Citrus Sinensis ID: 022210
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 301 | 2.2.26 [Sep-21-2011] | |||||||
| Q54GB2 | 567 | CTD small phosphatase-lik | yes | no | 0.614 | 0.326 | 0.443 | 4e-44 | |
| Q8BG15 | 465 | CTD small phosphatase-lik | yes | no | 0.634 | 0.410 | 0.401 | 2e-38 | |
| Q08BB5 | 469 | CTD small phosphatase-lik | yes | no | 0.634 | 0.407 | 0.397 | 2e-38 | |
| Q5XIK8 | 465 | CTD small phosphatase-lik | yes | no | 0.634 | 0.410 | 0.401 | 2e-38 | |
| Q05D32 | 466 | CTD small phosphatase-lik | yes | no | 0.634 | 0.409 | 0.401 | 2e-38 | |
| A4QNX6 | 460 | CTD small phosphatase-lik | no | no | 0.627 | 0.410 | 0.396 | 2e-38 | |
| Q5F3Z7 | 466 | CTD small phosphatase-lik | yes | no | 0.634 | 0.409 | 0.397 | 5e-38 | |
| Q801R4 | 466 | CTD small phosphatase-lik | N/A | no | 0.634 | 0.409 | 0.392 | 8e-38 | |
| Q66KM5 | 466 | CTD small phosphatase-lik | yes | no | 0.634 | 0.409 | 0.397 | 1e-37 | |
| Q3KQB6 | 466 | CTD small phosphatase-lik | N/A | no | 0.634 | 0.409 | 0.392 | 2e-37 |
| >sp|Q54GB2|CTSL2_DICDI CTD small phosphatase-like protein 2 OS=Dictyostelium discoideum GN=ctdspl2 PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 178 bits (452), Expect = 4e-44, Method: Compositional matrix adjust.
Identities = 90/203 (44%), Positives = 126/203 (62%), Gaps = 18/203 (8%)
Query: 109 YNPYLYFMGWQNLPQIAPSYWPRTPLREPIAGLPITLVLDLDD--------------FSF 154
+NP+L+ N + P P +E + I+LVLDLD+ +F
Sbjct: 360 FNPFLFIKQLANATTMPPPVA--LPPKEH-SSPKISLVLDLDETLVHCSTEPLEQPHLTF 416
Query: 155 PIHSKMEVQTVFVRQRPYLHMFLEAVASMFDVVIFTAGQSIYAGQLLDILDPNQTLIGQR 214
P+ VF ++RP+ FL V+ +F+V+IFTA Q +YA +LL+++DPN I R
Sbjct: 417 PVFFNNTEYQVFAKKRPFFEEFLHKVSDIFEVIIFTASQEVYANKLLNMIDPNNK-IKYR 475
Query: 215 VYRDSCVFADGEYLKDLTILGRDLARIAIVDNTPQVFQLQVDNGIPIESWFGDPSDSALL 274
+YRDSCV+ DG YLKDL++LGRDL ++ I+DN+PQ F QVDNGIPIESWF D +D LL
Sbjct: 476 LYRDSCVYVDGNYLKDLSVLGRDLKQVVIIDNSPQSFGFQVDNGIPIESWFEDENDKELL 535
Query: 275 SLLMFLETLVGADDVRPIIKQKY 297
L+ FLE+L +DVRP I+ K+
Sbjct: 536 QLVPFLESLTNVEDVRPHIRDKF 558
|
Probable phosphatase. Dictyostelium discoideum (taxid: 44689) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: - |
| >sp|Q8BG15|CTSL2_MOUSE CTD small phosphatase-like protein 2 OS=Mus musculus GN=Ctdspl2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q08BB5|CTL2A_DANRE CTD small phosphatase-like protein 2-A OS=Danio rerio GN=ctdspl2a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5XIK8|CTSL2_RAT CTD small phosphatase-like protein 2 OS=Rattus norvegicus GN=Ctdspl2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q05D32|CTSL2_HUMAN CTD small phosphatase-like protein 2 OS=Homo sapiens GN=CTDSPL2 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|A4QNX6|CTL2B_DANRE CTD small phosphatase-like protein 2-B OS=Danio rerio GN=ctdspl2b PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q5F3Z7|CTSL2_CHICK CTD small phosphatase-like protein 2 OS=Gallus gallus GN=CTDSPL2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q801R4|CTL2A_XENLA CTD small phosphatase-like protein 2-A OS=Xenopus laevis GN=ctdspl2-a PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q66KM5|CTSL2_XENTR CTD small phosphatase-like protein 2 OS=Xenopus tropicalis GN=ctdspl2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q3KQB6|CTL2B_XENLA CTD small phosphatase-like protein 2-B OS=Xenopus laevis GN=ctdspl2-b PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 301 | ||||||
| 225463384 | 484 | PREDICTED: uncharacterized protein LOC10 | 0.724 | 0.450 | 0.517 | 1e-61 | |
| 297740632 | 479 | unnamed protein product [Vitis vinifera] | 0.724 | 0.455 | 0.517 | 1e-61 | |
| 255557435 | 474 | conserved hypothetical protein [Ricinus | 0.780 | 0.495 | 0.478 | 7e-61 | |
| 359487040 | 522 | PREDICTED: uncharacterized protein LOC10 | 0.724 | 0.417 | 0.519 | 3e-60 | |
| 147839779 | 482 | hypothetical protein VITISV_035567 [Viti | 0.724 | 0.452 | 0.512 | 4e-60 | |
| 296090552 | 570 | unnamed protein product [Vitis vinifera] | 0.724 | 0.382 | 0.519 | 4e-60 | |
| 224116454 | 377 | predicted protein [Populus trichocarpa] | 0.717 | 0.572 | 0.508 | 4e-60 | |
| 147798518 | 506 | hypothetical protein VITISV_037605 [Viti | 0.724 | 0.430 | 0.519 | 5e-60 | |
| 357450579 | 469 | CTD small phosphatase-like protein [Medi | 0.797 | 0.511 | 0.472 | 3e-58 | |
| 357450577 | 460 | CTD small phosphatase-like protein [Medi | 0.797 | 0.521 | 0.472 | 4e-58 |
| >gi|225463384|ref|XP_002271705.1| PREDICTED: uncharacterized protein LOC100258847 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 243 bits (619), Expect = 1e-61, Method: Compositional matrix adjust.
Identities = 120/232 (51%), Positives = 157/232 (67%), Gaps = 14/232 (6%)
Query: 84 SIQQTSLLDQGSNMQSCLGIADEEYYNPYLYFMGWQNLPQIAPSYWPRTPLREPIAGLPI 143
+I Q +Q S++ C E ++P+L+ +L + + P +E I
Sbjct: 253 AIHQMRSCNQESDINPCSDQDQAECFDPHLFIRNLPDLSDVVANSRPTILPKETRKKKSI 312
Query: 144 TLVLDLD--------------DFSFPIHSKMEVQTVFVRQRPYLHMFLEAVASMFDVVIF 189
TLVLDLD DF+FP+ M+ TV+V+QRPYLH FLE VA MF++V+F
Sbjct: 313 TLVLDLDETLVHSTLEHCDDADFTFPVFFNMKDHTVYVKQRPYLHTFLERVAEMFEIVVF 372
Query: 190 TAGQSIYAGQLLDILDPNQTLIGQRVYRDSCVFADGEYLKDLTILGRDLARIAIVDNTPQ 249
TA QSIYA QLLDILDP+ R YR+SC+F+DG Y KDLT+LG DLA++AI+DN+PQ
Sbjct: 373 TASQSIYAEQLLDILDPDGKFFSHRAYRESCIFSDGSYTKDLTVLGIDLAKVAIIDNSPQ 432
Query: 250 VFQLQVDNGIPIESWFGDPSDSALLSLLMFLETLVGADDVRPIIKQKYGSQE 301
VFQLQV+NGIPI+SWF DPSD AL+SLL FLETLV ADDVRPII +++G++E
Sbjct: 433 VFQLQVNNGIPIKSWFDDPSDHALISLLPFLETLVDADDVRPIIAKRFGNKE 484
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297740632|emb|CBI30814.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255557435|ref|XP_002519748.1| conserved hypothetical protein [Ricinus communis] gi|223541165|gb|EEF42721.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359487040|ref|XP_002265614.2| PREDICTED: uncharacterized protein LOC100267967 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147839779|emb|CAN65912.1| hypothetical protein VITISV_035567 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296090552|emb|CBI40902.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224116454|ref|XP_002317305.1| predicted protein [Populus trichocarpa] gi|222860370|gb|EEE97917.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147798518|emb|CAN65472.1| hypothetical protein VITISV_037605 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357450579|ref|XP_003595566.1| CTD small phosphatase-like protein [Medicago truncatula] gi|355484614|gb|AES65817.1| CTD small phosphatase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357450577|ref|XP_003595565.1| CTD small phosphatase-like protein [Medicago truncatula] gi|355484613|gb|AES65816.1| CTD small phosphatase-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 301 | ||||||
| TAIR|locus:2170458 | 456 | SSP4 "SCP1-like small phosphat | 0.780 | 0.515 | 0.449 | 1.7e-52 | |
| TAIR|locus:2143019 | 305 | SSP5 "SCP1-like small phosphat | 0.654 | 0.645 | 0.507 | 1.5e-51 | |
| TAIR|locus:2117661 | 446 | SSP4b "SCP1-like small phospha | 0.631 | 0.426 | 0.497 | 2.9e-48 | |
| DICTYBASE|DDB_G0290365 | 567 | ctdspl2 "CTD small phosphatase | 0.627 | 0.333 | 0.449 | 1.4e-41 | |
| UNIPROTKB|F1SN06 | 405 | F1SN06 "Uncharacterized protei | 0.727 | 0.540 | 0.380 | 1e-36 | |
| UNIPROTKB|E1B8W1 | 466 | CTDSPL2 "Uncharacterized prote | 0.631 | 0.407 | 0.409 | 1.3e-36 | |
| UNIPROTKB|F6XTC9 | 466 | CTDSPL2 "Uncharacterized prote | 0.631 | 0.407 | 0.409 | 1.3e-36 | |
| UNIPROTKB|Q05D32 | 466 | CTDSPL2 "CTD small phosphatase | 0.631 | 0.407 | 0.409 | 1.3e-36 | |
| MGI|MGI:1196405 | 465 | Ctdspl2 "CTD (carboxy-terminal | 0.631 | 0.408 | 0.409 | 1.3e-36 | |
| RGD|1309219 | 465 | Ctdspl2 "CTD (carboxy-terminal | 0.631 | 0.408 | 0.409 | 1.3e-36 |
| TAIR|locus:2170458 SSP4 "SCP1-like small phosphatase 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 544 (196.6 bits), Expect = 1.7e-52, P = 1.7e-52
Identities = 116/258 (44%), Positives = 165/258 (63%)
Query: 59 GQGTCEDILPIDKTLCNPHHELF-SYSIQQTSLLDQGSNMQSCLGIADEEYYNPYLYFMG 117
G +DI + +H+LF +++ ++ ++ +S +A++ ++P L+
Sbjct: 207 GSANKDDIKSDTDKINLDNHDLFLAFNRTRSYNVEPDDRAES--EVAED--FDPQLFIKN 262
Query: 118 WQNLPQIAPSYWPRTPLREPIAGLPITLVLDLD--------------DFSFPIHSKMEVQ 163
L + +YWPR LR+ +TLVLDLD DFSF + M+
Sbjct: 263 QPELSDVVSNYWPRDTLRKK----SVTLVLDLDETLVHSTLESCNVADFSFRVFFNMQEN 318
Query: 164 TVFVRQRPYLHMFLEAVASMFDVVIFTAGQSIYAGQLLDILDPNQTLIGQRVYRDSCVFA 223
TV+VRQRP+L+ FLE V +F VVIFTA SIYA QLLDILDP+ I QR YRDSC+
Sbjct: 319 TVYVRQRPHLYRFLERVGELFHVVIFTASHSIYASQLLDILDPDGKFISQRFYRDSCILL 378
Query: 224 DGEYLKDLTILGRDLARIAIVDNTPQVFQLQVDNGIPIESWFGDPSDSALLSLLMFLETL 283
DG Y KDLT+LG DLA++AI+DN PQV++LQ++NGIPI+SW+ DP+D L+++L FLETL
Sbjct: 379 DGIYTKDLTVLGLDLAKVAIIDNCPQVYRLQINNGIPIKSWYDDPTDDGLITILPFLETL 438
Query: 284 VGADDVRPIIKQKYGSQE 301
ADDVRPII +++G++E
Sbjct: 439 AVADDVRPIIGRRFGNKE 456
|
|
| TAIR|locus:2143019 SSP5 "SCP1-like small phosphatase 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2117661 SSP4b "SCP1-like small phosphatase 4b" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0290365 ctdspl2 "CTD small phosphatase-like protein 2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SN06 F1SN06 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B8W1 CTDSPL2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XTC9 CTDSPL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05D32 CTDSPL2 "CTD small phosphatase-like protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1196405 Ctdspl2 "CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1309219 Ctdspl2 "CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3.16 | LOW CONFIDENCE prediction! |
| 3rd Layer | 3.1.3 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 301 | |||
| TIGR02251 | 162 | TIGR02251, HIF-SF_euk, Dullard-like phosphatase do | 8e-60 | |
| pfam03031 | 153 | pfam03031, NIF, NLI interacting factor-like phosph | 2e-54 | |
| smart00577 | 148 | smart00577, CPDc, catalytic domain of ctd-like pho | 1e-47 | |
| COG5190 | 390 | COG5190, FCP1, TFIIF-interacting CTD phosphatases, | 8e-29 | |
| TIGR02250 | 156 | TIGR02250, FCP1_euk, FCP1-like phosphatase, phosph | 1e-11 |
| >gnl|CDD|233801 TIGR02251, HIF-SF_euk, Dullard-like phosphatase domain | Back alignment and domain information |
|---|
Score = 187 bits (478), Expect = 8e-60
Identities = 73/160 (45%), Positives = 107/160 (66%), Gaps = 15/160 (9%)
Query: 144 TLVLDLD---------------DFSFPIHSKMEVQTVFVRQRPYLHMFLEAVASMFDVVI 188
TLVLDLD DF P+ ++ V+V +RP++ FLE V+ +++VI
Sbjct: 3 TLVLDLDETLVHSTFKMPKVDADFKVPVLIDGKIIPVYVFKRPHVDEFLERVSKWYELVI 62
Query: 189 FTAGQSIYAGQLLDILDPNQTLIGQRVYRDSCVFADGEYLKDLTILGRDLARIAIVDNTP 248
FTA YA +LDILD +I +R+YR+SCVF +G+Y+KDL+++G+DL+++ I+DN+P
Sbjct: 63 FTASLEEYADPVLDILDRGGKVISRRLYRESCVFTNGKYVKDLSLVGKDLSKVIIIDNSP 122
Query: 249 QVFQLQVDNGIPIESWFGDPSDSALLSLLMFLETLVGADD 288
+ LQ DN IPI+SWFGDP+D+ LL+L+ FLE L DD
Sbjct: 123 YSYSLQPDNAIPIKSWFGDPNDTELLNLIPFLEGLRFEDD 162
|
This model represents the putative phosphatase domain of a family of eukaryotic proteins including "Dullard" , and the NLI interacting factor (NIF)-like phosphatases. This domain is a member of the haloacid dehalogenase (HAD) superfamily by virtue of a conserved set of three catalytic motifs and a conserved fold as predicted by PSIPRED. The third motif in this family is distinctive (hhhhDNxPxxa) and aparrently lacking the last aspartate. This domain is classified as a "Class III" HAD, since there is no large "cap" domain found between motifs 1 and 2 or motifs 2 and 3. This domain is related to domains found in FCP1-like phosphatases (TIGR02250), and together both are detected by the pfam03031. Length = 162 |
| >gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >gnl|CDD|227517 COG5190, FCP1, TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|131304 TIGR02250, FCP1_euk, FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 301 | |||
| KOG1605 | 262 | consensus TFIIF-interacting CTD phosphatase, inclu | 100.0 | |
| PF03031 | 159 | NIF: NLI interacting factor-like phosphatase; Inte | 100.0 | |
| TIGR02251 | 162 | HIF-SF_euk Dullard-like phosphatase domain. This d | 100.0 | |
| TIGR02245 | 195 | HAD_IIID1 HAD-superfamily subfamily IIID hydrolase | 100.0 | |
| KOG2832 | 393 | consensus TFIIF-interacting CTD phosphatase, inclu | 100.0 | |
| TIGR02250 | 156 | FCP1_euk FCP1-like phosphatase, phosphatase domain | 99.97 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 99.95 | |
| smart00577 | 148 | CPDc catalytic domain of ctd-like phosphatases. | 99.91 | |
| KOG0323 | 635 | consensus TFIIF-interacting CTD phosphatases, incl | 99.69 | |
| COG5190 | 390 | FCP1 TFIIF-interacting CTD phosphatases, including | 98.09 | |
| cd01427 | 139 | HAD_like Haloacid dehalogenase-like hydrolases. Th | 97.85 | |
| TIGR01681 | 128 | HAD-SF-IIIC HAD-superfamily phosphatase, subfamily | 97.61 | |
| PHA03398 | 303 | viral phosphatase superfamily protein; Provisional | 97.48 | |
| TIGR01662 | 132 | HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I | 97.33 | |
| TIGR01685 | 174 | MDP-1 magnesium-dependent phosphatase-1. This mode | 97.23 | |
| TIGR01684 | 301 | viral_ppase viral phosphatase. These proteins also | 97.19 | |
| PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.09 | |
| TIGR01686 | 320 | FkbH FkbH-like domain. The C-terminal portion of t | 96.99 | |
| TIGR00213 | 176 | GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | 96.99 | |
| PRK08942 | 181 | D,D-heptose 1,7-bisphosphate phosphatase; Validate | 96.89 | |
| PF13419 | 176 | HAD_2: Haloacid dehalogenase-like hydrolase; PDB: | 96.83 | |
| TIGR02253 | 221 | CTE7 HAD superfamily (subfamily IA) hydrolase, TIG | 96.56 | |
| TIGR01656 | 147 | Histidinol-ppas histidinol-phosphate phosphatase f | 96.56 | |
| TIGR01261 | 161 | hisB_Nterm histidinol-phosphatase. This model desc | 96.33 | |
| TIGR02254 | 224 | YjjG/YfnB HAD superfamily (subfamily IA) hydrolase | 96.3 | |
| TIGR01509 | 183 | HAD-SF-IA-v3 haloacid dehalogenase superfamily, su | 96.29 | |
| PRK13288 | 214 | pyrophosphatase PpaX; Provisional | 96.17 | |
| TIGR01449 | 213 | PGP_bact 2-phosphoglycolate phosphatase, prokaryot | 96.15 | |
| TIGR01454 | 205 | AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes | 96.12 | |
| PLN03243 | 260 | haloacid dehalogenase-like hydrolase; Provisional | 96.11 | |
| TIGR01993 | 184 | Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These | 96.03 | |
| PLN02770 | 248 | haloacid dehalogenase-like hydrolase family protei | 95.94 | |
| TIGR01428 | 198 | HAD_type_II 2-haloalkanoic acid dehalogenase, type | 95.85 | |
| PF05152 | 297 | DUF705: Protein of unknown function (DUF705); Inte | 95.83 | |
| TIGR00338 | 219 | serB phosphoserine phosphatase SerB. Phosphoserine | 95.77 | |
| PRK09449 | 224 | dUMP phosphatase; Provisional | 95.75 | |
| TIGR01689 | 126 | EcbF-BcbF capsule biosynthesis phosphatase. Due to | 95.74 | |
| PRK05446 | 354 | imidazole glycerol-phosphate dehydratase/histidino | 95.66 | |
| TIGR01668 | 170 | YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph | 95.61 | |
| TIGR01664 | 166 | DNA-3'-Pase DNA 3'-phosphatase. The central phosph | 95.58 | |
| PF12689 | 169 | Acid_PPase: Acid Phosphatase; InterPro: IPR010036 | 95.47 | |
| PRK13222 | 226 | phosphoglycolate phosphatase; Provisional | 95.46 | |
| TIGR02009 | 185 | PGMB-YQAB-SF beta-phosphoglucomutase family hydrol | 95.43 | |
| PRK06769 | 173 | hypothetical protein; Validated | 95.31 | |
| PRK10725 | 188 | fructose-1-P/6-phosphogluconate phosphatase; Provi | 95.28 | |
| KOG3109 | 244 | consensus Haloacid dehalogenase-like hydrolase [Ge | 95.22 | |
| PRK13226 | 229 | phosphoglycolate phosphatase; Provisional | 95.2 | |
| PRK09456 | 199 | ?-D-glucose-1-phosphatase; Provisional | 95.19 | |
| TIGR01422 | 253 | phosphonatase phosphonoacetaldehyde hydrolase. Thi | 95.18 | |
| PRK10826 | 222 | 2-deoxyglucose-6-phosphatase; Provisional | 95.08 | |
| PRK11587 | 218 | putative phosphatase; Provisional | 95.02 | |
| TIGR01491 | 201 | HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa | 94.99 | |
| PRK14988 | 224 | GMP/IMP nucleotidase; Provisional | 94.96 | |
| TIGR01670 | 154 | YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho | 94.94 | |
| PLN02575 | 381 | haloacid dehalogenase-like hydrolase | 94.93 | |
| COG0637 | 221 | Predicted phosphatase/phosphohexomutase [General f | 94.62 | |
| TIGR01549 | 154 | HAD-SF-IA-v1 haloacid dehalogenase superfamily, su | 94.61 | |
| COG1011 | 229 | Predicted hydrolase (HAD superfamily) [General fun | 94.57 | |
| TIGR01548 | 197 | HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, | 94.52 | |
| PRK13223 | 272 | phosphoglycolate phosphatase; Provisional | 94.24 | |
| TIGR02252 | 203 | DREG-2 REG-2-like, HAD superfamily (subfamily IA) | 94.18 | |
| COG4996 | 164 | Predicted phosphatase [General function prediction | 94.11 | |
| TIGR03351 | 220 | PhnX-like phosphonatase-like hydrolase. This clade | 94.04 | |
| TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 93.97 | |
| PRK13478 | 267 | phosphonoacetaldehyde hydrolase; Provisional | 93.88 | |
| TIGR03333 | 214 | salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl | 93.76 | |
| PLN02779 | 286 | haloacid dehalogenase-like hydrolase family protei | 93.71 | |
| PHA02597 | 197 | 30.2 hypothetical protein; Provisional | 93.69 | |
| PRK09552 | 219 | mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp | 93.63 | |
| TIGR02247 | 211 | HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li | 93.53 | |
| PRK10563 | 221 | 6-phosphogluconate phosphatase; Provisional | 93.52 | |
| PRK13225 | 273 | phosphoglycolate phosphatase; Provisional | 93.5 | |
| PRK11133 | 322 | serB phosphoserine phosphatase; Provisional | 93.48 | |
| TIGR01544 | 277 | HAD-SF-IE haloacid dehalogenase superfamily, subfa | 93.44 | |
| PLN02940 | 382 | riboflavin kinase | 93.1 | |
| TIGR01672 | 237 | AphA HAD superfamily (subfamily IIIB) phosphatase, | 92.64 | |
| TIGR01990 | 185 | bPGM beta-phosphoglucomutase. The enzyme from L. l | 92.43 | |
| PRK11009 | 237 | aphA acid phosphatase/phosphotransferase; Provisio | 91.79 | |
| TIGR01691 | 220 | enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen | 91.65 | |
| PRK08238 | 479 | hypothetical protein; Validated | 91.65 | |
| TIGR01493 | 175 | HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su | 91.42 | |
| PRK09484 | 183 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 91.27 | |
| TIGR01489 | 188 | DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent | 91.23 | |
| PLN02919 | 1057 | haloacid dehalogenase-like hydrolase family protei | 90.73 | |
| PLN02811 | 220 | hydrolase | 90.69 | |
| PRK13582 | 205 | thrH phosphoserine phosphatase; Provisional | 90.46 | |
| TIGR01533 | 266 | lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil | 90.28 | |
| PRK06698 | 459 | bifunctional 5'-methylthioadenosine/S-adenosylhomo | 90.12 | |
| TIGR01488 | 177 | HAD-SF-IB Haloacid Dehalogenase superfamily, subfa | 89.76 | |
| PF09419 | 168 | PGP_phosphatase: Mitochondrial PGP phosphatase; In | 89.53 | |
| COG0241 | 181 | HisB Histidinol phosphatase and related phosphatas | 89.23 | |
| TIGR01459 | 242 | HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas | 87.7 | |
| PTZ00445 | 219 | p36-lilke protein; Provisional | 87.24 | |
| COG2179 | 175 | Predicted hydrolase of the HAD superfamily [Genera | 86.06 | |
| TIGR01490 | 202 | HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol | 85.69 | |
| TIGR02137 | 203 | HSK-PSP phosphoserine phosphatase/homoserine phosp | 85.38 | |
| COG0546 | 220 | Gph Predicted phosphatases [General function predi | 84.35 | |
| PF06941 | 191 | NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol | 82.87 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 82.81 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 82.42 | |
| PF08645 | 159 | PNK3P: Polynucleotide kinase 3 phosphatase; InterP | 81.81 | |
| PRK10748 | 238 | flavin mononucleotide phosphatase; Provisional | 81.65 | |
| COG0561 | 264 | Cof Predicted hydrolases of the HAD superfamily [G | 80.99 |
| >KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-47 Score=355.57 Aligned_cols=171 Identities=47% Similarity=0.828 Sum_probs=159.5
Q ss_pred CCCCCCCCCCCCCCcEEEEecCCceeeee----------------ecCeeeeEEEEeCchHHHHHHHHHhCceEEEEcCC
Q 022210 129 WPRTPLREPIAGLPITLVLDLDDFSFPIH----------------SKMEVQTVFVRQRPYLHMFLEAVASMFDVVIFTAG 192 (301)
Q Consensus 129 ~~~llP~~~~~~~K~tLVLDLDd~l~~v~----------------~~~~~~~~~V~~RP~l~eFL~~ls~~fEIvIfTas 192 (301)
...++|......+|+|||||||+|+++-. +++..+.+||.+|||+++||++++++||+++|||+
T Consensus 76 ~~~~~~~~~~~~~kk~lVLDLDeTLvHss~~~~~~~~~d~~~~v~~~~~~~~~yV~kRP~vdeFL~~~s~~~e~v~FTAs 155 (262)
T KOG1605|consen 76 LSPVLPLRLATVGRKTLVLDLDETLVHSSLNLKPIVNADFTVPVEIDGHIHQVYVRKRPHVDEFLSRVSKWYELVLFTAS 155 (262)
T ss_pred ccccCCcccccCCCceEEEeCCCcccccccccCCCCCcceeeeeeeCCcceEEEEEcCCCHHHHHHHhHHHHHHHHHHhh
Confidence 34455666668999999999998766533 45677899999999999999999999999999999
Q ss_pred chHHHHHHHHHHCCCCceeeeEEecCccceeCCcccccccccCCCCCcEEEEECCchhcccCCCceeeccCccCCCCCHH
Q 022210 193 QSIYAGQLLDILDPNQTLIGQRVYRDSCVFADGEYLKDLTILGRDLARIAIVDNTPQVFQLQVDNGIPIESWFGDPSDSA 272 (301)
Q Consensus 193 ~~~YA~~vld~LDp~~~~f~~rlyRe~C~~~~g~~iKDLs~Lgrdls~vIIVDdsp~~~~~qp~N~I~I~~f~gd~~D~e 272 (301)
.+.||++|++.||+.+++|++|+||++|+..+|.|+|||+.+|+|+++||||||+|.+|.+||+|||||++|++|+.|+|
T Consensus 156 ~~~Ya~~v~D~LD~~~~i~~~RlyR~~C~~~~g~yvKdls~~~~dL~~viIiDNsP~sy~~~p~NgIpI~sw~~d~~D~e 235 (262)
T KOG1605|consen 156 LEVYADPLLDILDPDRKIISHRLYRDSCTLKDGNYVKDLSVLGRDLSKVIIVDNSPQSYRLQPENGIPIKSWFDDPTDTE 235 (262)
T ss_pred hHHHHHHHHHHccCCCCeeeeeecccceEeECCcEEEEcceeccCcccEEEEcCChHHhccCccCCCcccccccCCChHH
Confidence 99999999999999888999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhccCCCChHHHHHhhhcC
Q 022210 273 LLSLLMFLETLVGADDVRPIIKQKYGS 299 (301)
Q Consensus 273 Ll~L~~~L~~L~~~~DVR~~l~~~f~~ 299 (301)
|++|+|||++|+.++|||++++++|+.
T Consensus 236 LL~LlpfLe~L~~~~Dvr~~l~~~~~~ 262 (262)
T KOG1605|consen 236 LLKLLPFLEALAFVDDVRPILARRFGN 262 (262)
T ss_pred HHHHHHHHHHhcccccHHHHHHHhhcC
Confidence 999999999999999999999999874
|
|
| >PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear | Back alignment and domain information |
|---|
| >TIGR02251 HIF-SF_euk Dullard-like phosphatase domain | Back alignment and domain information |
|---|
| >TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 | Back alignment and domain information |
|---|
| >KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] | Back alignment and domain information |
|---|
| >TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >smart00577 CPDc catalytic domain of ctd-like phosphatases | Back alignment and domain information |
|---|
| >KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] | Back alignment and domain information |
|---|
| >cd01427 HAD_like Haloacid dehalogenase-like hydrolases | Back alignment and domain information |
|---|
| >TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC | Back alignment and domain information |
|---|
| >PHA03398 viral phosphatase superfamily protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA | Back alignment and domain information |
|---|
| >TIGR01685 MDP-1 magnesium-dependent phosphatase-1 | Back alignment and domain information |
|---|
| >TIGR01684 viral_ppase viral phosphatase | Back alignment and domain information |
|---|
| >PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01686 FkbH FkbH-like domain | Back alignment and domain information |
|---|
| >TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase | Back alignment and domain information |
|---|
| >PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated | Back alignment and domain information |
|---|
| >PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A | Back alignment and domain information |
|---|
| >TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 | Back alignment and domain information |
|---|
| >TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain | Back alignment and domain information |
|---|
| >TIGR01261 hisB_Nterm histidinol-phosphatase | Back alignment and domain information |
|---|
| >TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 | Back alignment and domain information |
|---|
| >TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED | Back alignment and domain information |
|---|
| >PRK13288 pyrophosphatase PpaX; Provisional | Back alignment and domain information |
|---|
| >TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic | Back alignment and domain information |
|---|
| >TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein | Back alignment and domain information |
|---|
| >PLN03243 haloacid dehalogenase-like hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase | Back alignment and domain information |
|---|
| >PLN02770 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II | Back alignment and domain information |
|---|
| >PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins | Back alignment and domain information |
|---|
| >TIGR00338 serB phosphoserine phosphatase SerB | Back alignment and domain information |
|---|
| >PRK09449 dUMP phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase | Back alignment and domain information |
|---|
| >PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 | Back alignment and domain information |
|---|
| >TIGR01664 DNA-3'-Pase DNA 3'-phosphatase | Back alignment and domain information |
|---|
| >PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea | Back alignment and domain information |
|---|
| >PRK13222 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase | Back alignment and domain information |
|---|
| >PRK06769 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13226 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK09456 ?-D-glucose-1-phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase | Back alignment and domain information |
|---|
| >PRK10826 2-deoxyglucose-6-phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11587 putative phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal | Back alignment and domain information |
|---|
| >PRK14988 GMP/IMP nucleotidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family | Back alignment and domain information |
|---|
| >PLN02575 haloacid dehalogenase-like hydrolase | Back alignment and domain information |
|---|
| >COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E | Back alignment and domain information |
|---|
| >COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 | Back alignment and domain information |
|---|
| >PRK13223 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase | Back alignment and domain information |
|---|
| >COG4996 Predicted phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03351 PhnX-like phosphonatase-like hydrolase | Back alignment and domain information |
|---|
| >TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
|---|
| >PRK13478 phosphonoacetaldehyde hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase | Back alignment and domain information |
|---|
| >PLN02779 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PHA02597 30 | Back alignment and domain information |
|---|
| >PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase | Back alignment and domain information |
|---|
| >PRK10563 6-phosphogluconate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13225 phosphoglycolate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK11133 serB phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 | Back alignment and domain information |
|---|
| >PLN02940 riboflavin kinase | Back alignment and domain information |
|---|
| >TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 | Back alignment and domain information |
|---|
| >TIGR01990 bPGM beta-phosphoglucomutase | Back alignment and domain information |
|---|
| >PRK11009 aphA acid phosphatase/phosphotransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PRK08238 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase | Back alignment and domain information |
|---|
| >PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase | Back alignment and domain information |
|---|
| >PLN02919 haloacid dehalogenase-like hydrolase family protein | Back alignment and domain information |
|---|
| >PLN02811 hydrolase | Back alignment and domain information |
|---|
| >PRK13582 thrH phosphoserine phosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family | Back alignment and domain information |
|---|
| >PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated | Back alignment and domain information |
|---|
| >TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like | Back alignment and domain information |
|---|
| >PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases | Back alignment and domain information |
|---|
| >COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 | Back alignment and domain information |
|---|
| >PTZ00445 p36-lilke protein; Provisional | Back alignment and domain information |
|---|
| >COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 | Back alignment and domain information |
|---|
| >TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein | Back alignment and domain information |
|---|
| >COG0546 Gph Predicted phosphatases [General function prediction only] | Back alignment and domain information |
|---|
| >PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] | Back alignment and domain information |
|---|
| >PRK10748 flavin mononucleotide phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 301 | ||||
| 1ta0_A | 197 | Three-Dimensional Structure Of A Rna-Polymerase Ii | 6e-27 | ||
| 2ghq_A | 181 | Ctd-Specific Phosphatase Scp1 In Complex With Pepti | 6e-27 | ||
| 3l0y_A | 184 | Crystal Structure Of Scp1 Phosphatase D98a Mutant L | 7e-27 | ||
| 3pgl_A | 180 | Crystal Structure Of Human Small C-Terminal Domain | 7e-27 | ||
| 1t9z_A | 197 | Three-Dimensional Structure Of A Rna-Polymerase Ii | 2e-26 | ||
| 2q5e_A | 187 | Crystal Structure Of Human Carboxy-Terminal Domain | 3e-26 | ||
| 3l0c_A | 184 | Crystal Structure Of Scp1 Phosphatase D206a Mutant | 5e-26 | ||
| 3l0b_A | 184 | Crystal Structure Of Scp1 Phosphatase D206a Mutant | 5e-26 | ||
| 2hhl_A | 195 | Crystal Structure Of The Human Small Ctd Phosphatas | 2e-25 | ||
| 3qle_A | 204 | Structural Basis For The Function Of Tim50 In The M | 5e-22 | ||
| 3ef1_A | 442 | The Structure Of Fcp1, An Essential Rna Polymerase | 9e-04 |
| >pdb|1TA0|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein With Associated Ligand Length = 197 | Back alignment and structure |
|
| >pdb|2GHQ|A Chain A, Ctd-Specific Phosphatase Scp1 In Complex With Peptide C- Terminal Domain Of Rna Polymerase Ii Length = 181 | Back alignment and structure |
| >pdb|3L0Y|A Chain A, Crystal Structure Of Scp1 Phosphatase D98a Mutant Length = 184 | Back alignment and structure |
| >pdb|3PGL|A Chain A, Crystal Structure Of Human Small C-Terminal Domain Phosphatase 1 (Scp1) Bound To Rabeprazole Length = 180 | Back alignment and structure |
| >pdb|1T9Z|A Chain A, Three-Dimensional Structure Of A Rna-Polymerase Ii Binding Protein Length = 197 | Back alignment and structure |
| >pdb|2Q5E|A Chain A, Crystal Structure Of Human Carboxy-Terminal Domain Rna Polymerase Ii Polypeptide A Small Phosphatase 2 Length = 187 | Back alignment and structure |
| >pdb|3L0C|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant With Trap Inorganic Phosphate Length = 184 | Back alignment and structure |
| >pdb|3L0B|A Chain A, Crystal Structure Of Scp1 Phosphatase D206a Mutant Phosphory Intermediate Length = 184 | Back alignment and structure |
| >pdb|2HHL|A Chain A, Crystal Structure Of The Human Small Ctd Phosphatase 3 Isoform 1 Length = 195 | Back alignment and structure |
| >pdb|3QLE|A Chain A, Structural Basis For The Function Of Tim50 In The Mitochondrial Presequence Translocase Length = 204 | Back alignment and structure |
| >pdb|3EF1|A Chain A, The Structure Of Fcp1, An Essential Rna Polymerase Ii Ctd Phosphatase Length = 442 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 | Back alignment and structure |
|---|
Score = 203 bits (517), Expect = 2e-65
Identities = 62/191 (32%), Positives = 100/191 (52%), Gaps = 15/191 (7%)
Query: 119 QNLPQIAPSYWPRTPLREPIAGLPITLVLDLD--------------DFSFPIHSKMEVQT 164
Q +P +P P + +V+DLD DF P+ +
Sbjct: 5 QVIPIPSPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQ 64
Query: 165 VFVRQRPYLHMFLEAVASMFDVVIFTAGQSIYAGQLLDILDPNQTLIGQRVYRDSCVFAD 224
V+V +RP++ FL+ + +F+ V+FTA + YA + D+LD + R++R+SCVF
Sbjct: 65 VYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWG-VFRARLFRESCVFHR 123
Query: 225 GEYLKDLTILGRDLARIAIVDNTPQVFQLQVDNGIPIESWFGDPSDSALLSLLMFLETLV 284
G Y+KDL+ LGR+L+++ IVDN+P + +N +P++SWF D +D+ LL L+ F E L
Sbjct: 124 GNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLS 183
Query: 285 GADDVRPIIKQ 295
DD
Sbjct: 184 REDDEGHHHHH 194
|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 | Back alignment and structure |
|---|
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Length = 442 | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Length = 372 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 301 | |||
| 3qle_A | 204 | TIM50P; chaperone, mitochondrion, preprotein trans | 100.0 | |
| 2ght_A | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| 3shq_A | 320 | UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila | 100.0 | |
| 2hhl_A | 195 | CTD small phosphatase-like protein; CTD phosphatas | 100.0 | |
| 3ef1_A | 442 | RNA polymerase II subunit A C-terminal domain phos | 99.97 | |
| 3ef0_A | 372 | RNA polymerase II subunit A C-terminal domain phos | 99.97 | |
| 2wm8_A | 187 | MDP-1, magnesium-dependent phosphatase 1; haloacid | 97.75 | |
| 2fpr_A | 176 | Histidine biosynthesis bifunctional protein HISB; | 97.73 | |
| 3ib6_A | 189 | Uncharacterized protein; structural genomics, unkn | 97.68 | |
| 2pr7_A | 137 | Haloacid dehalogenase/epoxide hydrolase family; NP | 97.64 | |
| 3l8h_A | 179 | Putative haloacid dehalogenase-like hydrolase; HAD | 97.55 | |
| 2gmw_A | 211 | D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi | 97.19 | |
| 2p9j_A | 162 | Hypothetical protein AQ2171; secsg, riken, PSI, st | 97.18 | |
| 2oda_A | 196 | Hypothetical protein pspto_2114; haloacid dehaloge | 96.78 | |
| 3kbb_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 96.39 | |
| 3e8m_A | 164 | Acylneuraminate cytidylyltransferase; 2-keto-3-deo | 96.32 | |
| 3kzx_A | 231 | HAD-superfamily hydrolase, subfamily IA, variant; | 96.31 | |
| 3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 96.28 | |
| 2pib_A | 216 | Phosphorylated carbohydrates phosphatase TM_1254; | 96.24 | |
| 3e58_A | 214 | Putative beta-phosphoglucomutase; structu genomics | 96.15 | |
| 3nvb_A | 387 | Uncharacterized protein; protein FKBH, protein fkb | 96.13 | |
| 4eze_A | 317 | Haloacid dehalogenase-like hydrolase; magnesium bi | 96.1 | |
| 1k1e_A | 180 | Deoxy-D-mannose-octulosonate 8-phosphate phosphat; | 96.09 | |
| 1zrn_A | 232 | L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud | 96.02 | |
| 3qnm_A | 240 | Haloacid dehalogenase-like hydrolase; structural g | 95.85 | |
| 3umb_A | 233 | Dehalogenase-like hydrolase; 2.20A {Ralstonia sola | 95.82 | |
| 3s6j_A | 233 | Hydrolase, haloacid dehalogenase-like family; stru | 95.82 | |
| 2nyv_A | 222 | Pgpase, PGP, phosphoglycolate phosphatase; structu | 95.81 | |
| 3sd7_A | 240 | Putative phosphatase; structural genomics, haloaci | 95.81 | |
| 2gfh_A | 260 | Haloacid dehalogenase-like hydrolase domain conta; | 95.8 | |
| 3m1y_A | 217 | Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, | 95.76 | |
| 2hdo_A | 209 | Phosphoglycolate phosphatase; NP_784602.1, structu | 95.75 | |
| 3ed5_A | 238 | YFNB; APC60080, bacillus subtilis subsp. subtilis | 95.72 | |
| 2hoq_A | 241 | Putative HAD-hydrolase PH1655; haloacid dehalogena | 95.71 | |
| 2o2x_A | 218 | Hypothetical protein; structural genomics, joint c | 95.7 | |
| 1rku_A | 206 | Homoserine kinase; phosphoserine phosphatase, phos | 95.69 | |
| 4ex6_A | 237 | ALNB; modified rossman fold, phosphatase, magnesiu | 95.67 | |
| 2hsz_A | 243 | Novel predicted phosphatase; structural genomics, | 95.66 | |
| 3um9_A | 230 | Haloacid dehalogenase, type II; haloacid dehalogen | 95.62 | |
| 2ah5_A | 210 | COG0546: predicted phosphatases; MCSG, structural | 95.59 | |
| 2hi0_A | 240 | Putative phosphoglycolate phosphatase; YP_619066.1 | 95.55 | |
| 2no4_A | 240 | (S)-2-haloacid dehalogenase IVA; HAD superfamily, | 95.54 | |
| 3mn1_A | 189 | Probable YRBI family phosphatase; structural genom | 95.53 | |
| 3m9l_A | 205 | Hydrolase, haloacid dehalogenase-like family; HAD | 95.5 | |
| 4dcc_A | 229 | Putative haloacid dehalogenase-like hydrolase; mag | 95.37 | |
| 2i6x_A | 211 | Hydrolase, haloacid dehalogenase-like family; HAD | 95.32 | |
| 2zg6_A | 220 | Putative uncharacterized protein ST2620, probable | 95.28 | |
| 2r8e_A | 188 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphata | 95.23 | |
| 3mmz_A | 176 | Putative HAD family hydrolase; structural genomics | 95.23 | |
| 3u26_A | 234 | PF00702 domain protein; structural genomics, PSI-b | 95.19 | |
| 3mc1_A | 226 | Predicted phosphatase, HAD family; PSI2, NYSGXRC, | 95.14 | |
| 2hcf_A | 234 | Hydrolase, haloacid dehalogenase-like family; NP_6 | 95.04 | |
| 1qq5_A | 253 | Protein (L-2-haloacid dehalogenase); hydrolase; 1. | 94.98 | |
| 3cnh_A | 200 | Hydrolase family protein; NP_295428.1, predicted h | 94.97 | |
| 3skx_A | 280 | Copper-exporting P-type ATPase B; P1B-ATPase, ATP | 94.97 | |
| 3n1u_A | 191 | Hydrolase, HAD superfamily, subfamily III A; struc | 94.69 | |
| 2om6_A | 235 | Probable phosphoserine phosphatase; rossmann fold, | 94.68 | |
| 3ij5_A | 211 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 94.65 | |
| 1te2_A | 226 | Putative phosphatase; structural genomics, phospha | 94.6 | |
| 2w43_A | 201 | Hypothetical 2-haloalkanoic acid dehalogenase; hyd | 94.56 | |
| 2go7_A | 207 | Hydrolase, haloacid dehalogenase-like family; stru | 94.55 | |
| 4eek_A | 259 | Beta-phosphoglucomutase-related protein; hydrolase | 94.52 | |
| 3nuq_A | 282 | Protein SSM1, putative nucleotide phosphatase; sup | 94.35 | |
| 3n07_A | 195 | 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; | 94.35 | |
| 1yns_A | 261 | E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo | 94.33 | |
| 3iru_A | 277 | Phoshonoacetaldehyde hydrolase like protein; phosp | 94.26 | |
| 3smv_A | 240 | S-(-)-azetidine-2-carboxylate hydrolase; haloacid | 94.21 | |
| 3umc_A | 254 | Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru | 94.17 | |
| 3d6j_A | 225 | Putative haloacid dehalogenase-like hydrolase; str | 94.09 | |
| 3k1z_A | 263 | Haloacid dehalogenase-like hydrolase domain-conta | 93.96 | |
| 3qxg_A | 243 | Inorganic pyrophosphatase; hydrolase, magnesium bi | 93.9 | |
| 3fvv_A | 232 | Uncharacterized protein; unknown function, structu | 93.72 | |
| 3nas_A | 233 | Beta-PGM, beta-phosphoglucomutase; PSI, structural | 93.68 | |
| 3dv9_A | 247 | Beta-phosphoglucomutase; structural genomics, APC6 | 93.68 | |
| 1qyi_A | 384 | ZR25, hypothetical protein; structural genomics, P | 93.5 | |
| 3a1c_A | 287 | Probable copper-exporting P-type ATPase A; ATP-bin | 93.46 | |
| 3umg_A | 254 | Haloacid dehalogenase; defluorinase, hydrolase; 2. | 93.44 | |
| 3ddh_A | 234 | Putative haloacid dehalogenase-like family hydrol; | 93.3 | |
| 2qlt_A | 275 | (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac | 93.22 | |
| 2fea_A | 236 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 93.21 | |
| 1nnl_A | 225 | L-3-phosphoserine phosphatase; PSP, HPSP, phospho- | 92.9 | |
| 2pke_A | 251 | Haloacid delahogenase-like family hydrolase; NP_63 | 92.73 | |
| 2b0c_A | 206 | Putative phosphatase; alpha-D-glucose-1-phosphate, | 92.72 | |
| 4g9b_A | 243 | Beta-PGM, beta-phosphoglucomutase; HAD, putative p | 92.55 | |
| 2fi1_A | 190 | Hydrolase, haloacid dehalogenase-like family; stru | 92.48 | |
| 2obb_A | 142 | Hypothetical protein; structural genomics, PSI-2, | 92.38 | |
| 2wf7_A | 221 | Beta-PGM, beta-phosphoglucomutase; transition stat | 92.21 | |
| 4gib_A | 250 | Beta-phosphoglucomutase; rossmann fold, HAD-like, | 92.12 | |
| 3kd3_A | 219 | Phosphoserine phosphohydrolase-like protein; csgid | 91.81 | |
| 2p11_A | 231 | Hypothetical protein; putative haloacid dehalogena | 91.73 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 91.25 | |
| 3l5k_A | 250 | Protein GS1, haloacid dehalogenase-like hydrolase | 90.96 | |
| 3ocu_A | 262 | Lipoprotein E; hydrolase, outer membrane; HET: NMN | 90.88 | |
| 2b82_A | 211 | APHA, class B acid phosphatase; DDDD acid phosphat | 90.64 | |
| 3n28_A | 335 | Phosphoserine phosphatase; HAD family hydrolase, s | 89.53 | |
| 3pct_A | 260 | Class C acid phosphatase; hydrolase, outer membran | 89.24 | |
| 2i33_A | 258 | Acid phosphatase; HAD superfamily, hydrolase; 1.57 | 89.21 | |
| 3p96_A | 415 | Phosphoserine phosphatase SERB; ssgcid, structural | 89.04 | |
| 2fdr_A | 229 | Conserved hypothetical protein; SAD, structural ge | 89.0 | |
| 1swv_A | 267 | Phosphonoacetaldehyde hydrolase; HAD enzyme superf | 88.83 | |
| 3vay_A | 230 | HAD-superfamily hydrolase; rossmann fold, haloacid | 88.54 | |
| 2yj3_A | 263 | Copper-transporting ATPase; hydrolase, P-type ATPa | 87.07 | |
| 1xpj_A | 126 | Hypothetical protein; structural genomics, MCSG, p | 86.49 | |
| 3bwv_A | 180 | Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 | 86.29 | |
| 1q92_A | 197 | 5(3)-deoxyribonucleotidase; alpha-beta rossman fol | 85.18 | |
| 2g80_A | 253 | Protein UTR4; YEL038W, UTR4 protein (unknown trans | 84.32 | |
| 2i7d_A | 193 | 5'(3')-deoxyribonucleotidase, cytosolic type; hydr | 82.96 | |
| 4ap9_A | 201 | Phosphoserine phosphatase; hydrolase, haloacid deh | 81.59 | |
| 1l7m_A | 211 | Phosphoserine phosphatase; rossmann fold, four-hel | 81.36 | |
| 3ewi_A | 168 | N-acylneuraminate cytidylyltransferase; beta barre | 81.23 |
| >3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} | Back alignment and structure |
|---|
Probab=100.00 E-value=7.3e-46 Score=332.64 Aligned_cols=169 Identities=31% Similarity=0.635 Sum_probs=152.5
Q ss_pred CCCCCCCCCC--CCCCCcEEEEecCCceeeeeecCeeeeEEEEeCchHHHHHHHHHhCceEEEEcCCchHHHHHHHHHHC
Q 022210 128 YWPRTPLREP--IAGLPITLVLDLDDFSFPIHSKMEVQTVFVRQRPYLHMFLEAVASMFDVVIFTAGQSIYAGQLLDILD 205 (301)
Q Consensus 128 ~~~~llP~~~--~~~~K~tLVLDLDd~l~~v~~~~~~~~~~V~~RP~l~eFL~~ls~~fEIvIfTas~~~YA~~vld~LD 205 (301)
..+.|||++. ..++|+|||||||+|+++..+.. .++++|++|||+++||++|+++|||+||||+.+.||++|++.||
T Consensus 18 ~~~~lLp~~~~~~~~~~~tLVLDLDeTLvh~~~~~-~~~~~v~~RPgl~eFL~~l~~~yeivI~Tas~~~ya~~vl~~LD 96 (204)
T 3qle_A 18 PFPDLLPPPPPPPYQRPLTLVITLEDFLVHSEWSQ-KHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLD 96 (204)
T ss_dssp -CCCCSCCCC----CCSEEEEEECBTTTEEEEEET-TTEEEEEECTTHHHHHHHHTTTEEEEEECSSCHHHHHHHHHHTS
T ss_pred CcccCCCCCCccccCCCeEEEEeccccEEeeeccc-cCceeEEeCCCHHHHHHHHHhCCEEEEEcCCcHHHHHHHHHHhC
Confidence 3445555544 35889999999999999987753 35789999999999999999999999999999999999999999
Q ss_pred CCCceeeeEEecCccceeCCcccccccccCCCCCcEEEEECCchhcccCCCceeeccCccCCCCCHHHHHHHHHHhhcc-
Q 022210 206 PNQTLIGQRVYRDSCVFADGEYLKDLTILGRDLARIAIVDNTPQVFQLQVDNGIPIESWFGDPSDSALLSLLMFLETLV- 284 (301)
Q Consensus 206 p~~~~f~~rlyRe~C~~~~g~~iKDLs~Lgrdls~vIIVDdsp~~~~~qp~N~I~I~~f~gd~~D~eLl~L~~~L~~L~- 284 (301)
|.+++|.+|+||++|...+|.|+|||++|||++++||||||++.+|.+||+|||+|++|.|++ |++|++|+|||+.|+
T Consensus 97 p~~~~f~~rl~R~~c~~~~g~y~KdL~~Lgrdl~~vIiIDDsp~~~~~~p~N~I~I~~~~~~~-D~eL~~L~~~L~~L~~ 175 (204)
T 3qle_A 97 PIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEA-DDKLVRLIPFLEYLAT 175 (204)
T ss_dssp TTCSSEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEEESCTTTTTTCGGGEEECCCCCSSC-CCHHHHHHHHHHHHHH
T ss_pred CCCCeEEEEEEecceeEECCeeeecHHHhCCChHHEEEEECCHHHHhhCccCceEeeeECCCC-ChhHHHHHHHHHHHhh
Confidence 998899999999999999999999999999999999999999999999999999999999875 679999999999998
Q ss_pred -CCCChHHHHHhhhcC
Q 022210 285 -GADDVRPIIKQKYGS 299 (301)
Q Consensus 285 -~~~DVR~~l~~~f~~ 299 (301)
.++|||++|++ |+.
T Consensus 176 ~~~~DVR~~L~~-~~~ 190 (204)
T 3qle_A 176 QQTKDVRPILNS-FED 190 (204)
T ss_dssp TCCSCSHHHHTT-SSC
T ss_pred cChHHHHHHHHH-hcC
Confidence 58999999987 554
|
| >2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A | Back alignment and structure |
|---|
| >3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A | Back alignment and structure |
|---|
| >2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* | Back alignment and structure |
|---|
| >3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* | Back alignment and structure |
|---|
| >2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* | Back alignment and structure |
|---|
| >3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
|---|
| >3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} | Back alignment and structure |
|---|
| >4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* | Back alignment and structure |
|---|
| >1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A | Back alignment and structure |
|---|
| >3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A | Back alignment and structure |
|---|
| >3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A | Back alignment and structure |
|---|
| >3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A | Back alignment and structure |
|---|
| >2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 | Back alignment and structure |
|---|
| >1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A | Back alignment and structure |
|---|
| >4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A | Back alignment and structure |
|---|
| >2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} | Back alignment and structure |
|---|
| >2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} | Back alignment and structure |
|---|
| >2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* | Back alignment and structure |
|---|
| >3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A | Back alignment and structure |
|---|
| >3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* | Back alignment and structure |
|---|
| >4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A | Back alignment and structure |
|---|
| >2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* | Back alignment and structure |
|---|
| >3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A | Back alignment and structure |
|---|
| >3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A | Back alignment and structure |
|---|
| >3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* | Back alignment and structure |
|---|
| >3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} | Back alignment and structure |
|---|
| >1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A | Back alignment and structure |
|---|
| >2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A | Back alignment and structure |
|---|
| >3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* | Back alignment and structure |
|---|
| >3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} | Back alignment and structure |
|---|
| >1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A | Back alignment and structure |
|---|
| >3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 | Back alignment and structure |
|---|
| >3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} | Back alignment and structure |
|---|
| >3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A | Back alignment and structure |
|---|
| >3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 | Back alignment and structure |
|---|
| >3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I | Back alignment and structure |
|---|
| >3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 | Back alignment and structure |
|---|
| >1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A | Back alignment and structure |
|---|
| >2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 | Back alignment and structure |
|---|
| >4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} | Back alignment and structure |
|---|
| >2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 | Back alignment and structure |
|---|
| >2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 | Back alignment and structure |
|---|
| >2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A | Back alignment and structure |
|---|
| >4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} | Back alignment and structure |
|---|
| >3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A | Back alignment and structure |
|---|
| >2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A | Back alignment and structure |
|---|
| >3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} | Back alignment and structure |
|---|
| >2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A | Back alignment and structure |
|---|
| >3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 | Back alignment and structure |
|---|
| >1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A | Back alignment and structure |
|---|
| >3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* | Back alignment and structure |
|---|
| >1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 | Back alignment and structure |
|---|
| >3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A | Back alignment and structure |
|---|
| >2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 | Back alignment and structure |
|---|
| >2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* | Back alignment and structure |
|---|
| >4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A | Back alignment and structure |
|---|
| >1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* | Back alignment and structure |
|---|
| >3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 301 | ||||
| d1ta0a_ | 181 | c.108.1.16 (A:) Carboxy-terminal domain RNA polyme | 9e-46 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 150 bits (381), Expect = 9e-46
Identities = 66/189 (34%), Positives = 99/189 (52%), Gaps = 26/189 (13%)
Query: 121 LPQIAPSYWPRTPLREPIAGLPITLVLDLD--------------DFSFPIHSKMEVQTVF 166
LP+ + I +V+DLD DF P+ V V+
Sbjct: 5 LPEAKAQDSDK-----------ICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVY 53
Query: 167 VRQRPYLHMFLEAVASMFDVVIFTAGQSIYAGQLLDILDPNQTLIGQRVYRDSCVFADGE 226
V +RP++ FL+ + +F+ V+FTA + YA + D+LD R++R+SCVF G
Sbjct: 54 VLKRPHVDEFLQRMGELFECVLFTASLAKYADPVADLLDKWG-AFRARLFRESCVFHRGN 112
Query: 227 YLKDLTILGRDLARIAIVDNTPQVFQLQVDNGIPIESWFGDPSDSALLSLLMFLETLVGA 286
Y+KDL+ LGRDL R+ I+DN+P + DN +P+ SWF + SD+ L LL F E L
Sbjct: 113 YVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFFEQLSRV 172
Query: 287 DDVRPIIKQ 295
DDV +++Q
Sbjct: 173 DDVYSVLRQ 181
|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 301 | |||
| d1ta0a_ | 181 | Carboxy-terminal domain RNA polymerase II polypept | 100.0 | |
| d1u7pa_ | 164 | Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu | 97.85 | |
| d1ltqa1 | 149 | Polynucleotide kinase, phosphatase domain {Bacteri | 97.51 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 96.87 | |
| d1x42a1 | 230 | Hypothetical protein PH0459 {Archaeon Pyrococcus h | 96.69 | |
| d2hdoa1 | 207 | Phosphoglycolate phosphatase {Lactobacillus planta | 96.62 | |
| d1te2a_ | 218 | Phosphatase YniC {Escherichia coli [TaxId: 562]} | 96.4 | |
| d2fpwa1 | 161 | Histidine biosynthesis bifunctional protein HisB, | 96.35 | |
| d2go7a1 | 204 | Hypothetical protein SP2064 {Streptococcus pneumon | 96.3 | |
| d2hsza1 | 224 | Phosphoglycolate phosphatase Gph {Haemophilus somn | 96.27 | |
| d1xpja_ | 124 | Hypothetical protein VC0232 {Vibrio cholerae [TaxI | 96.08 | |
| d2gfha1 | 247 | N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m | 95.89 | |
| d2ah5a1 | 210 | predicted phosphatase SP0104 {Streptococcus pneumo | 95.79 | |
| d2o2xa1 | 209 | Hypothetical protein Mll2559 {Mesorhizobium loti [ | 95.26 | |
| d1swva_ | 257 | Phosphonoacetaldehyde hydrolase {Bacillus cereus [ | 95.22 | |
| d2hcfa1 | 228 | Hypothetical protein CT1708 {Chlorobium tepidum [T | 94.99 | |
| d1zrna_ | 220 | L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s | 94.28 | |
| d1zs9a1 | 253 | E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | 94.18 | |
| d1o08a_ | 221 | beta-Phosphoglucomutase {Lactococcus lactis [TaxId | 93.18 | |
| d2fi1a1 | 187 | Putative hydrolase SP0805 {Streptococcus pneumonia | 93.14 | |
| d2feaa1 | 226 | 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate | 92.92 | |
| d2bdua1 | 291 | Cytosolic 5'-nucleotidase III {Mouse (Mus musculus | 92.47 | |
| d2fdra1 | 222 | Hypothetical protein Atu0790 {Agrobacterium tumefa | 92.09 | |
| d2gmwa1 | 182 | D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc | 91.22 | |
| d1cr6a1 | 222 | Epoxide hydrolase, N-terminal domain {Mouse (Mus m | 91.12 | |
| d1qq5a_ | 245 | L-2-Haloacid dehalogenase, HAD {Xanthobacter autot | 90.98 | |
| d1j97a_ | 210 | Phosphoserine phosphatase {Archaeon Methanococcus | 90.04 | |
| d1nnla_ | 217 | Phosphoserine phosphatase {Human (Homo sapiens) [T | 88.32 | |
| d2amya1 | 243 | Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: | 87.02 | |
| d2b0ca1 | 197 | Putative phosphatase YihX {Escherichia coli [TaxId | 86.29 | |
| d1yj5a1 | 195 | 5' polynucleotide kinase-3' phosphatase, middle do | 85.83 | |
| d1zd3a1 | 225 | Epoxide hydrolase, N-terminal domain {Human (Homo | 83.7 |
| >d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: HAD-like superfamily: HAD-like family: NLI interacting factor-like phosphatase domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1e-46 Score=328.51 Aligned_cols=160 Identities=38% Similarity=0.677 Sum_probs=149.6
Q ss_pred CCCCCCCCcEEEEecCCceeeee--------------ecCeeeeEEEEeCchHHHHHHHHHhCceEEEEcCCchHHHHHH
Q 022210 135 REPIAGLPITLVLDLDDFSFPIH--------------SKMEVQTVFVRQRPYLHMFLEAVASMFDVVIFTAGQSIYAGQL 200 (301)
Q Consensus 135 ~~~~~~~K~tLVLDLDd~l~~v~--------------~~~~~~~~~V~~RP~l~eFL~~ls~~fEIvIfTas~~~YA~~v 200 (301)
.++..++|+|||||||+|+++.. .++....+||++|||+++||++|+++|||+|||||++.||++|
T Consensus 8 ~~~~~~~k~~LVLDLDeTLihs~~~~~~~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~~YA~~i 87 (181)
T d1ta0a_ 8 AKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPV 87 (181)
T ss_dssp CCGGGTTSCEEEECCBTTTEEEESSCCTTCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSSCHHHHHHH
T ss_pred CCcccCCCeEEEEeCCCCEEccccCCCCCccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCCcHHHHHHH
Confidence 34445889999999999998643 3456678899999999999999999999999999999999999
Q ss_pred HHHHCCCCceeeeEEecCccceeCCcccccccccCCCCCcEEEEECCchhcccCCCceeeccCccCCCCCHHHHHHHHHH
Q 022210 201 LDILDPNQTLIGQRVYRDSCVFADGEYLKDLTILGRDLARIAIVDNTPQVFQLQVDNGIPIESWFGDPSDSALLSLLMFL 280 (301)
Q Consensus 201 ld~LDp~~~~f~~rlyRe~C~~~~g~~iKDLs~Lgrdls~vIIVDdsp~~~~~qp~N~I~I~~f~gd~~D~eLl~L~~~L 280 (301)
++.|||++ .|.+++||++|....+.++|||+++||++++||||||++.+|..||+|||+|++|.|+++|++|..|++||
T Consensus 88 l~~ldp~~-~~~~~~~r~~c~~~~~~~~KdL~~l~~~l~~vvivDd~~~~~~~~~~N~I~I~~f~~~~~D~eL~~l~~~L 166 (181)
T d1ta0a_ 88 ADLLDKWG-AFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWFDNMSDTELHDLLPFF 166 (181)
T ss_dssp HHHHCSSC-CEEEEECGGGSEEETTEEECCGGGSCSCGGGEEEECSCGGGGTTCGGGBCCCCCCSSCTTCCHHHHHHHHH
T ss_pred HHHhccCC-ceeEEEEeeeeeecCCcccccHhhcCCCHHHeEEEcCChhhhhcCccCeeEecCcCCCCCcHHHHHHHHHH
Confidence 99999987 57899999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhccCCCChHHHHHh
Q 022210 281 ETLVGADDVRPIIKQ 295 (301)
Q Consensus 281 ~~L~~~~DVR~~l~~ 295 (301)
+.|+.++|||++|++
T Consensus 167 ~~l~~~~DVR~~l~~ 181 (181)
T d1ta0a_ 167 EQLSRVDDVYSVLRQ 181 (181)
T ss_dssp HHHTTCSCHHHHHCC
T ss_pred HHHccCCcHHHHhcC
Confidence 999999999999985
|
| >d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} | Back information, alignment and structure |
|---|
| >d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} | Back information, alignment and structure |
|---|
| >d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|