Citrus Sinensis ID: 022253


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MVNIITIYKLLLHGLLKLVGMTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASLVHANGQHN
cccHHHHHHHHHHHHHHHcccEEEEEEEcccEEEEEEcccccccccEEEEEccccccccccHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEcHHHHHHHHHHHHcccccccEEEEcccccccHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccccccccEEEEEEcccccccHHHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHHcccccccccc
cccHHHHHHHHHHHHHHHccccEEEEEccccEEEEEEEccccccccEEEEEEcccccHHHHHHHHHHHHHHcccEEEcccccccccccccccccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHcHHHccEEEEEcccccccccccccccHHccHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccEEEEEcccccEccHHHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHHHcccccccccc
MVNIITIYKLLLHGLLKLVGMtqrtieiepgtilniwvpkkttkKHAVVLLhpfgfdgiLTWQFQVLALAKTYevyvpdflffgssvtdrpdrtaSFQAECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFDIAcyklptlpaFVYKHILEALSDHRKERIELLQALVisdkefsiphfsQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAghlvnlerpfvynRQLKTILASLVHANGQHN
MVNIITIYKLLLHGLLKLVGMTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKglrklgvekCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASLVHANGQHN
MVNIITIYklllhgllklVGMTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASLVHANGQHN
**NIITIYKLLLHGLLKLVGMTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASLVH******
*VNIITIYKLLLHGLLKLVGMTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKT*************
MVNIITIYKLLLHGLLKLVGMTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASLVHANGQHN
MVNIITIYKLLLHGLLKLVGMTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASL********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNIITIYKLLLHGLLKLVGMTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASLVHANGQHN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query300 2.2.26 [Sep-21-2011]
P0A573341 Uncharacterized protein M yes no 0.716 0.630 0.253 9e-10
P0A572341 Uncharacterized protein R yes no 0.716 0.630 0.253 9e-10
Q8IUS5362 Epoxide hydrolase 4 OS=Ho yes no 0.753 0.624 0.227 9e-09
Q6GLL2337 Monoacylglycerol lipase a N/A no 0.83 0.738 0.25 2e-08
Q9BV23337 Monoacylglycerol lipase A no no 0.643 0.572 0.252 2e-08
Q0IIS3367 Epoxide hydrolase 3 OS=Xe yes no 0.803 0.656 0.221 2e-08
Q48MQ7259 Putative aminoacrylate hy no no 0.71 0.822 0.256 4e-08
Q1LZ86337 Monoacylglycerol lipase A yes no 0.61 0.543 0.264 1e-07
Q8R2Y0336 Monoacylglycerol lipase A yes no 0.683 0.610 0.243 2e-07
Q5XI64337 Monoacylglycerol lipase A yes no 0.663 0.590 0.245 2e-07
>sp|P0A573|Y2734_MYCBO Uncharacterized protein Mb2734 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2734 PE=3 SV=1 Back     alignment and function desciption
 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 109/249 (43%), Gaps = 34/249 (13%)

Query: 47  AVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGL 106
           A++L+H  G D   TW      LA+ + V  PD L  G S   R D + +  A  M   L
Sbjct: 39  AILLIHGIG-DNSTTWNGVHAKLAQRFTVIAPDLLGHGQSDKPRADYSVAAYANGMRDLL 97

Query: 107 RKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVS---NAALERIGY 163
             L +E+ T+VG S GG V  + A  +P LV+ +++  S  G+T+ V+     A   +G 
Sbjct: 98  SVLDIERVTIVGHSLGGGVAMQFAYQFPQLVDRLIL-VSAGGVTKDVNIVFRLASLPMGS 156

Query: 164 ESWVDFLLPKTADALKVQFDIA---------CYKLPT-------LP----AFVYKHILEA 203
           E+     LP    A+++   I           + LP        LP    +  +   L A
Sbjct: 157 EAMALLRLPLVLPAVQIAGRIVGKAIGTTSLGHDLPNVLRILDDLPEPTASAAFGRTLRA 216

Query: 204 LSDHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATM 263
           + D R + + +L    +++   +IP     + ++WG  D +  ++ A ++       + +
Sbjct: 217 VVDWRGQMVTMLDRCYLTE---AIP-----VQIIWGTKDVVLPVRHA-HMAHAAMPGSQL 267

Query: 264 ESIEKAGHL 272
           E  E +GH 
Sbjct: 268 EIFEGSGHF 276





Mycobacterium bovis (taxid: 1765)
>sp|P0A572|Y2715_MYCTU Uncharacterized protein Rv2715/MT2788 OS=Mycobacterium tuberculosis GN=Rv2715 PE=3 SV=1 Back     alignment and function description
>sp|Q8IUS5|EPHX4_HUMAN Epoxide hydrolase 4 OS=Homo sapiens GN=EPHX4 PE=2 SV=2 Back     alignment and function description
>sp|Q6GLL2|ABH6A_XENLA Monoacylglycerol lipase abhd6-A OS=Xenopus laevis GN=abhd6-a PE=2 SV=1 Back     alignment and function description
>sp|Q9BV23|ABHD6_HUMAN Monoacylglycerol lipase ABHD6 OS=Homo sapiens GN=ABHD6 PE=2 SV=1 Back     alignment and function description
>sp|Q0IIS3|EPHX3_XENTR Epoxide hydrolase 3 OS=Xenopus tropicalis GN=ephx3 PE=2 SV=1 Back     alignment and function description
>sp|Q48MQ7|RUTD_PSE14 Putative aminoacrylate hydrolase RutD OS=Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6) GN=rutD PE=3 SV=1 Back     alignment and function description
>sp|Q1LZ86|ABHD6_BOVIN Monoacylglycerol lipase ABHD6 OS=Bos taurus GN=ABHD6 PE=2 SV=1 Back     alignment and function description
>sp|Q8R2Y0|ABHD6_MOUSE Monoacylglycerol lipase ABHD6 OS=Mus musculus GN=Abhd6 PE=2 SV=1 Back     alignment and function description
>sp|Q5XI64|ABHD6_RAT Monoacylglycerol lipase ABHD6 OS=Rattus norvegicus GN=Abhd6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
224077844307 predicted protein [Populus trichocarpa] 0.99 0.967 0.617 1e-106
224105383302 predicted protein [Populus trichocarpa] 0.983 0.976 0.617 1e-103
359475342303 PREDICTED: putative aminoacrylate hydrol 0.973 0.963 0.565 3e-93
359475344304 PREDICTED: putative aminoacrylate hydrol 0.973 0.960 0.562 1e-92
356559398316 PREDICTED: epoxide hydrolase 3-like [Gly 0.99 0.939 0.514 3e-92
357518259314 Epoxide hydrolase [Medicago truncatula] 0.986 0.942 0.528 4e-92
15234460317 hydrolase, alpha/beta fold family protei 0.973 0.921 0.527 2e-91
297798244315 predicted protein [Arabidopsis lyrata su 0.993 0.946 0.519 3e-91
356559396316 PREDICTED: epoxide hydrolase 4-like [Gly 0.986 0.936 0.512 1e-90
21593332317 putative hydrolase [Arabidopsis thaliana 0.973 0.921 0.524 1e-90
>gi|224077844|ref|XP_002305433.1| predicted protein [Populus trichocarpa] gi|222848397|gb|EEE85944.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/306 (61%), Positives = 231/306 (75%), Gaps = 9/306 (2%)

Query: 1   MVNIITIYKLLLHGLLKLVGMTQRTIEIEPGTILNIWVPKKTT--------KKHAVVLLH 52
           MVN++T+Y  LL  L+KLVG+  + +EIEPGT++  WVP   T         K AVV +H
Sbjct: 1   MVNVLTMYMSLLRALMKLVGVKPQAVEIEPGTVMRFWVPSDQTTSNTKNKPDKPAVVFVH 60

Query: 53  PFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGLRKLGVE 112
            F  DGILTWQFQVLALAK Y VYVPD LFFG S+TD+ +R  +FQAEC AKGL KLGVE
Sbjct: 61  GFELDGILTWQFQVLALAKEYAVYVPDLLFFGESITDKKERKVAFQAECTAKGLTKLGVE 120

Query: 113 KCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLP 172
           KCTLVG+SYGG+V FKMAEMYPDLVESMVV C+VM +TES+S A LERIG+ SW ++L+P
Sbjct: 121 KCTLVGMSYGGVVCFKMAEMYPDLVESMVVGCTVMAMTESISRAGLERIGFSSWSEYLMP 180

Query: 173 KTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISDKEFSIPHFSQ 232
            T   +K    +A YKLP +P FV+K ILE + D+RKER+ELLQ LV+SDK+F +P FSQ
Sbjct: 181 DTVKGVKDLLLVATYKLPWMPDFVFKSILEVMFDNRKERLELLQELVVSDKDFIVPRFSQ 240

Query: 233 KIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASL 292
           KIHLLWG +D IF+M+ ARNLKEQ+   AT++ IE AGHLV  ERP  YN+ LK ILASL
Sbjct: 241 KIHLLWGGDDIIFNMEEARNLKEQLEGKATLQFIENAGHLVQSERPSAYNKHLKKILASL 300

Query: 293 VHANGQ 298
            H +G+
Sbjct: 301 -HEDGK 305




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224105383|ref|XP_002313792.1| predicted protein [Populus trichocarpa] gi|222850200|gb|EEE87747.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359475342|ref|XP_003631664.1| PREDICTED: putative aminoacrylate hydrolase RutD-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475344|ref|XP_003631665.1| PREDICTED: putative aminoacrylate hydrolase RutD-like isoform 2 [Vitis vinifera] gi|297741467|emb|CBI32598.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356559398|ref|XP_003547986.1| PREDICTED: epoxide hydrolase 3-like [Glycine max] Back     alignment and taxonomy information
>gi|357518259|ref|XP_003629418.1| Epoxide hydrolase [Medicago truncatula] gi|355523440|gb|AET03894.1| Epoxide hydrolase [Medicago truncatula] Back     alignment and taxonomy information
>gi|15234460|ref|NP_195379.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana] gi|4006902|emb|CAB16832.1| putative protein [Arabidopsis thaliana] gi|7270609|emb|CAB80327.1| putative protein [Arabidopsis thaliana] gi|110741136|dbj|BAE98661.1| hypothetical protein [Arabidopsis thaliana] gi|114050589|gb|ABI49444.1| At4g36610 [Arabidopsis thaliana] gi|332661277|gb|AEE86677.1| hydrolase, alpha/beta fold family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297798244|ref|XP_002867006.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297312842|gb|EFH43265.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356559396|ref|XP_003547985.1| PREDICTED: epoxide hydrolase 4-like [Glycine max] Back     alignment and taxonomy information
>gi|21593332|gb|AAM65281.1| putative hydrolase [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query300
TAIR|locus:2062126313 AT2G18360 "AT2G18360" [Arabido 0.856 0.821 0.534 8.3e-81
TAIR|locus:2115435317 AT4G36610 [Arabidopsis thalian 0.98 0.927 0.506 2e-79
TAIR|locus:2184777311 AT5G09430 [Arabidopsis thalian 0.85 0.819 0.335 2.9e-39
TAIR|locus:2194744314 AT1G78210 [Arabidopsis thalian 0.893 0.853 0.327 3.7e-39
TAIR|locus:505006573328 AT4G39955 [Arabidopsis thalian 0.936 0.856 0.305 1.5e-37
TAIR|locus:2125909307 AT4G33180 [Arabidopsis thalian 0.856 0.837 0.322 1.3e-36
TAIR|locus:2018856332 AT1G17430 [Arabidopsis thalian 0.876 0.792 0.314 6.5e-35
UNIPROTKB|Q9KUJ8270 VC_0522 "Beta-ketoadipate enol 0.796 0.885 0.248 2.2e-10
TIGR_CMR|VC_0522270 VC_0522 "beta-ketoadipate enol 0.796 0.885 0.248 2.2e-10
UNIPROTKB|Q9BV23337 ABHD6 "Monoacylglycerol lipase 0.836 0.744 0.246 5.4e-10
TAIR|locus:2062126 AT2G18360 "AT2G18360" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 736 (264.1 bits), Expect = 8.3e-81, Sum P(2) = 8.3e-81
 Identities = 138/258 (53%), Positives = 194/258 (75%)

Query:    39 PKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQ 98
             P+K TK   ++ +H F  +GI+TWQFQV +LAK Y VY+PD LFFG S +D  DR+ +FQ
Sbjct:    57 PQKPTKP-VLLFIHGFAAEGIVTWQFQVGSLAKKYSVYIPDLLFFGGSYSDNADRSPAFQ 115

Query:    99 AECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAAL 158
             A C+ K LR LG+EK TLVG SYGGMV FK+AE YP++V++MVV+ S++ +T+++S + L
Sbjct:   116 AHCLVKSLRILGIEKFTLVGFSYGGMVAFKIAEEYPEMVQAMVVSGSILAMTDTISESNL 175

Query:   159 ERIGYESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQAL 218
              ++G++S  D LLP +   LK  F +A +K    P  ++K  +E +  +RKER ELL+AL
Sbjct:   176 NQLGFKSSADLLLPTSVKGLKTLFTLAVHKPMWFPKRLFKDFIEVMITNRKERAELLEAL 235

Query:   219 VISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERP 278
             VIS+K+ +IP F QKIHLLWGE+D+IF+++ A+++KEQ+G+NATMESI+KAGHL +LERP
Sbjct:   236 VISNKDVTIPRFQQKIHLLWGESDQIFNLEFAKSMKEQLGENATMESIKKAGHLAHLERP 295

Query:   279 FVYNRQLKTILASLVHAN 296
              VYNR+LK  LAS+   N
Sbjct:   296 CVYNRRLKKFLASVYSEN 313


GO:0016787 "hydrolase activity" evidence=ISS
TAIR|locus:2115435 AT4G36610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2184777 AT5G09430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2194744 AT1G78210 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006573 AT4G39955 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125909 AT4G33180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018856 AT1G17430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUJ8 VC_0522 "Beta-ketoadipate enol-lactone hydrolase, putative" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0522 VC_0522 "beta-ketoadipate enol-lactone hydrolase, putative" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BV23 ABHD6 "Monoacylglycerol lipase ABHD6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.1.10LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
COG0596282 COG0596, MhpC, Predicted hydrolases or acyltransfe 5e-28
pfam12697187 pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam 2e-23
pfam00561226 pfam00561, Abhydrolase_1, alpha/beta hydrolase fol 5e-16
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subun 2e-15
TIGR03695252 TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cy 3e-15
TIGR02427251 TIGR02427, protocat_pcaD, 3-oxoadipate enol-lacton 7e-08
PLN02578354 PLN02578, PLN02578, hydrolase 1e-07
TIGR03611248 TIGR03611, RutD, pyrimidine utilization protein D 1e-06
PRK00870302 PRK00870, PRK00870, haloalkane dehalogenase; Provi 2e-06
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 5e-05
PRK08775343 PRK08775, PRK08775, homoserine O-acetyltransferase 2e-04
TIGR01738245 TIGR01738, bioH, pimelyl-[acyl-carrier protein] me 2e-04
TIGR01250289 TIGR01250, pro_imino_pep_2, proline-specific pepti 0.001
pfam12695145 pfam12695, Abhydrolase_5, Alpha/beta hydrolase fam 0.002
COG2021368 COG2021, MET2, Homoserine acetyltransferase [Amino 0.003
PLN02679360 PLN02679, PLN02679, hydrolase, alpha/beta fold fam 0.003
>gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
 Score =  109 bits (272), Expect = 5e-28
 Identities = 68/264 (25%), Positives = 96/264 (36%), Gaps = 18/264 (6%)

Query: 45  KHAVVLLHPFGFDG-ILTWQFQVLA-LAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECM 102
              +VLLH F     +    F+VL  LA  Y V  PD    G S  D    + S  A+ +
Sbjct: 21  GPPLVLLHGFPGSSSVWRPVFKVLPALAARYRVIAPDLRGHGRS--DPAGYSLSAYADDL 78

Query: 103 AKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIG 162
           A  L  LG+EK  LVG S GG V   +A  +PD V  +V+           +        
Sbjct: 79  AALLDALGLEKVVLVGHSMGGAVALALALRHPDRVRGLVLIGPAPPPGLLEAALRQPAGA 138

Query: 163 YESWVDFLLPKTADALKV-QFDIACYKLPTLPAFVYKHILEALSDHRKERIEL------- 214
                   L    DA        A   L  L A     + EAL                 
Sbjct: 139 APLAALADLLLGLDAAAFAALLAALGLLAALAAAARAGLAEALRAPLLGAAAAAFARAAR 198

Query: 215 ------LQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEK 268
                 L AL+  D   ++   +    ++ GE+D +   ++AR L   +  +A +  I  
Sbjct: 199 ADLAAALLALLDRDLRAALARITVPTLIIHGEDDPVVPAELARRLAAALPNDARLVVIPG 258

Query: 269 AGHLVNLERPFVYNRQLKTILASL 292
           AGH  +LE P  +   L   L  L
Sbjct: 259 AGHFPHLEAPEAFAAALLAFLERL 282


Length = 282

>gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|234315 TIGR03695, menH_SHCHC, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>gnl|CDD|131480 TIGR02427, protocat_pcaD, 3-oxoadipate enol-lactonase Back     alignment and domain information
>gnl|CDD|215315 PLN02578, PLN02578, hydrolase Back     alignment and domain information
>gnl|CDD|211851 TIGR03611, RutD, pyrimidine utilization protein D Back     alignment and domain information
>gnl|CDD|179147 PRK00870, PRK00870, haloalkane dehalogenase; Provisional Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|181553 PRK08775, PRK08775, homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130799 TIGR01738, bioH, pimelyl-[acyl-carrier protein] methyl ester esterase Back     alignment and domain information
>gnl|CDD|188121 TIGR01250, pro_imino_pep_2, proline-specific peptidase, Bacillus coagulans-type subfamily Back     alignment and domain information
>gnl|CDD|221718 pfam12695, Abhydrolase_5, Alpha/beta hydrolase family Back     alignment and domain information
>gnl|CDD|224932 COG2021, MET2, Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178283 PLN02679, PLN02679, hydrolase, alpha/beta fold family protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 300
PLN02824294 hydrolase, alpha/beta fold family protein 100.0
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 100.0
PRK03592295 haloalkane dehalogenase; Provisional 100.0
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 100.0
PLN02679360 hydrolase, alpha/beta fold family protein 100.0
PRK10349256 carboxylesterase BioH; Provisional 100.0
PRK00870302 haloalkane dehalogenase; Provisional 100.0
PRK03204286 haloalkane dehalogenase; Provisional 100.0
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 100.0
PLN02578354 hydrolase 100.0
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 100.0
PRK06489360 hypothetical protein; Provisional 100.0
PLN03084383 alpha/beta hydrolase fold protein; Provisional 100.0
PLN02385349 hydrolase; alpha/beta fold family protein 100.0
PLN02965255 Probable pheophorbidase 100.0
PRK10673255 acyl-CoA esterase; Provisional 100.0
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 100.0
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 100.0
TIGR03611257 RutD pyrimidine utilization protein D. This protei 100.0
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 100.0
PRK10749330 lysophospholipase L2; Provisional 100.0
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 100.0
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 100.0
PHA02857276 monoglyceride lipase; Provisional 100.0
PRK08775343 homoserine O-acetyltransferase; Provisional 100.0
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 100.0
PRK07581339 hypothetical protein; Validated 100.0
PLN02298330 hydrolase, alpha/beta fold family protein 100.0
PLN02894402 hydrolase, alpha/beta fold family protein 100.0
PRK00175379 metX homoserine O-acetyltransferase; Provisional 100.0
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 100.0
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 100.0
PLN02211273 methyl indole-3-acetate methyltransferase 100.0
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 100.0
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 100.0
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 100.0
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 100.0
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 100.0
COG2267298 PldB Lysophospholipase [Lipid metabolism] 100.0
PLN02652395 hydrolase; alpha/beta fold family protein 99.98
PLN02511388 hydrolase 99.98
KOG2984277 consensus Predicted hydrolase [General function pr 99.97
KOG1455313 consensus Lysophospholipase [Lipid transport and m 99.97
PRK05855 582 short chain dehydrogenase; Validated 99.97
COG1647243 Esterase/lipase [General function prediction only] 99.97
KOG2382315 consensus Predicted alpha/beta hydrolase [General 99.96
PRK06765389 homoserine O-acetyltransferase; Provisional 99.96
PRK13604307 luxD acyl transferase; Provisional 99.96
PRK10985324 putative hydrolase; Provisional 99.96
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 99.96
PRK05077414 frsA fermentation/respiration switch protein; Revi 99.96
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 99.95
PLN02872395 triacylglycerol lipase 99.94
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 99.94
PRK11071190 esterase YqiA; Provisional 99.94
PRK10566249 esterase; Provisional 99.93
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 99.93
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 99.92
PRK07868 994 acyl-CoA synthetase; Validated 99.92
KOG2564343 consensus Predicted acetyltransferases and hydrola 99.91
KOG1552258 consensus Predicted alpha/beta hydrolase [General 99.91
KOG4391300 consensus Predicted alpha/beta hydrolase BEM46 [Ge 99.91
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 99.91
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 99.9
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 99.9
PF03096283 Ndr: Ndr family; InterPro: IPR004142 This family c 99.89
COG2021368 MET2 Homoserine acetyltransferase [Amino acid tran 99.88
COG3208244 GrsT Predicted thioesterase involved in non-riboso 99.88
KOG1838409 consensus Alpha/beta hydrolase [General function p 99.87
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 99.87
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 99.87
KOG2931326 consensus Differentiation-related gene 1 protein ( 99.86
PRK11460232 putative hydrolase; Provisional 99.86
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 99.86
KOG4667269 consensus Predicted esterase [Lipid transport and 99.85
PLN00021313 chlorophyllase 99.84
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 99.82
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 99.82
PLN02442283 S-formylglutathione hydrolase 99.81
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 99.8
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 99.8
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 99.79
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 99.78
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 99.78
PRK10162318 acetyl esterase; Provisional 99.77
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 99.77
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 99.76
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 99.75
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 99.75
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 99.75
COG0400207 Predicted esterase [General function prediction on 99.72
COG2945210 Predicted hydrolase of the alpha/beta superfamily 99.72
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.71
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 99.7
COG0412236 Dienelactone hydrolase and related enzymes [Second 99.7
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 99.69
PRK10115686 protease 2; Provisional 99.67
KOG2565469 consensus Predicted hydrolases or acyltransferases 99.67
COG3458321 Acetyl esterase (deacetylase) [Secondary metabolit 99.66
COG4757281 Predicted alpha/beta hydrolase [General function p 99.66
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 99.64
PF02273294 Acyl_transf_2: Acyl transferase; InterPro: IPR0031 99.63
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 99.62
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 99.62
COG3571213 Predicted hydrolase of the alpha/beta-hydrolase fo 99.6
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 99.59
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 99.59
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 99.57
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 99.55
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 99.55
PRK102521296 entF enterobactin synthase subunit F; Provisional 99.54
PF02129272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 99.53
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 99.52
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 99.5
PRK05371 767 x-prolyl-dipeptidyl aminopeptidase; Provisional 99.49
KOG3043242 consensus Predicted hydrolase related to dienelact 99.47
KOG3975301 consensus Uncharacterized conserved protein [Funct 99.46
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 99.44
KOG1515336 consensus Arylacetamide deacetylase [Defense mecha 99.43
KOG2551230 consensus Phospholipase/carboxyhydrolase [Amino ac 99.43
COG3319257 Thioesterase domains of type I polyketide synthase 99.43
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 99.43
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 99.42
COG0657312 Aes Esterase/lipase [Lipid metabolism] 99.39
KOG4627270 consensus Kynurenine formamidase [Amino acid trans 99.38
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 99.38
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 99.36
PRK04940180 hypothetical protein; Provisional 99.34
PF10503220 Esterase_phd: Esterase PHB depolymerase 99.34
KOG2100755 consensus Dipeptidyl aminopeptidase [Posttranslati 99.33
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 99.28
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 99.25
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 99.25
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 99.24
KOG2112206 consensus Lysophospholipase [Lipid transport and m 99.24
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 99.21
COG4188365 Predicted dienelactone hydrolase [General function 99.17
PF11339 581 DUF3141: Protein of unknown function (DUF3141); In 99.15
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 99.12
KOG2281867 consensus Dipeptidyl aminopeptidases/acylaminoacyl 99.09
COG4814288 Uncharacterized protein with an alpha/beta hydrola 99.09
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 99.09
COG4099387 Predicted peptidase [General function prediction o 99.07
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 99.06
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 99.04
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 99.04
KOG3253 784 consensus Predicted alpha/beta hydrolase [General 99.03
KOG1553517 consensus Predicted alpha/beta hydrolase BAT5 [Gen 98.99
KOG3847399 consensus Phospholipase A2 (platelet-activating fa 98.96
COG3150191 Predicted esterase [General function prediction on 98.95
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 98.91
PF05705240 DUF829: Eukaryotic protein of unknown function (DU 98.9
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 98.89
PF04301213 DUF452: Protein of unknown function (DUF452); Inte 98.89
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 98.88
PF10142367 PhoPQ_related: PhoPQ-activated pathogenicity-relat 98.86
COG2936 563 Predicted acyl esterases [General function predict 98.83
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 98.81
PLN02606306 palmitoyl-protein thioesterase 98.81
COG1075336 LipA Predicted acetyltransferases and hydrolases w 98.73
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 98.72
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 98.66
COG4782377 Uncharacterized protein conserved in bacteria [Fun 98.62
PF05577 434 Peptidase_S28: Serine carboxypeptidase S28; InterP 98.62
KOG1551371 consensus Uncharacterized conserved protein [Funct 98.61
PF12048310 DUF3530: Protein of unknown function (DUF3530); In 98.61
KOG4840299 consensus Predicted hydrolases or acyltransferases 98.56
COG1073299 Hydrolases of the alpha/beta superfamily [General 98.52
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 98.5
PLN02209437 serine carboxypeptidase 98.48
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 98.45
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 98.44
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 98.4
COG1505648 Serine proteases of the peptidase family S9A [Amin 98.39
KOG3724 973 consensus Negative regulator of COPII vesicle form 98.37
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 98.35
COG1770682 PtrB Protease II [Amino acid transport and metabol 98.34
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 98.34
COG4553415 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipi 98.34
KOG2237712 consensus Predicted serine protease [Posttranslati 98.2
KOG3101283 consensus Esterase D [General function prediction 98.18
PF11144403 DUF2920: Protein of unknown function (DUF2920); In 98.16
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 98.09
PLN02633314 palmitoyl protein thioesterase family protein 98.05
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 98.01
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 98.0
PF00135 535 COesterase: Carboxylesterase family The prints ent 97.96
KOG2183 492 consensus Prolylcarboxypeptidase (angiotensinase C 97.95
COG2382299 Fes Enterochelin esterase and related enzymes [Ino 97.87
PF0408363 Abhydro_lipase: Partial alpha/beta-hydrolase lipas 97.85
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 97.78
COG2939 498 Carboxypeptidase C (cathepsin A) [Amino acid trans 97.73
KOG3967297 consensus Uncharacterized conserved protein [Funct 97.68
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 97.66
COG0627316 Predicted esterase [General function prediction on 97.66
COG2819264 Predicted hydrolase of the alpha/beta superfamily 97.64
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 97.53
KOG2182 514 consensus Hydrolytic enzymes of the alpha/beta hyd 97.44
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 97.36
COG2830214 Uncharacterized protein conserved in bacteria [Fun 97.33
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 97.32
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 97.3
KOG12022376 consensus Animal-type fatty acid synthase and rela 97.28
PF06441112 EHN: Epoxide hydrolase N terminus; InterPro: IPR01 97.19
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 97.17
KOG2369473 consensus Lecithin:cholesterol acyltransferase (LC 97.11
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 97.0
KOG2521350 consensus Uncharacterized conserved protein [Funct 96.84
PLN02162475 triacylglycerol lipase 96.82
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 96.81
KOG4372405 consensus Predicted alpha/beta hydrolase [General 96.77
PLN00413479 triacylglycerol lipase 96.75
TIGR03712511 acc_sec_asp2 accessory Sec system protein Asp2. Th 96.71
KOG1516 545 consensus Carboxylesterase and related proteins [G 96.68
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 96.59
COG4287 507 PqaA PhoPQ-activated pathogenicity-related protein 96.57
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 96.55
PLN02571413 triacylglycerol lipase 96.55
PLN02454414 triacylglycerol lipase 96.54
PF05576 448 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 96.33
PLN02408365 phospholipase A1 96.32
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 96.2
PLN02934515 triacylglycerol lipase 96.11
PLN02310405 triacylglycerol lipase 96.03
PLN02324415 triacylglycerol lipase 95.92
PF06850202 PHB_depo_C: PHB de-polymerase C-terminus; InterPro 95.91
COG4947227 Uncharacterized protein conserved in bacteria [Fun 95.87
PLN02802509 triacylglycerol lipase 95.7
PLN02753531 triacylglycerol lipase 95.56
PLN03037525 lipase class 3 family protein; Provisional 95.48
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 95.43
PLN02719518 triacylglycerol lipase 95.4
PLN02761527 lipase class 3 family protein 95.33
PF07519 474 Tannase: Tannase and feruloyl esterase; InterPro: 95.02
KOG4569336 consensus Predicted lipase [Lipid transport and me 94.82
KOG4388 880 consensus Hormone-sensitive lipase HSL [Lipid tran 94.62
PLN02847 633 triacylglycerol lipase 94.39
COG5153425 CVT17 Putative lipase essential for disintegration 92.58
KOG4540425 consensus Putative lipase essential for disintegra 92.58
PF09949100 DUF2183: Uncharacterized conserved protein (DUF218 92.33
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 92.26
KOG2385633 consensus Uncharacterized conserved protein [Funct 89.73
KOG2029697 consensus Uncharacterized conserved protein [Funct 89.62
PF03283361 PAE: Pectinacetylesterase 88.74
PRK124673956 peptide synthase; Provisional 87.44
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 85.95
PF09994277 DUF2235: Uncharacterized alpha/beta hydrolase doma 83.11
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 81.86
smart00827298 PKS_AT Acyl transferase domain in polyketide synth 80.03
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
Probab=100.00  E-value=6.9e-41  Score=260.82  Aligned_cols=266  Identities=19%  Similarity=0.201  Sum_probs=183.6

Q ss_pred             CcccceeecCCCeEEEEEccCCCCCCceEEEEcCCCCCchhhHHHHHHhhhcCceEEeecCCCCCCCCCCC-------CC
Q 022253           20 GMTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDR-------PD   92 (300)
Q Consensus        20 ~~~~~~i~~~~g~~l~~~~~~~~~~~~~vv~lhG~~~~~~~~~~~~~~~l~~~~~v~~~d~~G~G~s~~~~-------~~   92 (300)
                      ..+.++++. +|.+++|...|.  ++++|||+||+++++. .|..+++.|+++|+|+++|+||||.|+.+.       ..
T Consensus         7 ~~~~~~~~~-~~~~i~y~~~G~--~~~~vlllHG~~~~~~-~w~~~~~~L~~~~~vi~~DlpG~G~S~~~~~~~~~~~~~   82 (294)
T PLN02824          7 QVETRTWRW-KGYNIRYQRAGT--SGPALVLVHGFGGNAD-HWRKNTPVLAKSHRVYAIDLLGYGYSDKPNPRSAPPNSF   82 (294)
T ss_pred             CCCCceEEE-cCeEEEEEEcCC--CCCeEEEECCCCCChh-HHHHHHHHHHhCCeEEEEcCCCCCCCCCCcccccccccc
Confidence            455677888 799999988774  4589999999999999 999999999988999999999999998754       24


Q ss_pred             CChHHHHHHHHHHHHHhCCcceEEEEEehhHHHHHHHHHhCcccccceEEEcccCCCCccchhhhhhccchhhhhhccC-
Q 022253           93 RTASFQAECMAKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLL-  171 (300)
Q Consensus        93 ~~~~~~~~~~~~~i~~~~~~~~~lvG~S~Gg~~a~~~a~~~p~~v~~~vl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  171 (300)
                      ++++++++++.++++.++.++++++||||||.+++.+|.++|++|+++|++++....................+...+. 
T Consensus        83 ~~~~~~a~~l~~~l~~l~~~~~~lvGhS~Gg~va~~~a~~~p~~v~~lili~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  162 (294)
T PLN02824         83 YTFETWGEQLNDFCSDVVGDPAFVICNSVGGVVGLQAAVDAPELVRGVMLINISLRGLHIKKQPWLGRPFIKAFQNLLRE  162 (294)
T ss_pred             CCHHHHHHHHHHHHHHhcCCCeEEEEeCHHHHHHHHHHHhChhheeEEEEECCCcccccccccchhhhHHHHHHHHHHhc
Confidence            8899999999999999999999999999999999999999999999999999864321100000000000000000000 


Q ss_pred             ----------cccHHHHHHHHHHhhccCCCChHHHHHHHHHHHhcchhhHHHHHHHhhh-c---ccCCCCCCCcceEEEE
Q 022253          172 ----------PKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVI-S---DKEFSIPHFSQKIHLL  237 (300)
Q Consensus       172 ----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~---~~~~~~~~i~~P~l~i  237 (300)
                                ..........+.................+......  ......+..+.. .   .....+.++++|+++|
T Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~lvi  240 (294)
T PLN02824        163 TAVGKAFFKSVATPETVKNILCQCYHDDSAVTDELVEAILRPGLE--PGAVDVFLDFISYSGGPLPEELLPAVKCPVLIA  240 (294)
T ss_pred             hhHHHHHHHhhcCHHHHHHHHHHhccChhhccHHHHHHHHhccCC--chHHHHHHHHhccccccchHHHHhhcCCCeEEE
Confidence                      00011111222111111111222222221111100  111111111111 0   1124567899999999


Q ss_pred             eeCCCcccCHHHHHHHHHHhCCCceEEEEcCCCCcccccChHHHHHHHHHHHhhc
Q 022253          238 WGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILASL  292 (300)
Q Consensus       238 ~g~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~gH~~~~~~~~~~~~~i~~fl~~~  292 (300)
                      +|++|.+++.+.++.+.+..+ ++++++++++||++++|+|+++++.|.+|++++
T Consensus       241 ~G~~D~~~~~~~~~~~~~~~~-~~~~~~i~~~gH~~~~e~p~~~~~~i~~fl~~~  294 (294)
T PLN02824        241 WGEKDPWEPVELGRAYANFDA-VEDFIVLPGVGHCPQDEAPELVNPLIESFVARH  294 (294)
T ss_pred             EecCCCCCChHHHHHHHhcCC-ccceEEeCCCCCChhhhCHHHHHHHHHHHHhcC
Confidence            999999999999988877665 789999999999999999999999999999764



>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>KOG2984 consensus Predicted hydrolase [General function prediction only] Back     alignment and domain information
>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>KOG1552 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG4391 consensus Predicted alpha/beta hydrolase BEM46 [General function prediction only] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 Back     alignment and domain information
>COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1838 consensus Alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>KOG2931 consensus Differentiation-related gene 1 protein (NDR1 protein), related proteins [Function unknown] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4667 consensus Predicted esterase [Lipid transport and metabolism] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG2565 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>PF02273 Acyl_transf_2: Acyl transferase; InterPro: IPR003157 LuxD proteins are bacterial acyl transferases Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional Back     alignment and domain information
>KOG3043 consensus Predicted hydrolase related to dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>KOG3975 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG1515 consensus Arylacetamide deacetylase [Defense mechanisms] Back     alignment and domain information
>KOG2551 consensus Phospholipase/carboxyhydrolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>KOG4627 consensus Kynurenine formamidase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>KOG2100 consensus Dipeptidyl aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>KOG2112 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information
>PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG2281 consensus Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>KOG3253 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG1553 consensus Predicted alpha/beta hydrolase BAT5 [General function prediction only] Back     alignment and domain information
>KOG3847 consensus Phospholipase A2 (platelet-activating factor acetylhydrolase in humans) [Lipid transport and metabolism] Back     alignment and domain information
>COG3150 Predicted esterase [General function prediction only] Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF05705 DUF829: Eukaryotic protein of unknown function (DUF829); InterPro: IPR008547 This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PF04301 DUF452: Protein of unknown function (DUF452); InterPro: IPR007398 This is a family of uncharacterised proteins Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF10142 PhoPQ_related: PhoPQ-activated pathogenicity-related protein; InterPro: IPR009199 Proteins in this entry are believed to play a role in virulence/pathogenicity in Salmonella Back     alignment and domain information
>COG2936 Predicted acyl esterases [General function prediction only] Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1551 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12048 DUF3530: Protein of unknown function (DUF3530); InterPro: IPR022529 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG4840 consensus Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG1073 Hydrolases of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information
>COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>COG1770 PtrB Protease II [Amino acid transport and metabolism] Back     alignment and domain information
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>COG4553 DepA Poly-beta-hydroxyalkanoate depolymerase [Lipid metabolism] Back     alignment and domain information
>KOG2237 consensus Predicted serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3101 consensus Esterase D [General function prediction only] Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information
>KOG2183 consensus Prolylcarboxypeptidase (angiotensinase C) [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF04083 Abhydro_lipase: Partial alpha/beta-hydrolase lipase region; InterPro: IPR006693 The alpha/beta hydrolase fold is common to several hydrolytic enzymes of widely differing phylogenetic origin and catalytic function Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3967 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>KOG2182 consensus Hydrolytic enzymes of the alpha/beta hydrolase fold [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>COG2830 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>PF06441 EHN: Epoxide hydrolase N terminus; InterPro: IPR010497 This entry represents the N-terminal region of the eukaryotic epoxide hydrolase protein Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>KOG2521 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 Back     alignment and domain information
>KOG1516 consensus Carboxylesterase and related proteins [General function prediction only] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>COG4287 PqaA PhoPQ-activated pathogenicity-related protein [General function prediction only] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PF06850 PHB_depo_C: PHB de-polymerase C-terminus; InterPro: IPR009656 This entry represents the C terminus of bacterial poly(3-hydroxybutyrate) (PHB) de-polymerase Back     alignment and domain information
>COG4947 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>KOG4569 consensus Predicted lipase [Lipid transport and metabolism] Back     alignment and domain information
>KOG4388 consensus Hormone-sensitive lipase HSL [Lipid transport and metabolism] Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] Back     alignment and domain information
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism] Back     alignment and domain information
>PF09949 DUF2183: Uncharacterized conserved protein (DUF2183); InterPro: IPR019236 This domain, found in various bacterial and fungal proteins, has no known function Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>KOG2385 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2029 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF03283 PAE: Pectinacetylesterase Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information
>PF09994 DUF2235: Uncharacterized alpha/beta hydrolase domain (DUF2235); InterPro: IPR018712 This domain has no known function Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>smart00827 PKS_AT Acyl transferase domain in polyketide synthase (PKS) enzymes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
2d0d_A282 Crystal Structure Of A Meta-Cleavage Product Hydrol 9e-08
1iun_A282 Meta-Cleavage Product Hydrolase From Pseudomonas Fl 6e-07
2xt0_A297 Dehalogenase Dppa From Plesiocystis Pacifica Sir-I 2e-06
3ans_A336 Human Soluble Epoxide Hydrolase In Complex With A S 5e-05
3pdc_A344 Crystal Structure Of Hydrolase Domain Of Human Solu 5e-05
1s8o_A555 Human Soluble Epoxide Hydrolase Length = 555 7e-05
4g5x_A279 Crystal Structures Of N-acyl Homoserine Lactonase A 1e-04
4g8c_A279 Crystal Structures Of N-acyl Homoserine Lactonase A 2e-04
3w06_A272 Crystal Structure Of Arabidopsis Thaliana Dwarf14 L 3e-04
4hrx_A288 Crystal Structure Of Kai2 Length = 288 3e-04
4ih1_A270 Crystal Structure Of Karrikin Insensitive 2 (kai2) 3e-04
4g8b_A279 Crystal Structures Of N-acyl Homoserine Lactonase A 4e-04
4iha_A268 Crystal Structure Of Rice Dwarf14 (d14) In Complex 5e-04
3w04_A266 Crystal Structure Of Oryza Sativa Dwarf14 (d14) Len 5e-04
3b12_A304 Crystal Structure Of The Fluoroacetate Dehalogenase 6e-04
4dnp_A269 Crystal Structure Of Dad2 Length = 269 7e-04
1y37_A304 Structure Of Fluoroacetate Dehalogenase From Burkho 8e-04
>pdb|2D0D|A Chain A, Crystal Structure Of A Meta-Cleavage Product Hydrolase (Cumd) A129v Mutant Length = 282 Back     alignment and structure

Iteration: 1

Score = 54.3 bits (129), Expect = 9e-08, Method: Compositional matrix adjust. Identities = 63/248 (25%), Positives = 109/248 (43%), Gaps = 23/248 (9%) Query: 48 VVLLHPFG--FDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDR---TASFQAECM 102 V+L+H G W+ + AL+K Y V PD + FG TDRP+ + + + Sbjct: 28 VILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFG--FTDRPENYNYSKDSWVDHI 85 Query: 103 AKGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSV---MGLTESVSNAALE 159 + L +EK +VG S+GG + A Y + V+ MV+ +V +TE ++ Sbjct: 86 IGIMDALEIEKAHIVGNSFGGGLAIATALRYSERVDRMVLMGAVGTRFDVTEGLNAVWGY 145 Query: 160 RIGYESWVDFLLPKTADALKVQFDIA--CYKLPTLPAFVYKHILEALSDHRKE-RIELLQ 216 E+ + L D V ++A Y+ P F E+ S E R + Sbjct: 146 TPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGF-----QESFSSMFPEPRQRWID 200 Query: 217 ALVISDKEF-SIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNL 275 AL SD++ ++P+ + IH G D++ + + L E + + A + + GH + Sbjct: 201 ALASSDEDIKTLPNETLIIH---GREDQVVPLSSSLRLGELIDR-AQLHVFGRCGHWTQI 256 Query: 276 ERPFVYNR 283 E+ +NR Sbjct: 257 EQTDRFNR 264
>pdb|1IUN|A Chain A, Meta-Cleavage Product Hydrolase From Pseudomonas Fluorescens Ip01 (Cumd) S103a Mutant Hexagonal Length = 282 Back     alignment and structure
>pdb|2XT0|A Chain A, Dehalogenase Dppa From Plesiocystis Pacifica Sir-I Length = 297 Back     alignment and structure
>pdb|3ANS|A Chain A, Human Soluble Epoxide Hydrolase In Complex With A Synthetic Inhibitor Length = 336 Back     alignment and structure
>pdb|3PDC|A Chain A, Crystal Structure Of Hydrolase Domain Of Human Soluble Epoxide Hydrolase Complexed With A Benzoxazole Inhibitor Length = 344 Back     alignment and structure
>pdb|1S8O|A Chain A, Human Soluble Epoxide Hydrolase Length = 555 Back     alignment and structure
>pdb|4G5X|A Chain A, Crystal Structures Of N-acyl Homoserine Lactonase Aidh Length = 279 Back     alignment and structure
>pdb|4G8C|A Chain A, Crystal Structures Of N-acyl Homoserine Lactonase Aidh E219g Mutant Complexed With N-hexanoyl Homoserine Length = 279 Back     alignment and structure
>pdb|3W06|A Chain A, Crystal Structure Of Arabidopsis Thaliana Dwarf14 Like (atd14l) Length = 272 Back     alignment and structure
>pdb|4HRX|A Chain A, Crystal Structure Of Kai2 Length = 288 Back     alignment and structure
>pdb|4IH1|A Chain A, Crystal Structure Of Karrikin Insensitive 2 (kai2) From Arabidopsis Thaliana Length = 270 Back     alignment and structure
>pdb|4G8B|A Chain A, Crystal Structures Of N-acyl Homoserine Lactonase Aidh S102g Mutant Complexed With N-hexanoyl Homoserine Lactone Length = 279 Back     alignment and structure
>pdb|4IHA|A Chain A, Crystal Structure Of Rice Dwarf14 (d14) In Complex With A Gr24 Hydrolysis Intermediate Length = 268 Back     alignment and structure
>pdb|3W04|A Chain A, Crystal Structure Of Oryza Sativa Dwarf14 (d14) Length = 266 Back     alignment and structure
>pdb|3B12|A Chain A, Crystal Structure Of The Fluoroacetate Dehalogenase D104 Mutant From Burkholderia Sp. Fa1 In Complex With Fluoroacetate Length = 304 Back     alignment and structure
>pdb|4DNP|A Chain A, Crystal Structure Of Dad2 Length = 269 Back     alignment and structure
>pdb|1Y37|A Chain A, Structure Of Fluoroacetate Dehalogenase From Burkholderia Sp. Fa1 Length = 304 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query300
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 3e-36
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 5e-36
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 7e-36
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 2e-35
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 2e-35
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 8e-35
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 2e-34
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 5e-34
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 6e-33
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 2e-32
1iup_A282 META-cleavage product hydrolase; aromatic compound 3e-32
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 1e-30
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 2e-30
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 4e-30
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 1e-29
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 2e-29
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 2e-29
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 2e-29
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 2e-29
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 1e-28
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 4e-27
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 3e-24
1r3d_A264 Conserved hypothetical protein VC1974; structural 2e-22
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 5e-22
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 5e-22
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 6e-22
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 7e-22
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 3e-21
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 5e-21
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 2e-20
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 3e-20
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 4e-20
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 6e-20
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 1e-19
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 5e-19
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 5e-19
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 6e-19
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 7e-19
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 9e-19
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 1e-18
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 1e-18
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 7e-04
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 2e-18
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 2e-18
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 6e-18
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 6e-18
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 1e-17
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 3e-17
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 5e-17
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 3e-16
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 5e-16
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 5e-16
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 1e-15
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 1e-15
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 3e-15
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 6e-15
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 1e-14
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 2e-14
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 3e-14
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 2e-13
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 4e-13
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 5e-13
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 1e-12
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 4e-12
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 4e-12
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 2e-11
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-10
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 6e-10
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 7e-10
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 4e-09
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 1e-08
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 4e-08
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 6e-08
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 8e-07
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 2e-06
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 5e-06
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 5e-06
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 7e-06
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 9e-06
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 1e-05
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 1e-05
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 6e-05
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 6e-05
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 2e-04
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Length = 272 Back     alignment and structure
 Score =  130 bits (328), Expect = 3e-36
 Identities = 39/251 (15%), Positives = 77/251 (30%), Gaps = 8/251 (3%)

Query: 46  HAVVLLHPFGFDGILTWQFQVLALAKT--YEVYVPDFLFFGSSVTDRPDRTASFQAECMA 103
             ++ LH    D   +       L+    Y+    D    G+S    P  + +     + 
Sbjct: 22  TPIIFLHGLSLDK-QSTCLFFEPLSNVGQYQRIYLDLPGMGNSDPISPSTSDNVLETLIE 80

Query: 104 KGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGY 163
                +G  +  L G SYGG +   +A    D    + +TC V+    S       +   
Sbjct: 81  AIEEIIGARRFILYGHSYGGYLAQAIAFHLKDQTLGVFLTCPVITADHSKR--LTGKHIN 138

Query: 164 ESWVDFLLPKTADALKVQFDIACYKLPTLPAFVYKHILEALSDHRKERIELLQALVISD- 222
               D    +  +       +               I+  L    K  I+ LQ       
Sbjct: 139 ILEEDINPVENKEYFADFLSMNVIINNQAWHDYQNLIIPGLQKEDKTFIDQLQNNYSFTF 198

Query: 223 -KEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAGHLVNLERPFVY 281
            ++    ++     ++ G ND++   Q    L     +N  +  + + GH + +++    
Sbjct: 199 EEKLKNINYQFPFKIMVGRNDQVVGYQEQLKLINHN-ENGEIVLLNRTGHNLMIDQREAV 257

Query: 282 NRQLKTILASL 292
                  L  L
Sbjct: 258 GFHFDLFLDEL 268


>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Length = 285 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Length = 291 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Length = 269 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Length = 289 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Length = 268 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Length = 286 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Length = 306 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Length = 296 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Length = 258 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Length = 282 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Length = 276 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} Length = 266 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Length = 314 Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Length = 271 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Length = 278 Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Length = 266 Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Length = 315 Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Length = 254 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Length = 282 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Length = 245 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Length = 286 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Length = 264 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Length = 292 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Length = 273 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} PDB: 1va4_A 3hi4_A 3hea_A Length = 271 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Length = 293 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Length = 285 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} Length = 281 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Length = 255 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 1cqw_A 2v9z_A Length = 299 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Length = 264 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Length = 277 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Length = 274 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Length = 456 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Length = 275 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Length = 286 Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Length = 316 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Length = 276 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Length = 298 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Length = 207 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Length = 207 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Length = 330 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Length = 279 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Length = 309 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Length = 210 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Length = 306 Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Length = 294 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Length = 291 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Length = 304 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Length = 301 Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Length = 262 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Length = 318 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Length = 286 Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Length = 297 Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Length = 330 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Length = 555 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Length = 310 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Length = 398 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Length = 297 Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Length = 293 Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Length = 302 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Length = 356 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Length = 247 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Length = 316 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Length = 328 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Length = 320 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Length = 305 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Length = 264 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} Length = 270 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Length = 267 Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Length = 251 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Length = 273 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Length = 257 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Length = 422 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} Length = 258 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Length = 251 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Length = 270 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Length = 446 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Length = 131 Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Length = 415 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 100.0
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 100.0
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 100.0
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 100.0
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 100.0
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 100.0
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 100.0
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 100.0
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 100.0
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 100.0
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 100.0
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 100.0
1iup_A282 META-cleavage product hydrolase; aromatic compound 100.0
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 100.0
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 100.0
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 100.0
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 100.0
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 100.0
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 100.0
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 100.0
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 100.0
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 100.0
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 100.0
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 100.0
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 100.0
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 100.0
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 100.0
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 100.0
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 100.0
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 100.0
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 100.0
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 100.0
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 100.0
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 100.0
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 100.0
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 100.0
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 100.0
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 100.0
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 100.0
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 100.0
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 100.0
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 100.0
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 100.0
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 100.0
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 100.0
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 100.0
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 100.0
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 100.0
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 100.0
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 100.0
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 100.0
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 100.0
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 100.0
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 100.0
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 100.0
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 100.0
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 100.0
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 100.0
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 100.0
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 100.0
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 100.0
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 100.0
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 100.0
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 100.0
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 100.0
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 100.0
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 100.0
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 100.0
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 100.0
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 100.0
1r3d_A264 Conserved hypothetical protein VC1974; structural 100.0
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 100.0
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 100.0
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 100.0
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 100.0
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 100.0
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 100.0
3llc_A270 Putative hydrolase; structural genomics, joint cen 100.0
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 100.0
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 100.0
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 100.0
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 100.0
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 100.0
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 100.0
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 100.0
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 100.0
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 100.0
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 100.0
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 100.0
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 100.0
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 100.0
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 99.98
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 99.98
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 99.97
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 99.97
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 99.97
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 99.97
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.97
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 99.97
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 99.97
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 99.97
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 99.97
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 99.97
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 99.97
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 99.97
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 99.97
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 99.97
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 99.97
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 99.97
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 99.97
3h04_A275 Uncharacterized protein; protein with unknown func 99.96
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 99.96
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 99.96
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 99.96
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 99.96
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 99.96
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 99.96
1kez_A300 Erythronolide synthase; polyketide synthase, modul 99.96
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 99.96
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 99.96
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 99.95
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 99.95
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 99.95
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 99.95
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 99.95
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 99.95
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 99.95
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 99.95
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 99.95
4fle_A202 Esterase; structural genomics, PSI-biology, northe 99.95
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 99.95
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 99.95
3bjr_A283 Putative carboxylesterase; structural genomics, jo 99.94
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 99.94
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.94
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 99.94
1vkh_A273 Putative serine hydrolase; structural genomics, jo 99.94
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 99.94
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 99.94
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 99.94
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 99.94
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 99.94
3ain_A323 303AA long hypothetical esterase; carboxylesterase 99.94
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 99.93
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.93
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 99.93
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 99.93
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.93
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 99.93
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 99.93
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 99.93
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 99.92
3tej_A329 Enterobactin synthase component F; nonribosomal pe 99.92
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 99.92
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.92
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 99.92
3lp5_A250 Putative cell surface hydrolase; structural genom 99.92
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 99.92
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 99.92
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 99.92
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 99.92
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 99.91
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 99.91
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 99.91
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 99.91
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 99.91
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 99.91
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 99.9
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 99.9
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.9
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 99.9
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 99.89
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.89
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.89
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.89
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.89
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.89
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.89
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 99.88
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 99.88
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 99.88
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 99.87
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 99.87
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 99.87
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 99.87
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 99.87
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 99.87
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 99.86
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 99.86
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 99.86
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 99.86
1lns_A 763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 99.85
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 99.85
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 99.85
3d59_A383 Platelet-activating factor acetylhydrolase; secret 99.84
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 99.84
4f21_A246 Carboxylesterase/phospholipase family protein; str 99.84
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 99.82
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 99.81
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 99.8
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.8
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 99.79
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.78
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 99.78
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 99.78
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 99.78
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 99.76
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 99.76
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 99.75
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.75
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 99.75
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 99.74
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 99.73
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 99.73
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 99.72
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 99.72
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 99.72
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 99.7
3nuz_A398 Putative acetyl xylan esterase; structural genomic 99.7
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 99.69
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 99.64
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 99.62
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 99.6
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 99.58
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 99.53
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 99.51
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 99.21
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 99.16
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 99.13
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 99.13
1ac5_A 483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 99.07
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 99.04
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.03
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.0
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 98.95
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 98.91
1ivy_A 452 Human protective protein; carboxypeptidase, serine 98.89
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 98.74
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 98.73
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 98.67
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 98.61
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 98.61
4g4g_A433 4-O-methyl-glucuronoyl methylesterase; alpha/beta 98.59
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 98.58
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 98.56
4ebb_A 472 Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 98.55
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 98.49
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 98.49
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 98.43
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 98.41
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 98.31
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 98.3
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 98.29
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 98.05
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 97.99
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 97.95
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 97.89
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 97.75
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 97.61
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 97.56
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 97.21
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 97.18
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 97.1
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 97.07
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 96.92
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 96.91
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 96.91
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 96.88
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 96.71
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 96.7
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 96.65
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 96.6
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 96.55
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 96.54
1ivy_A452 Human protective protein; carboxypeptidase, serine 95.63
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 94.5
2yij_A419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 92.94
3pa8_A254 Toxin B; CLAN CD cysteine protease, protease, toxi 81.9
3im8_A307 Malonyl acyl carrier protein transacylase; fatty a 81.86
3ptw_A336 Malonyl COA-acyl carrier protein transacylase; str 80.99
2qc3_A303 MCT, malonyl COA-acyl carrier protein transacylase 80.58
2cuy_A305 Malonyl COA-[acyl carrier protein] transacylase; t 80.02
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
Probab=100.00  E-value=1.6e-43  Score=271.27  Aligned_cols=257  Identities=18%  Similarity=0.187  Sum_probs=188.1

Q ss_pred             ceeecCCCeEEEEEccCCCCCCceEEEEcCCCCCchhhHHHHHHhhhcCceEEeecCCCCCCCCCCCCCCChHHHHHHHH
Q 022253           24 RTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMA  103 (300)
Q Consensus        24 ~~i~~~~g~~l~~~~~~~~~~~~~vv~lhG~~~~~~~~~~~~~~~l~~~~~v~~~d~~G~G~s~~~~~~~~~~~~~~~~~  103 (300)
                      .++...||.+++|...|. +++|+|||+||++++.. .|..+++.|+++|+|+++|+||||.|+.+...++++.+++|+.
T Consensus         7 ~~~~~~~g~~l~y~~~G~-~~~p~lvl~hG~~~~~~-~w~~~~~~L~~~~~vi~~D~rG~G~S~~~~~~~~~~~~a~dl~   84 (266)
T 3om8_A            7 SFLATSDGASLAYRLDGA-AEKPLLALSNSIGTTLH-MWDAQLPALTRHFRVLRYDARGHGASSVPPGPYTLARLGEDVL   84 (266)
T ss_dssp             EEEECTTSCEEEEEEESC-TTSCEEEEECCTTCCGG-GGGGGHHHHHTTCEEEEECCTTSTTSCCCCSCCCHHHHHHHHH
T ss_pred             eEEeccCCcEEEEEecCC-CCCCEEEEeCCCccCHH-HHHHHHHHhhcCcEEEEEcCCCCCCCCCCCCCCCHHHHHHHHH
Confidence            345556999999998875 45789999999999999 9999999999889999999999999998877899999999999


Q ss_pred             HHHHHhCCcceEEEEEehhHHHHHHHHHhCcccccceEEEcccCCCCccchhhhhhccchhhhhhccCcccHHHHHHHHH
Q 022253          104 KGLRKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADALKVQFD  183 (300)
Q Consensus       104 ~~i~~~~~~~~~lvG~S~Gg~~a~~~a~~~p~~v~~~vl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  183 (300)
                      ++++.++.++++++||||||.+|+.+|.++|++|+++|++++..........  ....  ......  ............
T Consensus        85 ~~l~~l~~~~~~lvGhS~Gg~va~~~A~~~P~rv~~lvl~~~~~~~~~~~~~--~~~~--~~~~~~--~~~~~~~~~~~~  158 (266)
T 3om8_A           85 ELLDALEVRRAHFLGLSLGGIVGQWLALHAPQRIERLVLANTSAWLGPAAQW--DERI--AAVLQA--EDMSETAAGFLG  158 (266)
T ss_dssp             HHHHHTTCSCEEEEEETHHHHHHHHHHHHCGGGEEEEEEESCCSBCCCSHHH--HHHH--HHHHHC--SSSHHHHHHHHH
T ss_pred             HHHHHhCCCceEEEEEChHHHHHHHHHHhChHhhheeeEecCcccCCchhHH--HHHH--HHHHcc--ccHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999987543321110  0000  000000  000001111111


Q ss_pred             HhhccC-CCChHHHHHHHHHHHh-cchhhHHHHHHHhhhcccCCCCCCCcceEEEEeeCCCcccCHHHHHHHHHHhCCCc
Q 022253          184 IACYKL-PTLPAFVYKHILEALS-DHRKERIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNA  261 (300)
Q Consensus       184 ~~~~~~-~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~i~~P~l~i~g~~D~~~~~~~~~~~~~~~~~~~  261 (300)
                      ...... ........+.+..... ............+...+....+.++++|+|+|+|++|.++|++..+.+.+.++ ++
T Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~l~~i~~P~Lvi~G~~D~~~~~~~~~~l~~~ip-~a  237 (266)
T 3om8_A          159 NWFPPALLERAEPVVERFRAMLMATNRHGLAGSFAAVRDTDLRAQLARIERPTLVIAGAYDTVTAASHGELIAASIA-GA  237 (266)
T ss_dssp             HHSCHHHHHSCCHHHHHHHHHHHTSCHHHHHHHHHHHHTCBCTTTGGGCCSCEEEEEETTCSSSCHHHHHHHHHHST-TC
T ss_pred             HhcChhhhhcChHHHHHHHHHHHhCCHHHHHHHHHHhhccchhhHhcCCCCCEEEEEeCCCCCCCHHHHHHHHHhCC-CC
Confidence            100000 0000111222222211 12222223333444455567788999999999999999999999999999998 99


Q ss_pred             eEEEEcCCCCcccccChHHHHHHHHHHHh
Q 022253          262 TMESIEKAGHLVNLERPFVYNRQLKTILA  290 (300)
Q Consensus       262 ~~~~~~~~gH~~~~~~~~~~~~~i~~fl~  290 (300)
                      ++++++ +||++++|+|+++++.|.+||+
T Consensus       238 ~~~~i~-~gH~~~~e~p~~~~~~i~~Fl~  265 (266)
T 3om8_A          238 RLVTLP-AVHLSNVEFPQAFEGAVLSFLG  265 (266)
T ss_dssp             EEEEES-CCSCHHHHCHHHHHHHHHHHHT
T ss_pred             EEEEeC-CCCCccccCHHHHHHHHHHHhc
Confidence            999998 8999999999999999999995



>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>4g4g_A 4-O-methyl-glucuronoyl methylesterase; alpha/beta hydrolase, 3-layer alpha/beta/alpha sandwich, ROS fold, glucuronoyl esterase; 1.55A {Myceliophthora thermophila} PDB: 4g4i_A 4g4j_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3pa8_A Toxin B; CLAN CD cysteine protease, protease, toxin-peptide in complex; HET: 621 IHP; 2.00A {Clostridium difficile} PDB: 3pee_B* Back     alignment and structure
>3im8_A Malonyl acyl carrier protein transacylase; fatty acid synthesis, malonyl-COA, acyl carrier protein TRAN (MCAT), FABD, acyltransferase; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>3ptw_A Malonyl COA-acyl carrier protein transacylase; structural genomics, protein structure initiative; 2.10A {Clostridium perfringens} Back     alignment and structure
>2qc3_A MCT, malonyl COA-acyl carrier protein transacylase; malonyl-COA:ACP transacylase, , nucleophili fatty acids biosynthesis; 2.30A {Mycobacterium tuberculosis} PDB: 2qj3_A Back     alignment and structure
>2cuy_A Malonyl COA-[acyl carrier protein] transacylase; transferase, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 300
d1bn7a_291 c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus 8e-17
d1m33a_256 c.69.1.26 (A:) Biotin biosynthesis protein BioH {E 3e-16
d1uk8a_271 c.69.1.10 (A:) Meta-cleavage product hydrolase Cum 6e-16
d1j1ia_268 c.69.1.10 (A:) Meta cleavage compound hydrolase Ca 8e-16
d1pjaa_268 c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H 4e-15
d1a8sa_273 c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas flu 1e-14
d3c70a1256 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber t 5e-14
d1r3da_264 c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio 7e-14
d1cvla_319 c.69.1.18 (A:) Lipase {Chromobacterium viscosum [T 1e-13
d1zd3a2322 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, 3e-13
d1ex9a_285 c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [Tax 4e-13
d1a8qa_274 c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces au 2e-12
d1brta_277 c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces au 2e-12
d1xkla_258 c.69.1.20 (A:) Salicylic acid-binding protein 2 (S 4e-12
d1hkha_279 c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. 4e-12
d2rhwa1283 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2 5e-12
d1a88a_275 c.69.1.12 (A:) Chloroperoxidase L {Streptomyces li 5e-12
d1ehya_293 c.69.1.11 (A:) Bacterial epoxide hydrolase {Agroba 8e-12
d1c4xa_281 c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-di 8e-12
d1va4a_271 c.69.1.12 (A:) Arylesterase {Pseudomonas fluoresce 9e-12
d1mj5a_298 c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomona 3e-11
d1azwa_313 c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas 4e-11
d1q0ra_297 c.69.1.28 (A:) Aclacinomycin methylesterase RdmC { 8e-11
d1k8qa_377 c.69.1.6 (A:) Gastric lipase {Dog (Canis familiari 2e-10
d1thta_302 c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase 4e-10
d1wm1a_313 c.69.1.7 (A:) Proline aminopeptidase {Serratia mar 5e-10
d1mtza_290 c.69.1.7 (A:) Tricorn interacting factor F1 {Archa 6e-10
d1qlwa_318 c.69.1.15 (A:) A novel bacterial esterase {Alcalig 8e-10
d1tcaa_317 c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Cand 2e-08
d2dsta1122 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 3e-08
d1tqha_242 c.69.1.29 (A:) Carboxylesterase Est {Bacillus stea 4e-08
d1b6ga_310 c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacte 4e-08
d1qo7a_394 c.69.1.11 (A:) Bacterial epoxide hydrolase {Asperg 1e-06
d1imja_208 c.69.1.23 (A:) Ccg1/TafII250-interacting factor B 4e-05
d1ispa_179 c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 6e-04
d1mo2a_255 c.69.1.22 (A:) Erythromycin polyketide synthase {S 7e-04
d1ju3a2347 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-t 9e-04
d1vlqa_322 c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Therm 0.003
d2jbwa1360 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine h 0.004
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Length = 291 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Haloalkane dehalogenase
domain: Haloalkane dehalogenase
species: Rhodococcus sp. [TaxId: 1831]
 Score = 76.8 bits (187), Expect = 8e-17
 Identities = 38/262 (14%), Positives = 81/262 (30%), Gaps = 18/262 (6%)

Query: 47  AVVLLHPFGFDGILTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQAECMAKGL 106
            V+ LH         W+  +  +A ++    PD +  G S     D         +   +
Sbjct: 31  PVLFLHGNPTSS-YLWRNIIPHVAPSHRCIAPDLIGMGKSDKPDLDYFFDDHVRYLDAFI 89

Query: 107 RKLGVEKCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESW 166
             LG+E+  LV   +G  +GF  A+  P+ V+ +     +  +          R  ++++
Sbjct: 90  EALGLEEVVLVIHDWGSALGFHWAKRNPERVKGIACMEFIRPIPTWDEWPEFARETFQAF 149

Query: 167 VDFLLPKTADALKVQF----------------DIACYKLPTLPAFVYKHILEALSDHRKE 210
               + +     +  F                ++  Y+ P L     + +    ++    
Sbjct: 150 RTADVGRELIIDQNAFIEGVLPKCVVRPLTEVEMDHYREPFLKPVDREPLWRFPNEIPIA 209

Query: 211 RIELLQALVISDKEFSIPHFSQKIHLLWGENDKIFDMQVARNLKEQVGQNATMESIEKAG 270
                   ++      +        L WG    +     A  L E +  N     I    
Sbjct: 210 GEPANIVALVEAYMNWLHQSPVPKLLFWGTPGVLIPPAEAARLAESL-PNCKTVDIGPGL 268

Query: 271 HLVNLERPFVYNRQLKTILASL 292
           H +  + P +   ++   L  L
Sbjct: 269 HYLQEDNPDLIGSEIARWLPGL 290


>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Length = 256 Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Length = 268 Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Length = 273 Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 256 Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Length = 264 Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Length = 319 Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Length = 285 Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Length = 274 Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Length = 277 Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 258 Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Length = 279 Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Length = 283 Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Length = 275 Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Length = 293 Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Length = 281 Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Length = 271 Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Length = 298 Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Length = 313 Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Length = 297 Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Length = 377 Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Length = 302 Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Length = 313 Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 290 Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Length = 318 Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Length = 317 Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Length = 122 Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Length = 242 Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Length = 310 Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Length = 394 Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Length = 255 Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Length = 347 Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Length = 322 Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Length = 360 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query300
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 100.0
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 100.0
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 100.0
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 100.0
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 100.0
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 100.0
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 100.0
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 100.0
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 100.0
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 100.0
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 100.0
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 100.0
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 100.0
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 100.0
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 100.0
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 100.0
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 100.0
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 100.0
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 100.0
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 100.0
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 100.0
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 100.0
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 100.0
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 100.0
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 100.0
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 100.0
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 100.0
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 99.98
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.97
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 99.97
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 99.96
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 99.95
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 99.94
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 99.94
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 99.94
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 99.94
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 99.94
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 99.94
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 99.94
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 99.93
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 99.92
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 99.91
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 99.9
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 99.9
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 99.89
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 99.89
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 99.88
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 99.88
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 99.88
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 99.87
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 99.87
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 99.87
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 99.87
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 99.85
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 99.84
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 99.79
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.79
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.78
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 99.78
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 99.77
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 99.75
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 99.72
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.68
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.67
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.65
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 99.64
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.64
d1lnsa3405 X-Prolyl dipeptidyl aminopeptidase PepX, middle do 99.64
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 99.61
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 99.5
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 99.45
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 99.44
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 99.37
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 99.34
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 99.32
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 99.27
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 99.27
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 99.24
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 99.19
d1ivya_ 452 Human 'protective protein', HPP {Human (Homo sapie 99.19
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 99.18
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 99.14
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 99.13
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 99.07
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 99.0
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 98.91
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 98.78
d1ac5a_ 483 Serine carboxypeptidase II {Baker's yeast (Sacchar 98.74
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 97.98
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 97.94
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 97.89
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 97.88
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 97.87
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 97.76
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 97.69
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 97.63
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 97.45
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 97.32
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 96.91
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 96.83
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 96.8
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 96.78
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 96.73
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 95.78
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 95.64
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 95.26
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Carbon-carbon bond hydrolase
domain: Meta cleavage compound hydrolase CarC
species: Janthinobacterium sp. J3 [TaxId: 213804]
Probab=100.00  E-value=2.1e-41  Score=258.27  Aligned_cols=257  Identities=18%  Similarity=0.219  Sum_probs=183.1

Q ss_pred             cccceeecCCCeEEEEEccCCCCCCceEEEEcCCCCCch--hhHHHHHHhhhcCceEEeecCCCCCCCCCCCCCCChHHH
Q 022253           21 MTQRTIEIEPGTILNIWVPKKTTKKHAVVLLHPFGFDGI--LTWQFQVLALAKTYEVYVPDFLFFGSSVTDRPDRTASFQ   98 (300)
Q Consensus        21 ~~~~~i~~~~g~~l~~~~~~~~~~~~~vv~lhG~~~~~~--~~~~~~~~~l~~~~~v~~~d~~G~G~s~~~~~~~~~~~~   98 (300)
                      ..++++++ ||.+++|...|.   +|+|||+||++++..  ..|..+++.|+++|+|+++|+||||.|+.+....+.+.+
T Consensus         2 ~~~~~~~~-dg~~l~y~~~G~---g~~vvllHG~~~~~~~~~~~~~~~~~l~~~~~v~~~D~~G~G~S~~~~~~~~~~~~   77 (268)
T d1j1ia_           2 YVERFVNA-GGVETRYLEAGK---GQPVILIHGGGAGAESEGNWRNVIPILARHYRVIAMDMLGFGKTAKPDIEYTQDRR   77 (268)
T ss_dssp             CEEEEEEE-TTEEEEEEEECC---SSEEEEECCCSTTCCHHHHHTTTHHHHTTTSEEEEECCTTSTTSCCCSSCCCHHHH
T ss_pred             CcCeEEEE-CCEEEEEEEEcC---CCeEEEECCCCCCccHHHHHHHHHHHHhcCCEEEEEcccccccccCCccccccccc
Confidence            35677888 899999998874   688999999987654  257778899988899999999999999988888999999


Q ss_pred             HHHHHHHHHHhCCc-ceEEEEEehhHHHHHHHHHhCcccccceEEEcccCCCCccchhhhhhccchhhhhhccCcccHHH
Q 022253           99 AECMAKGLRKLGVE-KCTLVGVSYGGMVGFKMAEMYPDLVESMVVTCSVMGLTESVSNAALERIGYESWVDFLLPKTADA  177 (300)
Q Consensus        99 ~~~~~~~i~~~~~~-~~~lvG~S~Gg~~a~~~a~~~p~~v~~~vl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  177 (300)
                      ++++.++++.++.+ +++++|||+||.+++.+|.++|++|+++|++++........... ..      ...  .......
T Consensus        78 ~~~~~~~i~~l~~~~~~~liG~S~Gg~ia~~~a~~~p~~v~~lil~~~~~~~~~~~~~~-~~------~~~--~~~~~~~  148 (268)
T d1j1ia_          78 IRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDL-RP------IIN--YDFTREG  148 (268)
T ss_dssp             HHHHHHHHHHSCCSSCEEEEEEHHHHHHHHHHHHHCGGGEEEEEEESCCBCCCC-------------------CCSCHHH
T ss_pred             cccchhhHHHhhhcccceeeeccccccccchhhccChHhhheeeecCCCccccccchhh-hh------hhh--hhhhhhh
Confidence            99999999999874 78999999999999999999999999999999875433221110 00      000  0011112


Q ss_pred             HHHHHHHhhccCCCChHHHHHHHHHHHhcc--hhhHHHHHHHh----hhcccCCCCCCCcceEEEEeeCCCcccCHHHHH
Q 022253          178 LKVQFDIACYKLPTLPAFVYKHILEALSDH--RKERIELLQAL----VISDKEFSIPHFSQKIHLLWGENDKIFDMQVAR  251 (300)
Q Consensus       178 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~----~~~~~~~~~~~i~~P~l~i~g~~D~~~~~~~~~  251 (300)
                      ..............................  ...........    ........+.++++|+++|+|++|.++|++..+
T Consensus       149 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~i~~P~l~i~G~~D~~~~~~~~~  228 (268)
T d1j1ia_         149 MVHLVKALTNDGFKIDDAMINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAY  228 (268)
T ss_dssp             HHHHHHHHSCTTCCCCHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHTSSBCCHHHHTTCCSCEEEEEETTCSSSCHHHHH
T ss_pred             hHHHHHHHhhhhhhhhhhhhHHHHHhhhhhhhhhhhhhhhhhhhccccccchhhhHhhCCCCEEEEEeCCCCCCCHHHHH
Confidence            222222222222222222222222211110  00111111111    111122346789999999999999999999999


Q ss_pred             HHHHHhCCCceEEEEcCCCCcccccChHHHHHHHHHHHhh
Q 022253          252 NLKEQVGQNATMESIEKAGHLVNLERPFVYNRQLKTILAS  291 (300)
Q Consensus       252 ~~~~~~~~~~~~~~~~~~gH~~~~~~~~~~~~~i~~fl~~  291 (300)
                      .+.+.++ ++++++++++||++++|+|+++++.|.+||.+
T Consensus       229 ~~~~~~~-~~~~~~~~~~gH~~~~e~p~~~~~~i~~FL~~  267 (268)
T d1j1ia_         229 KFLDLID-DSWGYIIPHCGHWAMIEHPEDFANATLSFLSL  267 (268)
T ss_dssp             HHHHHCT-TEEEEEESSCCSCHHHHSHHHHHHHHHHHHHH
T ss_pred             HHHHhCC-CCEEEEECCCCCchHHhCHHHHHHHHHHHHcC
Confidence            9999998 99999999999999999999999999999975



>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure