccCceEeee
Q 022184          196 ------------------------------------SDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGH  239 (301)
Q Consensus       196 ------------------------------------~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~~d~~~~~~~~~  239 (301)
                                                          |..-|..+.||||+++     +++++.|..|++||.++++.+..
T Consensus       330 ~~~~~~~erlVSgsDd~tlflW~p~~~kkpi~rmtgHq~lVn~V~fSPd~r~-----IASaSFDkSVkLW~g~tGk~las  404 (480)
T KOG0271|consen  330 AVLKDSGERLVSGSDDFTLFLWNPFKSKKPITRMTGHQALVNHVSFSPDGRY-----IASASFDKSVKLWDGRTGKFLAS  404 (480)
T ss_pred             HhhccCcceeEEecCCceEEEecccccccchhhhhchhhheeeEEECCCccE-----EEEeecccceeeeeCCCcchhhh
Confidence                                                1234788999999998     89999999999999999999999


Q ss_pred             eeccCCCcEEEEEcCCCCEEEEeeCCCcEEEEeCCCceeeccccccccCccEEEEEEccCCC
Q 022184          240 KRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQR  301 (301)
Q Consensus       240 ~~~~~~~v~~~~~s~~~~~l~~~~~d~~i~i~~~~~~~~~~~~~~~~~~~~v~~~~~spdg~  301 (301)
                      +.+|-..|+.++|+.|.++|++|+.|.++++|++++.++..-+ .+| ...|.++.|+|||+
T Consensus       405 fRGHv~~VYqvawsaDsRLlVS~SkDsTLKvw~V~tkKl~~DL-pGh-~DEVf~vDwspDG~  464 (480)
T KOG0271|consen  405 FRGHVAAVYQVAWSADSRLLVSGSKDSTLKVWDVRTKKLKQDL-PGH-ADEVFAVDWSPDGQ  464 (480)
T ss_pred             hhhccceeEEEEeccCccEEEEcCCCceEEEEEeeeeeecccC-CCC-CceEEEEEecCCCc
Confidence            9999999999999999999999999999999999999988877 689 99999999999995



>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0296 consensus Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0306 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0289 consensus mRNA splicing factor [General function prediction only] Back     alignment and domain information
>KOG0288 consensus WD40 repeat protein TipD [General function prediction only] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1446 consensus Histone H3 (Lys4) methyltransferase complex and RNA cleavage factor II complex, subunit SWD2 [RNA processing and modification; Chromatin structure and dynamics; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0641 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0308 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0639 consensus Transducin-like enhancer of split protein (contains WD40 repeats) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1332 consensus Vesicle coat complex COPII, subunit SEC13 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1036 consensus Mitotic spindle checkpoint protein BUB3, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4283 consensus Transcription-coupled repair protein CSA, contains WD40 domain [Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0267 consensus Microtubule severing protein katanin p80 subunit B (contains WD40 repeats) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG0299 consensus U3 snoRNP-associated protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0270 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0268 consensus Sof1-like rRNA processing protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG2055 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>KOG1408 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG2096 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG0307 consensus Vesicle coat complex COPII, subunit SEC31 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0301 consensus Phospholipase A2-activating protein (contains WD40 repeats) [Lipid transport and metabolism] Back     alignment and domain information
>KOG1274 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0300 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG2445 consensus Nuclear pore complex component (sc Seh1) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0646 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1063 consensus RNA polymerase II elongator complex, subunit ELP2, WD repeat superfamily [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2048 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1007 consensus WD repeat protein TSSC1, WD repeat superfamily [Function unknown] Back     alignment and domain information
>KOG4378 consensus Nuclear protein COP1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4328 consensus WD40 protein [Function unknown] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1539 consensus WD repeat protein [General function prediction only] Back     alignment and domain information
>KOG2106 consensus Uncharacterized conserved protein, contains HELP and WD40 domains [Function unknown] Back     alignment and domain information
>KOG2919 consensus Guanine nucleotide-binding protein [General function prediction only] Back     alignment and domain information
>KOG1034 consensus Transcriptional repressor EED/ESC/FIE, required for transcriptional silencing, WD repeat superfamily [Transcription] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0290 consensus Conserved WD40 repeat-containing protein AN11 [Function unknown] Back     alignment and domain information
>KOG0294 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0321 consensus WD40 repeat-containing protein L2DTL [Function unknown] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG1009 consensus Chromatin assembly complex 1 subunit B/CAC2 (contains WD40 repeats) [Chromatin structure and dynamics; Replication, recombination and repair] Back     alignment and domain information
>KOG0771 consensus Prolactin regulatory element-binding protein/Protein transport protein SEC12p [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>KOG0649 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0650 consensus WD40 repeat nucleolar protein Bop1, involved in ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1524 consensus WD40 repeat-containing protein CHE-2 [General function prediction only] Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0642 consensus Cell-cycle nuclear protein, contains WD-40 repeats [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1523 consensus Actin-related protein Arp2/3 complex, subunit ARPC1/p41-ARC [Cytoskeleton] Back     alignment and domain information
>KOG1587 consensus Cytoplasmic dynein intermediate chain [Cytoskeleton] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2139 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2394 consensus WD40 protein DMR-N9 [General function prediction only] Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG2110 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG1188 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1272 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG1445 consensus Tumor-specific antigen (contains WD repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG4227 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1963 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0644 consensus Uncharacterized conserved protein, contains WD40 repeat and BROMO domains [General function prediction only] Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG4497 consensus Uncharacterized conserved protein WDR8, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2111 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG0322 consensus G-protein beta subunit-like protein GNB1L, contains WD repeats [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2321 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG4547 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3881 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0280 consensus Uncharacterized conserved protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1354 consensus Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1334 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG0974 consensus WD-repeat protein WDR6, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2315 consensus Predicted translation initiation factor related to eIF-3a [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>KOG4532 consensus WD40-like repeat containing protein [General function prediction only] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG1409 consensus Uncharacterized conserved protein, contains WD40 repeats and FYVE domains [Function unknown] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1064 consensus RAVE (regulator of V-ATPase assembly) complex subunit RAV1/DMX protein, WD repeat superfamily [General function prediction only] Back     alignment and domain information
>KOG3914 consensus WD repeat protein WDR4 [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4190 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG2695 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1912 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG4714 consensus Nucleoporin [Nuclear structure] Back     alignment and domain information
>KOG0882 consensus Cyclophilin-related peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG1008 consensus Uncharacterized conserved protein, contains WD40 repeats [Function unknown] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG4640 consensus Anaphase-promoting complex (APC), subunit 4 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3621 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1275 consensus PAB-dependent poly(A) ribonuclease, subunit PAN2 [Replication, recombination and repair] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4649 consensus PQQ (pyrrolo-quinoline quinone) repeat protein [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2395 consensus Protein involved in vacuole import and degradation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG4499 consensus Ca2+-binding protein Regucalcin/SMP30 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG2079 consensus Vacuolar assembly/sorting protein VPS8 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2444 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4441 consensus Proteins containing BTB/POZ and Kelch domains, involved in regulatory/signal transduction processes [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG3630 consensus Nuclear pore complex, Nup214/CAN component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1897 consensus Damage-specific DNA binding complex, subunit DDB1 [Replication, recombination and repair] Back     alignment and domain information
>PF07569 Hira: TUP1-like enhancer of split; InterPro: IPR011494 The Hira proteins are found in a range of eukaryotes and are implicated in the assembly of repressive chromatin Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF10214 Rrn6: RNA polymerase I-specific transcription-initiation factor; InterPro: IPR019350 RNA polymerase I-specific transcription-initiation factor Rrn6 and Rrn7 represent components of a multisubunit transcription factor essential for the initiation of rDNA transcription by Pol I [] Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>KOG2377 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4460 consensus Nuclear pore complex, Nup88/rNup84 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>KOG1916 consensus Nuclear protein, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG2247 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>TIGR03606 non_repeat_PQQ dehydrogenase, PQQ-dependent, s-GDH family Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>PF12657 TFIIIC_delta: Transcription factor IIIC subunit delta N-term; InterPro: IPR024761 This entry represents a domain found towards the N terminus of the 90 kDa subunit of transcription factor IIIC (also known as subunit 9 in yeast []) Back     alignment and domain information
>KOG1983 consensus Tomosyn and related SNARE-interacting proteins [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information
>KOG1900 consensus Nuclear pore complex, Nup155 component (D Nup154, sc Nup157/Nup170) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10395 Utp8: Utp8 family; InterPro: IPR018843 Utp8 is an essential component of the nuclear tRNA export machinery in Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>TIGR02276 beta_rpt_yvtn 40-residue YVTN family beta-propeller repeat Back     alignment and domain information
>PF14781 BBS2_N: Ciliary BBSome complex subunit 2, N-terminal Back     alignment and domain information
>COG5276 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02333 Phytase: Phytase; InterPro: IPR003431 Phytase (3 Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>COG4590 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>PRK13613 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PRK13615 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG1898 consensus Splicing factor 3b, subunit 3 [RNA processing and modification] Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF05935 Arylsulfotrans: Arylsulfotransferase (ASST); InterPro: IPR010262 This family consists of several bacterial arylsulphotransferase proteins Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>PF03088 Str_synth: Strictosidine synthase; InterPro: IPR018119 This entry represents a conserved region found in strictosidine synthase (4 Back     alignment and domain information
>PF01436 NHL: NHL repeat; InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins Back     alignment and domain information
>smart00564 PQQ beta-propeller repeat Back     alignment and domain information
>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171 Back     alignment and domain information
>COG3292 Predicted periplasmic ligand-binding sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PF03022 MRJP: Major royal jelly protein; InterPro: IPR003534 The major royal jelly proteins (MRJPs) comprise 12 Back     alignment and domain information
>PF14269 Arylsulfotran_2: Arylsulfotransferase (ASST) Back     alignment and domain information
>PF11635 Med16: Mediator complex subunit 16; InterPro: IPR021665 Mediator is a large complex of up to 33 proteins that is conserved from plants through fungi to humans - the number and representation of individual subunits varying with species [],[] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query301
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 6e-06
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 6e-06
3sfz_A 1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 1e-05
3shf_A 1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 1e-05
3iza_B 1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 1e-05
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 8e-05
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 9e-05
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 1e-04
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 1e-04
2gnq_A336 Structure Of Wdr5 Length = 336 1e-04
2g9a_A311 Structural Basis For The Specific Recognition Of Me 1e-04
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 1e-04
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 1e-04
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 1e-04
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 1e-04
2g99_A308 Structural Basis For The Specific Recognition Of Me 1e-04
2h9l_A329 Wdr5delta23 Length = 329 1e-04
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 1e-04
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 1e-04
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 1e-04
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 3e-04
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 3e-04
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure

Iteration: 1

Score = 48.1 bits (113), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 42/160 (26%), Positives = 70/160 (43%), Gaps = 11/160 (6%) Query: 120 FSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDGSAR 179 S DG +G DG LR+ + K VL + FS D+ + + S D + + Sbjct: 94 ISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIK 153 Query: 180 IWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTW----N 235 +W T +T + E + RFS + + P + V G L+ V++++ N Sbjct: 154 LWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPII---VSCGWDKLVKVWNLANCKLKTN 210 Query: 236 KIGHKRLLRKPASVLSISLDGKYLAMGSKDGDICVVDVKK 275 IGH L + +++S DG A G KDG + D+ + Sbjct: 211 HIGHTGYL----NTVTVSPDGSLCASGGKDGQAMLWDLNE 246
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query301
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
3jrp_A379 Fusion protein of protein transport protein SEC13 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 100.0
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 100.0
3jrp_A 379 Fusion protein of protein transport protein SEC13 100.0
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 100.0
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 100.0
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
2xyi_A430 Probable histone-binding protein CAF1; transcripti 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
4e54_B435 DNA damage-binding protein 2; beta barrel, double 100.0
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 100.0
3jro_A 753 Fusion protein of protein transport protein SEC13 100.0
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 100.0
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 100.0
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 100.0
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 100.0
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 100.0
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 100.0
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 100.0
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 100.0
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 100.0
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 100.0
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 100.0
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 100.0
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 100.0
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 100.0
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 99.98
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.97
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.97
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.97
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.97
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.96
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.96
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.96
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.96
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.96
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.95
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 99.95
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.95
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.95
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.95
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.94
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.94
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.94
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.94
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.94
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.94
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.93
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.93
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.93
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.93
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.93
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.93
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.93
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.92
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.92
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.92
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.92
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.91
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.91
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.91
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.9
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 99.9
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.9
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.9
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.89
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.89
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.88
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.87
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.86
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.85
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.84
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.84
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.83
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.83
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.83
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.82
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.82
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.81
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.8
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.8
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.79
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 99.79
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.78
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.78
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.78
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.77
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.76
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.74
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.74
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 99.74
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.74
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.74
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.73
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.73
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.72
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.72
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.72
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.71
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.71
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.7
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.69
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.68
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.67
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.67
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.66
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.65
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.65
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.65
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.63
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.63
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 99.61
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.6
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.6
2ece_A462 462AA long hypothetical selenium-binding protein; 99.59
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.59
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.58
2qe8_A343 Uncharacterized protein; structural genomics, join 99.58
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.57
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.54
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.54
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.54
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.51
2qe8_A343 Uncharacterized protein; structural genomics, join 99.5
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.49
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.48
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.48
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.45
2ece_A462 462AA long hypothetical selenium-binding protein; 99.38
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.38
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.37
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.33
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.32
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 99.29
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.27
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 99.22
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.22
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 99.21
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.18
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 99.15
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.12
2p4o_A306 Hypothetical protein; putative lactonase, structur 99.08
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 99.07
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 99.07
2fp8_A322 Strictosidine synthase; six bladed beta propeller 99.06
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 99.05
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 99.05
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.05
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 99.03
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 99.02
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 99.0
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 99.0
3v65_B386 Low-density lipoprotein receptor-related protein; 98.98
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.97
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.96
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.94
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.93
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.91
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.91
4a2l_A 795 BT_4663, two-component system sensor histidine kin 98.88
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 98.87
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 98.86
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.84
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.83
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.83
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 98.8
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.8
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.8
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 98.78
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 98.78
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.77
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.76
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.75
3v65_B386 Low-density lipoprotein receptor-related protein; 98.75
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.7
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.68
3v9f_A 781 Two-component system sensor histidine kinase/RESP 98.66
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.62
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 98.6
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 98.59
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.58
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.54
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.52
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 98.51
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 98.48
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.48
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.45
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 98.45
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.41
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.39
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 98.38
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.36
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 98.36
3kya_A496 Putative phosphatase; structural genomics, joint c 98.36
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 98.35
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 98.34
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 98.34
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 98.34
3amr_A 355 3-phytase; beta-propeller, phytate, MYO-inositol h 98.3
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 98.24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 98.2
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 98.18
3kya_A496 Putative phosphatase; structural genomics, joint c 98.17
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 98.17
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 98.17
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 98.14
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.13
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 98.11
3s94_A 619 LRP-6, low-density lipoprotein receptor-related pr 98.04
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 97.97
4a0p_A 628 LRP6, LRP-6, low-density lipoprotein receptor-rela 97.97
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.96
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.96
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 97.91
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.85
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 97.82
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 97.69
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 97.65
3pbp_A 452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 97.64
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 97.61
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.61
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 97.61
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 97.55
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 97.52
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 97.48
3das_A 347 Putative oxidoreductase; aldose sugar dehydrogenas 97.47
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 97.39
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 97.38
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 97.34
1bpo_A 494 Protein (clathrin); clathrin endocytosis beta-prop 97.2
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 97.16
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 97.15
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.14
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 97.13
1cru_A 454 Protein (soluble quinoprotein glucose dehydrogena; 97.12
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 96.92
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 96.9
3ott_A 758 Two-component system sensor histidine kinase; beta 96.82
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 96.76
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.72
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 96.68
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.57
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 96.55
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.43
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 96.27
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 96.24
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 96.08
2be1_A 339 Serine/threonine-protein kinase/endoribonuclease; 95.89
3sbq_A 638 Nitrous-oxide reductase; beta-propeller, cupredoxi 95.88
3ott_A 758 Two-component system sensor histidine kinase; beta 95.47
2wg3_C 463 Hedgehog-interacting protein; lipoprotein, develop 94.17
3sbq_A638 Nitrous-oxide reductase; beta-propeller, cupredoxi 93.1
3ei3_A 1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 92.95
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 91.42
4gq2_M 950 Nucleoporin NUP120; beta propeller alpha helical, 91.31
3q6k_A381 43.2 kDa salivary protein; beta propeller, binding 87.5
3qhy_B282 Beta-lactamase inhibitory protein II; enyzme-inhib 86.95
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 86.48
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 86.34
3zwu_A592 Alkaline phosphatase PHOX; hydrolase, beta-propell 86.31
3uc1_A327 DNA gyrase subunit A; DNA binding protein, topoiso 85.31
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 83.82
1suu_A312 DNA gyrase subunit A; topoisomerase,DNA gyrase, be 83.65
4a9v_A592 PHOX; hydrolase, beta-propeller; 1.10A {Pseudomona 81.52
3kci_A 389 Probable E3 ubiquitin-protein ligase HERC2; WD40, 81.1
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.8e-47  Score=307.10  Aligned_cols=272  Identities=17%  Similarity=0.197  Sum_probs=235.7

Q ss_pred             CCceeEEEeeeecCC-CccEEEecCCccccCCcCceeEeeeCCCcceeeeCCceeccccccCCcceEEEECCCCCeEEEE
Q 022184            3 GGGTVTCGSWIKRPE-NVNLVVLGKSSRASSSPSVLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCS   81 (301)
Q Consensus         3 ~~~~v~~~~w~~~~~-~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~~~   81 (301)
                      ...+|++++|+++.. +..++++|+      .|+.+++|+++......      ...+.+|...|.+++|++++..++++
T Consensus        31 H~~~V~~v~~~~~~~~~~~~l~tgs------~D~~v~vW~~~~~~~~~------~~~l~gh~~~v~~~~~~~~~~~l~s~   98 (321)
T 3ow8_A           31 HDDAIWSVAWGTNKKENSETVVTGS------LDDLVKVWKWRDERLDL------QWSLEGHQLGVVSVDISHTLPIAASS   98 (321)
T ss_dssp             SSSCEEEEEEC-------CEEEEEE------TTSCEEEEEEETTEEEE------EEEECCCSSCEEEEEECSSSSEEEEE
T ss_pred             CCCcEEEEEEecCCCCCCCEEEEEc------CCCCEEEEECCCCCeee------eeeeccCCCCEEEEEECCCCCEEEEE
Confidence            467899999997632 356788766      77888999987543221      34578999999999999999999999


Q ss_pred             ecCCcEEEEEEcCCccccccccccCCCCCCCCCeeEEEEeeCCCEEEEeecCCeEEEEeCCCcceecccccCCccEEEEE
Q 022184           82 TTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMD  161 (301)
Q Consensus        82 ~~d~~i~~w~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~dg~i~v~d~~~~~~~~~~~~~~~~i~~~~  161 (301)
                      +.|++|++||+.+++....+.       .+...+.+++|+|++++|++++.|+.|++|++++++....+..+...+.+++
T Consensus        99 s~D~~i~lWd~~~~~~~~~~~-------~~~~~~~~~~~spdg~~l~~g~~dg~v~i~~~~~~~~~~~~~~~~~~v~~~~  171 (321)
T 3ow8_A           99 SLDAHIRLWDLENGKQIKSID-------AGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSLDTRGKFILSIA  171 (321)
T ss_dssp             ETTSEEEEEETTTTEEEEEEE-------CCTTCCCCEEECTTSSEEEEECTTSEEEEEETTTCSEEEEEECSSSCEEEEE
T ss_pred             eCCCcEEEEECCCCCEEEEEe-------CCCccEEEEEECCCCCEEEEEcCCCcEEEEEcCCCceeEEecCCCceEEEEE
Confidence            999999999998876533221       2456788999999999999999999999999999988888888888999999


Q ss_pred             ecCCCcEEEEEeCCCcEEEEeCCCCceEEEEeecCCCCeeEEEEccCCCcceEEEEEEeCCcceEEEEEccCceEeeeee
Q 022184          162 FSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKR  241 (301)
Q Consensus       162 ~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~~d~~~~~~~~~~~  241 (301)
                      |+|++++|++++.|+.|++||+++++.+..+..+ ..+|.+++|+|+++.     +++++.|+.|++||+++++....+.
T Consensus       172 ~spdg~~lasg~~dg~i~iwd~~~~~~~~~~~~h-~~~v~~l~~spd~~~-----l~s~s~dg~i~iwd~~~~~~~~~~~  245 (321)
T 3ow8_A          172 YSPDGKYLASGAIDGIINIFDIATGKLLHTLEGH-AMPIRSLTFSPDSQL-----LVTASDDGYIKIYDVQHANLAGTLS  245 (321)
T ss_dssp             ECTTSSEEEEEETTSCEEEEETTTTEEEEEECCC-SSCCCEEEECTTSCE-----EEEECTTSCEEEEETTTCCEEEEEC
T ss_pred             ECCCCCEEEEEcCCCeEEEEECCCCcEEEEEccc-CCceeEEEEcCCCCE-----EEEEcCCCeEEEEECCCcceeEEEc
Confidence            9999999999999999999999999998888765 457999999999997     7899999999999999999888899


Q ss_pred             ccCCCcEEEEEcCCCCEEEEeeCCCcEEEEeCCCceeeccccccccCccEEEEEEccCCC
Q 022184          242 LLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQR  301 (301)
Q Consensus       242 ~~~~~v~~~~~s~~~~~l~~~~~d~~i~i~~~~~~~~~~~~~~~~~~~~v~~~~~spdg~  301 (301)
                      .|...|.+++|+|++++|++++.|+.|++||+.+++.+..+ ..| ...|.+++|+|||+
T Consensus       246 ~h~~~v~~~~~sp~~~~l~s~s~D~~v~iwd~~~~~~~~~~-~~h-~~~v~~v~~s~~g~  303 (321)
T 3ow8_A          246 GHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTF-FDH-QDQVWGVKYNGNGS  303 (321)
T ss_dssp             CCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEE-CCC-SSCEEEEEECTTSS
T ss_pred             CCCCceEEEEECCCCCEEEEEeCCCcEEEEeCCCCEEEEEE-cCC-CCcEEEEEECCCCC
Confidence            99999999999999999999999999999999999988877 578 89999999999984



>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>4gq2_M Nucleoporin NUP120; beta propeller alpha helical, component of nuclear pore COMP transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4fhm_B Back     alignment and structure
>3q6k_A 43.2 kDa salivary protein; beta propeller, binding protein, serotonin, salivary gland, binding, ligand binging protein; HET: CIT SRO; 2.52A {Lutzomyia longipalpis} PDB: 3q6p_A* 3q6t_A* Back     alignment and structure
>3qhy_B Beta-lactamase inhibitory protein II; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Streptomyces exfoliatus} PDB: 3qi0_A 1jtd_B Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3zwu_A Alkaline phosphatase PHOX; hydrolase, beta-propeller, iron; 1.39A {Pseudomonas fluorescens} Back     alignment and structure
>3uc1_A DNA gyrase subunit A; DNA binding protein, topoisomerase, isomerase; HET: DNA; 1.65A {Mycobacterium tuberculosis} Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>1suu_A DNA gyrase subunit A; topoisomerase,DNA gyrase, beta-propeller, beta-pinwheel, ISO; HET: DNA; 1.75A {Borrelia burgdorferi} SCOP: b.68.10.1 Back     alignment and structure
>4a9v_A PHOX; hydrolase, beta-propeller; 1.10A {Pseudomonas fluorescens} PDB: 3zwu_A 4a9x_A* Back     alignment and structure
>3kci_A Probable E3 ubiquitin-protein ligase HERC2; WD40, RCC1, structural genomics consortium, SGC, coiled coil, metal-binding, phosphoprotein; 1.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 301
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-12
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-09
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 2e-06
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 5e-06
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 6e-11
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 2e-05
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-10
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.002
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 0.004
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 6e-10
d1k8kc_ 371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 0.001
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-09
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 6e-08
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 4e-07
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-04
d1vyhc1 317 b.69.4.1 (C:92-408) Platelet-activating factor ace 2e-04
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-06
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 0.001
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-06
d1pbyb_ 337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 0.003
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-05
d1yfqa_ 342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 2e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 3e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 6e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-05
d1nr0a1 311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 0.003
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 7e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 4e-04
d1nr0a2 299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 5e-04
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 7e-04
d1nexb2 355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 0.002
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 8e-04
d1sq9a_ 393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 0.002
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 0.002
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: beta1-subunit of the signal-transducing G protein heterotrimer
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 64.0 bits (154), Expect = 3e-12
 Identities = 25/125 (20%), Positives = 40/125 (32%), Gaps = 5/125 (4%)

Query: 57  YVFDESEGDPMTIAVNPSGDDFVCSTTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQK 116
             F   E D   I   P+G+ F   + +  C+LF++      +                 
Sbjct: 220 QTFTGHESDINAICFFPNGNAFATGSDDATCRLFDLRADQELMT-----YSHDNIICGIT 274

Query: 117 CLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMDFSLDSEFLATTSTDG 176
            +SFS  G    AG  D +  +                  V  +  + D   +AT S D 
Sbjct: 275 SVSFSKSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDS 334

Query: 177 SARIW 181
             +IW
Sbjct: 335 FLKIW 339


>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query301
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 100.0
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 100.0
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 100.0
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 100.0
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 100.0
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.98
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.97
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.97
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.96
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.95
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.94
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.94
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.94
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.92
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.91
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.91
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.91
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.9
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.89
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.89
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.88
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.87
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.87
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.85
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.83
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.77
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.76
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.75
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.73
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.73
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.63
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.52
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.52
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.48
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.46
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.46
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.45
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 99.43
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.41
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.41
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 99.4
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 99.37
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 99.33
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 99.32
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.29
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.26
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.26
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 99.25
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 99.22
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 99.15
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 99.13
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.94
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 98.78
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.76
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.51
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.13
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 98.08
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 98.07
d1fwxa2 459 Nitrous oxide reductase, N-terminal domain {Paraco 98.02
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 98.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 97.93
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.69
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 97.68
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 97.26
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 97.26
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 97.03
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 97.02
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.91
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 96.73
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.72
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.71
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.69
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 96.66
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 96.66
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 96.61
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 96.49
d1w6sa_ 596 Methanol dehydrogenase, heavy chain {Methylobacter 96.33
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 96.19
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 95.91
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 95.58
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 95.55
d2hu7a1313 Acylamino-acid-releasing enzyme, N-terminal donain 95.29
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 95.17
d1crua_ 450 Soluble quinoprotein glucose dehydrogenase {Acinet 94.55
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 93.25
d1xipa_ 381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 92.35
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 90.77
d1wp5a_323 Topoisomerase IV subunit A, ParC, C-terminal domai 85.05
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=5.9e-42  Score=275.34  Aligned_cols=271  Identities=13%  Similarity=0.123  Sum_probs=228.9

Q ss_pred             CCCceeEEEeeeecCCCccEEEecCCccccCCcCceeEeeeCCCcceeeeCCceeccccccCCcceEEEECCCCCeEEEE
Q 022184            2 EGGGTVTCGSWIKRPENVNLVVLGKSSRASSSPSVLEIFSFDPKTTSVYTSPLVTYVFDESEGDPMTIAVNPSGDDFVCS   81 (301)
Q Consensus         2 ~~~~~v~~~~w~~~~~~~~~~~~g~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~h~~~v~~~~~~~~~~~l~~~   81 (301)
                      +...+|+|++|+|+   +.++|+|+       ++.|+||++......   .+.......+|.+.|.+++|+|++++|+++
T Consensus        49 ~H~~~V~~v~fs~~---g~~latg~-------dg~V~iWd~~~~~~~---~~~~~~~~~~h~~~I~~v~~s~dg~~l~s~  115 (337)
T d1gxra_          49 NHGEVVCAVTISNP---TRHVYTGG-------KGCVKVWDISHPGNK---SPVSQLDCLNRDNYIRSCKLLPDGCTLIVG  115 (337)
T ss_dssp             CCSSCCCEEEECSS---SSEEEEEC-------BSEEEEEETTSTTCC---SCSEEEECSCTTSBEEEEEECTTSSEEEEE
T ss_pred             CCCCcEEEEEECCC---CCEEEEEE-------CCEEEEEEccCCccc---ceeEEeeecCCCCcEEEEEEcCCCCEEEEe
Confidence            45689999999988   67888843       556899998754422   222344567899999999999999999999


Q ss_pred             ecCCcEEEEEEcCCccccccccccCCCCCCCCCeeEEEEeeCCCEEEEeecCCeEEEEeCCCcceecccccCCccEEEEE
Q 022184           82 TTNGGCKLFEVYGGATDINLLAKKMPPLQDAGPQKCLSFSVDGSRFAAGGVDGHLRIMHWPSLRIILDEPKAHKSVLDMD  161 (301)
Q Consensus        82 ~~d~~i~~w~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~s~~~~~l~~~~~dg~i~v~d~~~~~~~~~~~~~~~~i~~~~  161 (301)
                      +.|+.|++||+.........     ....|...+.+++|+|++.++++++.|+.|++|++.+++.......|...+.+++
T Consensus       116 ~~dg~i~iwd~~~~~~~~~~-----~~~~~~~~v~~~~~~~~~~~l~s~~~d~~i~~~~~~~~~~~~~~~~~~~~v~~l~  190 (337)
T d1gxra_         116 GEASTLSIWDLAAPTPRIKA-----ELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCID  190 (337)
T ss_dssp             ESSSEEEEEECCCC--EEEE-----EEECSSSCEEEEEECTTSSEEEEEETTSCEEEEETTTTEEEEEECCCSSCEEEEE
T ss_pred             eccccccccccccccccccc-----ccccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            99999999998765432111     1123567899999999999999999999999999999988888888889999999


Q ss_pred             ecCCCcEEEEEeCCCcEEEEeCCCCceEEEEeecCCCCeeEEEEccCCCcceEEEEEEeCCcceEEEEEccCceEeeeee
Q 022184          162 FSLDSEFLATTSTDGSARIWKTEDGVAWTFLTRNSDEKIELCRFSKDGTKPFLFCTVQRGDKALLAVYDISTWNKIGHKR  241 (301)
Q Consensus       162 ~~~~~~~l~~~~~d~~i~i~d~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~~d~~~~~~~~~~~  241 (301)
                      |++++..+++++.|+.+++||+++++.+..+.  +...+.+++|+|+++.     +++++.++.+++||+++.+.. ...
T Consensus       191 ~s~~~~~~~~~~~d~~v~i~d~~~~~~~~~~~--~~~~i~~l~~~~~~~~-----l~~~~~d~~i~i~d~~~~~~~-~~~  262 (337)
T d1gxra_         191 ISNDGTKLWTGGLDNTVRSWDLREGRQLQQHD--FTSQIFSLGYCPTGEW-----LAVGMESSNVEVLHVNKPDKY-QLH  262 (337)
T ss_dssp             ECTTSSEEEEEETTSEEEEEETTTTEEEEEEE--CSSCEEEEEECTTSSE-----EEEEETTSCEEEEETTSSCEE-EEC
T ss_pred             ccccccccccccccccccccccccceeecccc--cccceEEEEEcccccc-----cceeccccccccccccccccc-ccc
Confidence            99999999999999999999999999887775  3457999999999997     688899999999999988765 456


Q ss_pred             ccCCCcEEEEEcCCCCEEEEeeCCCcEEEEeCCCceeeccccccccCccEEEEEEccCCC
Q 022184          242 LLRKPASVLSISLDGKYLAMGSKDGDICVVDVKKMEINHWSKRLHLGTSIALVEFCPTQR  301 (301)
Q Consensus       242 ~~~~~v~~~~~s~~~~~l~~~~~d~~i~i~~~~~~~~~~~~~~~~~~~~v~~~~~spdg~  301 (301)
                      .|...|.+++|+|++++|++++.||.|++||+.+++.+...  .| ...|.+++|+|||+
T Consensus       263 ~~~~~i~~v~~s~~g~~l~s~s~Dg~i~iwd~~~~~~~~~~--~~-~~~v~~~~~s~d~~  319 (337)
T d1gxra_         263 LHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQS--KE-SSSVLSCDISVDDK  319 (337)
T ss_dssp             CCSSCEEEEEECTTSSEEEEEETTSEEEEEETTTCCEEEEE--EC-SSCEEEEEECTTSC
T ss_pred             ccccccceEEECCCCCEEEEEeCCCeEEEEECCCCCEEEEc--cC-CCCEEEEEEeCCCC
Confidence            78889999999999999999999999999999999888764  46 78999999999985



>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d2hu7a1 b.69.7.2 (A:9-321) Acylamino-acid-releasing enzyme, N-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp5a_ b.68.10.1 (A:) Topoisomerase IV subunit A, ParC, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure