Citrus Sinensis ID: 022285


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MDTGKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAEVVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVDDDSDLIDEDTLLTEEDLKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGSVMWTWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRHLDMKFRADASEKRIRRIVSGVA
cccccccccEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEEEccccccccccHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHHHHHHHHccHHHHHHcccccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccHHHHccccccccccccccccccccccEEEcccccccccccccccHHHHHHHHHHHcccc
cccHHccccEEEEEccccccHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHccccccccEEEEEEcccccccHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHcccEEcccccccccccccccEEEEEEEccccccccccccccccccHHHHccccccccccHHHHccHHHcccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHcccccccccccccEEcccccccccccccccccccEEEEEccccccccccHHccccccHHHHHHHccccc
MDTGKMQSAVLAlsedkilpVSAVLNAIRDLGdeaveqcdpQIITQasslsqlpvesfsIDTVLsissshelpgdqLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIqlksvvpaevvsfgvkgkkptwkigssfaikKAPKSLAklqvdddsdlidedtllteedlkkpqlpsvgdcevgstrkackNCICGRAEAEEKVEKLGLTMDqlknpqsacgsvmwtwrcfplrymplqgsasiqtgregvtvkqlprsrhldmKFRADASEKRIRRIVSGVA
MDTGKMQSAVLalsedkilpVSAVLNAIRDLGDEAVEQCDPQIITQasslsqlpVESFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYkkltsdkgdVDKAISALEGKLLLAGFLDAQRIQLKSVVPaevvsfgvkgkkptwkigssfaikkapkslaklqvdddsDLIDEDTLlteedlkkpqlpsvgdcevgstrKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGSVMWTWRCFPLRYMPLQgsasiqtgregvtvkqlprsrhldmkfradasekrirRIVSGVA
MDTGKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAEVVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVdddsdlidedtllteedlKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGSVMWTWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRHLDMKFRADASEKRIRRIVSGVA
**********LALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSI********DQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAEVVSFGVKGKKPTWKIGSSFAIK**************************************DCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGSVMWTWRCFPLRYMPLQGS******************************************
*******SAVLALSEDKILPVSAVLNA**********QC*****************SFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQR*******PAEVVSFGVKGK********************KLQVDDDSDLIDEDTLLTEEDLK*************************************************CGSVMWTWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRHLDMKFRADASEKRIRRIVSG**
*********VLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAEVVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVDDDSDLIDEDTLLTEEDLKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGSVMWTWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRHLDMKFRADASEKRIRRIVSGVA
*DT*KMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAEVVSFGVKGKKPTWKIGSSFAIK****S**KLQVDDDSDLIDEDTLLTEEDLKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQ*KNPQSACGSVMWTWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRH*D*KFRADASEKR***IV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTGKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAEVVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVDDDSDLIDEDTLLTEEDLKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGSVMWTWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRHLDMKFRADASEKRIRRIVSGVA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query299 2.2.26 [Sep-21-2011]
D1I234272 Anamorsin homolog OS=Viti yes no 0.826 0.908 0.667 3e-85
A9PBH9277 Anamorsin homolog OS=Popu yes no 0.842 0.909 0.633 1e-81
B9RBT0274 Anamorsin homolog OS=Rici N/A no 0.836 0.912 0.612 3e-80
B7FNA9265 Anamorsin homolog OS=Medi N/A no 0.839 0.947 0.561 3e-71
C6TKZ5260 Anamorsin homolog OS=Glyc no no 0.792 0.911 0.579 3e-69
Q8L7Z3272 Anamorsin homolog OS=Arab yes no 0.876 0.963 0.496 9e-60
Q7XQ97265 Anamorsin homolog 1 OS=Or yes no 0.775 0.875 0.502 1e-52
A2XYW4265 Anamorsin homolog 1 OS=Or N/A no 0.742 0.837 0.514 2e-52
B8ARI7264 Anamorsin homolog 2 OS=Or N/A no 0.742 0.840 0.514 9e-52
Q7XPW7264 Anamorsin homolog 2 OS=Or yes no 0.682 0.772 0.532 2e-51
>sp|D1I234|DRE2_VITVI Anamorsin homolog OS=Vitis vinifera GN=VIT_01s0010g01180 PE=3 SV=1 Back     alignment and function desciption
 Score =  315 bits (807), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 169/253 (66%), Positives = 197/253 (77%), Gaps = 6/253 (2%)

Query: 6   MQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLS 65
           +Q++ LAL++ ++L +S VL+A+R L +  V+QCDP IITQASSLSQLPVES S+D V+S
Sbjct: 2   LQNSTLALTDHEVLSISTVLDAVRKLDNAGVDQCDPLIITQASSLSQLPVESSSLDIVIS 61

Query: 66  ISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQR 125
           I  S E P D+LL EISRVLKPGGT+LI K   S  G  D   S LE KLL+AGFL+AQ 
Sbjct: 62  ICRSLEFPCDKLLAEISRVLKPGGTVLIQKTSQSVAGIKDGETS-LERKLLMAGFLEAQA 120

Query: 126 IQLKSVVPAE-VVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVDDDSDLIDEDTLLTEE 184
           IQLK VVP+E   SFG+K KKP+WKIGSSF+IKKA KSL K Q++DD DLIDED+LLTEE
Sbjct: 121 IQLKPVVPSEGAQSFGIKAKKPSWKIGSSFSIKKAEKSLPKFQIEDDMDLIDEDSLLTEE 180

Query: 185 DLKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGSVMW-- 242
           DLKKPQLP  GDCEVGSTRKACKNC CGRAE EEKVEKLGLTMDQL NPQSACGS     
Sbjct: 181 DLKKPQLPVDGDCEVGSTRKACKNCTCGRAEEEEKVEKLGLTMDQLNNPQSACGSCGLGD 240

Query: 243 TWRC--FPLRYMP 253
            +RC   P + +P
Sbjct: 241 AFRCGTCPYKGLP 253




May be required for the maturation of extramitochondrial Fe/S proteins (By similarity). Has anti-apoptotic effects in the cell.
Vitis vinifera (taxid: 29760)
>sp|A9PBH9|DRE2_POPTR Anamorsin homolog OS=Populus trichocarpa GN=POPTRDRAFT_761104 PE=2 SV=1 Back     alignment and function description
>sp|B9RBT0|DRE2_RICCO Anamorsin homolog OS=Ricinus communis GN=RCOM_1680640 PE=3 SV=1 Back     alignment and function description
>sp|B7FNA9|DRE2_MEDTR Anamorsin homolog OS=Medicago truncatula PE=2 SV=1 Back     alignment and function description
>sp|C6TKZ5|DRE2_SOYBN Anamorsin homolog OS=Glycine max PE=2 SV=1 Back     alignment and function description
>sp|Q8L7Z3|DRE2_ARATH Anamorsin homolog OS=Arabidopsis thaliana GN=At5g18400 PE=1 SV=1 Back     alignment and function description
>sp|Q7XQ97|DRE21_ORYSJ Anamorsin homolog 1 OS=Oryza sativa subsp. japonica GN=Os04g0674400 PE=2 SV=2 Back     alignment and function description
>sp|A2XYW4|DRE21_ORYSI Anamorsin homolog 1 OS=Oryza sativa subsp. indica GN=H0403D02.15 PE=2 SV=1 Back     alignment and function description
>sp|B8ARI7|DRE22_ORYSI Anamorsin homolog 2 OS=Oryza sativa subsp. indica GN=OsI_17963 PE=2 SV=1 Back     alignment and function description
>sp|Q7XPW7|DRE22_ORYSJ Anamorsin homolog 2 OS=Oryza sativa subsp. japonica GN=Os04g0682050 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
225425061276 PREDICTED: anamorsin homolog [Vitis vini 0.842 0.913 0.666 4e-85
292630750272 RecName: Full=Anamorsin homolog; AltName 0.826 0.908 0.667 2e-83
292630769277 RecName: Full=Anamorsin homolog; AltName 0.842 0.909 0.633 6e-80
118483629277 unknown [Populus trichocarpa] 0.842 0.909 0.633 7e-80
255537095274 Anamorsin, putative [Ricinus communis] g 0.836 0.912 0.612 2e-78
224082520266 predicted protein [Populus trichocarpa] 0.806 0.906 0.616 6e-75
388497454274 unknown [Lotus japonicus] 0.836 0.912 0.593 4e-71
356543201267 PREDICTED: anamorsin homolog [Glycine ma 0.812 0.910 0.581 4e-71
147771846279 hypothetical protein VITISV_035762 [Viti 0.782 0.838 0.599 9e-71
357473847265 Anamorsin-like protein [Medicago truncat 0.839 0.947 0.561 2e-69
>gi|225425061|ref|XP_002271546.1| PREDICTED: anamorsin homolog [Vitis vinifera] Back     alignment and taxonomy information
 Score =  320 bits (821), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 172/258 (66%), Positives = 200/258 (77%), Gaps = 6/258 (2%)

Query: 1   MDTGKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSI 60
           MDT  +Q++ LAL++ ++L +S VL+A+R L +  V+QCDP IITQASSLSQLPVES S+
Sbjct: 1   MDTKMLQNSTLALTDHEVLSISTVLDAVRKLDNAGVDQCDPLIITQASSLSQLPVESSSL 60

Query: 61  DTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGF 120
           D V+SI  S E P D+LL EISRVLKPGGT+LI K   S  G  D   S LE KLL+AGF
Sbjct: 61  DIVISICRSLEFPCDKLLAEISRVLKPGGTVLIQKTSQSVAGIKDGETS-LERKLLMAGF 119

Query: 121 LDAQRIQLKSVVPAE-VVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVDDDSDLIDEDT 179
           L+AQ IQLK VVP+E   SFG+K KKP+WKIGSSF+IKKA KSL K Q++DD DLIDED+
Sbjct: 120 LEAQAIQLKPVVPSEGAQSFGIKAKKPSWKIGSSFSIKKAEKSLPKFQIEDDMDLIDEDS 179

Query: 180 LLTEEDLKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGS 239
           LLTEEDLKKPQLP  GDCEVGSTRKACKNC CGRAE EEKVEKLGLTMDQL NPQSACGS
Sbjct: 180 LLTEEDLKKPQLPVDGDCEVGSTRKACKNCTCGRAEEEEKVEKLGLTMDQLNNPQSACGS 239

Query: 240 VMW--TWRC--FPLRYMP 253
                 +RC   P + +P
Sbjct: 240 CGLGDAFRCGTCPYKGLP 257




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|292630750|sp|D1I234.1|DRE2_VITVI RecName: Full=Anamorsin homolog; AltName: Full=Fe-S cluster assembly protein DRE2 homolog gi|297738244|emb|CBI27445.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|292630769|sp|A9PBH9.1|DRE2_POPTR RecName: Full=Anamorsin homolog; AltName: Full=Fe-S cluster assembly protein DRE2 homolog gi|118483677|gb|ABK93732.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118483629|gb|ABK93709.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255537095|ref|XP_002509614.1| Anamorsin, putative [Ricinus communis] gi|292630771|sp|B9RBT0.1|DRE2_RICCO RecName: Full=Anamorsin homolog; AltName: Full=Fe-S cluster assembly protein DRE2 homolog gi|223549513|gb|EEF51001.1| Anamorsin, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224082520|ref|XP_002306726.1| predicted protein [Populus trichocarpa] gi|222856175|gb|EEE93722.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|388497454|gb|AFK36793.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356543201|ref|XP_003540051.1| PREDICTED: anamorsin homolog [Glycine max] Back     alignment and taxonomy information
>gi|147771846|emb|CAN71337.1| hypothetical protein VITISV_035762 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357473847|ref|XP_003607208.1| Anamorsin-like protein [Medicago truncatula] gi|292630728|sp|B7FNA9.1|DRE2_MEDTR RecName: Full=Anamorsin homolog; AltName: Full=Fe-S cluster assembly protein DRE2 homolog gi|217075765|gb|ACJ86242.1| unknown [Medicago truncatula] gi|355508263|gb|AES89405.1| Anamorsin-like protein [Medicago truncatula] gi|388492662|gb|AFK34397.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query299
TAIR|locus:2146178272 AT5G18400 [Arabidopsis thalian 0.882 0.970 0.437 9.9e-55
TAIR|locus:4515103586182 AT5G18362 "AT5G18362" [Arabido 0.374 0.615 0.458 2.1e-22
UNIPROTKB|Q6FI81312 CIAPIN1 "Anamorsin" [Homo sapi 0.515 0.493 0.268 2.8e-13
UNIPROTKB|Q5EAC7310 CIAPIN1 "Anamorsin" [Bos tauru 0.515 0.496 0.262 5.2e-13
UNIPROTKB|E2RTJ0315 CIAPIN1 "Uncharacterized prote 0.471 0.447 0.272 6.8e-12
MGI|MGI:1922083309 Ciapin1 "cytokine induced apop 0.521 0.504 0.259 1.5e-11
DICTYBASE|DDB_G0285251256 rsc43 "Protein DRE2" [Dictyost 0.642 0.75 0.301 2e-11
UNIPROTKB|I3L704313 CIAPIN1 "Uncharacterized prote 0.207 0.198 0.436 2.1e-11
UNIPROTKB|Q5ZJA2306 CIAPIN1 "Anamorsin" [Gallus ga 0.454 0.444 0.254 4.1e-10
UNIPROTKB|F1P0W1305 CIAPIN1 "Anamorsin" [Gallus ga 0.454 0.445 0.254 5.9e-10
TAIR|locus:2146178 AT5G18400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 565 (203.9 bits), Expect = 9.9e-55, P = 9.9e-55
 Identities = 119/272 (43%), Positives = 172/272 (63%)

Query:     1 MDTGKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSI 60
             MD+   Q  VLA+++D +LPVS+VL  +++LG E +E  DP IITQAS+++Q P+++ S+
Sbjct:     1 MDSMMNQKTVLAVTDDVVLPVSSVLAIMKELGKEVIESFDPLIITQASTINQFPLDASSV 60

Query:    61 DTVLSISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSDKGDVDKAISALEGKLLLAGF 120
             + VL+IS + + P D++  E SR+LKPGGT+ + K L  + G++ + I   + ++ LAGF
Sbjct:    61 EAVLAISKTSDFPSDKICGEFSRILKPGGTVSVCKVLEGETGEIQQTI---QRRVTLAGF 117

Query:   121 LDAQRIQLKSV-VPAEVVSFGVKGKKPTWKIGSSFAIKKAPKSLAKLQVXXXXXXXXXXX 179
             L+ Q + LKS+ +    +SFG+K KKP+WKIGSSFA+KK   +L K+ +           
Sbjct:   118 LEPQCLDLKSIKLSTFSLSFGIKAKKPSWKIGSSFALKKPVTNLFKIDLDDDVDLIDEDS 177

Query:   180 XXXXXXXKKPQLPSVGDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQSACGS 239
                     KPQLP    CE  +T+KACKNC+CGRAE EEK  KLGLT DQ++NPQS+CGS
Sbjct:   178 LLTEEDLMKPQLPVASGCE--TTKKACKNCVCGRAEIEEKAVKLGLTEDQIENPQSSCGS 235

Query:   240 VMWTWRCFPLRYMPLQGSASIQTGREGVTVKQ 271
                    F     P +G    + G E VT+ Q
Sbjct:   236 C-GLGDAFRCGTCPYKGLPPFKLG-EKVTLSQ 265




GO:0005737 "cytoplasm" evidence=ISM
GO:0008150 "biological_process" evidence=ND
GO:0005515 "protein binding" evidence=IPI
TAIR|locus:4515103586 AT5G18362 "AT5G18362" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q6FI81 CIAPIN1 "Anamorsin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EAC7 CIAPIN1 "Anamorsin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RTJ0 CIAPIN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1922083 Ciapin1 "cytokine induced apoptosis inhibitor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285251 rsc43 "Protein DRE2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|I3L704 CIAPIN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZJA2 CIAPIN1 "Anamorsin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0W1 CIAPIN1 "Anamorsin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7XPW7DRE22_ORYSJNo assigned EC number0.53240.68220.7727yesno
A9PBH9DRE2_POPTRNo assigned EC number0.63320.84280.9097yesno
Q8L7Z3DRE2_ARATHNo assigned EC number0.49630.87620.9632yesno
B9RBT0DRE2_RICCONo assigned EC number0.61240.83610.9124N/Ano
D1I234DRE2_VITVINo assigned EC number0.66790.82600.9080yesno
B7FNA9DRE2_MEDTRNo assigned EC number0.56170.83940.9471N/Ano
Q7XQ97DRE21_ORYSJNo assigned EC number0.50200.77590.8754yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00021214001
SubName- Full=Chromosome chr1 scaffold_22, whole genome shotgun sequence; (272 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
pfam0509397 pfam05093, CIAPIN1, Cytokine-induced anti-apoptosi 3e-12
pfam0824192 pfam08241, Methyltransf_11, Methyltransferase doma 3e-08
COG5636284 COG5636, COG5636, Uncharacterized conserved protei 3e-07
>gnl|CDD|218427 pfam05093, CIAPIN1, Cytokine-induced anti-apoptosis inhibitor 1, Fe-S biogenesis Back     alignment and domain information
 Score = 61.6 bits (150), Expect = 3e-12
 Identities = 25/69 (36%), Positives = 33/69 (47%), Gaps = 13/69 (18%)

Query: 184 EDLKKPQLPSV--GDCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQ-----------L 230
           EDLKKP   ++       G  RKACKNC CG AE EE+ +K      Q           +
Sbjct: 1   EDLKKPDPVTLRKCGPGPGKKRKACKNCTCGLAEEEEQEKKDKSAAQQQKVEDDLAEITV 60

Query: 231 KNPQSACGS 239
           +   S+CG+
Sbjct: 61  EGKTSSCGN 69


Anamorsin, subsequently named CIAPIN1 for cytokine-induced anti-apoptosis inhibitor 1, in humans is the homologue of yeast Dre2, a conserved soluble eukaryotic Fe-S cluster protein, that functions in cytosolic Fe-S protein biogenesis. It is found in both the cytoplasm and in the mitochondrial intermembrane space (IMS). CIAPIN1 is found to be up-regulated in hepatocellular cancer, is considered to be a downstream effector of the receptor tyrosine kinase-Ras signalling pathway, and is essential in mouse definitive haematopoiesis. Dre2 has been found to interact with the yeast reductase Tah18, forming a tight cytosolic complex implicated in the response to high levels of oxidative stress. Length = 97

>gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|227923 COG5636, COG5636, Uncharacterized conserved protein, contains Zn-ribbon-like motif [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 299
KOG4020257 consensus Protein DRE2, required for cell viabilit 100.0
PF05093100 CIAPIN1: Cytokine-induced anti-apoptosis inhibitor 100.0
COG5636284 Uncharacterized conserved protein, contains Zn-rib 100.0
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.45
PLN02232160 ubiquinone biosynthesis methyltransferase 99.28
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.28
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 99.23
PLN02233261 ubiquinone biosynthesis methyltransferase 99.2
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.16
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.12
PLN02244340 tocopherol O-methyltransferase 99.0
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.96
PLN02490340 MPBQ/MSBQ methyltransferase 98.93
KOG4300252 consensus Predicted methyltransferase [General fun 98.93
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.87
PLN02336475 phosphoethanolamine N-methyltransferase 98.81
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.7
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.69
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.64
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.56
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.54
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.53
PRK08317241 hypothetical protein; Provisional 98.53
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.52
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.51
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.47
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.45
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.44
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.42
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.39
TIGR00452314 methyltransferase, putative. Known examples to dat 98.34
PRK05785226 hypothetical protein; Provisional 98.33
PRK11207197 tellurite resistance protein TehB; Provisional 98.32
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 98.31
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.3
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.27
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.26
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.25
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 98.24
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.24
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.19
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.18
PRK06922677 hypothetical protein; Provisional 98.18
COG2521287 Predicted archaeal methyltransferase [General func 98.16
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 98.15
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.14
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.12
PRK04266226 fibrillarin; Provisional 98.12
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 98.11
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.11
KOG3045325 consensus Predicted RNA methylase involved in rRNA 98.08
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.07
PRK12335287 tellurite resistance protein TehB; Provisional 98.07
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.07
PLN02336 475 phosphoethanolamine N-methyltransferase 98.06
KOG3010261 consensus Methyltransferase [General function pred 97.94
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.94
COG4106257 Tam Trans-aconitate methyltransferase [General fun 97.9
PLN03075296 nicotianamine synthase; Provisional 97.88
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 97.87
PTZ00146293 fibrillarin; Provisional 97.82
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 97.76
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.75
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 97.7
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 97.66
KOG1270282 consensus Methyltransferases [Coenzyme transport a 97.63
PRK06202232 hypothetical protein; Provisional 97.63
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 97.62
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 97.61
PRK14968188 putative methyltransferase; Provisional 97.61
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 97.6
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.59
PRK14967223 putative methyltransferase; Provisional 97.58
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 97.57
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 97.56
KOG2940325 consensus Predicted methyltransferase [General fun 97.56
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.49
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 97.46
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 97.45
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 97.38
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 97.35
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.34
TIGR03438301 probable methyltransferase. This model represents 97.24
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.23
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 97.23
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.23
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 97.2
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.17
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 97.14
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 97.12
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 97.11
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.03
COG4123248 Predicted O-methyltransferase [General function pr 97.02
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 97.01
PRK01581374 speE spermidine synthase; Validated 96.97
PRK13255218 thiopurine S-methyltransferase; Reviewed 96.95
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 96.93
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 96.92
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 96.89
PRK10611287 chemotaxis methyltransferase CheR; Provisional 96.87
PLN02585315 magnesium protoporphyrin IX methyltransferase 96.84
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 96.84
KOG2361264 consensus Predicted methyltransferase [General fun 96.82
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 96.81
TIGR00536284 hemK_fam HemK family putative methylases. The gene 96.73
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 96.69
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 96.68
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 96.61
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 96.61
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 96.58
PRK00811283 spermidine synthase; Provisional 96.57
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 96.56
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 96.54
PRK10901427 16S rRNA methyltransferase B; Provisional 96.54
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 96.54
PRK03612521 spermidine synthase; Provisional 96.53
PRK07402196 precorrin-6B methylase; Provisional 96.53
KOG1331293 consensus Predicted methyltransferase [General fun 96.49
TIGR00438188 rrmJ cell division protein FtsJ. 96.43
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 96.43
PRK14901434 16S rRNA methyltransferase B; Provisional 96.42
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 96.39
PHA03411279 putative methyltransferase; Provisional 96.37
PRK14903431 16S rRNA methyltransferase B; Provisional 96.25
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 96.23
PRK04457262 spermidine synthase; Provisional 96.2
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 96.15
PRK14904445 16S rRNA methyltransferase B; Provisional 96.13
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 96.13
PRK14902444 16S rRNA methyltransferase B; Provisional 96.1
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 96.03
COG1041347 Predicted DNA modification methylase [DNA replicat 96.03
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 95.98
COG4627185 Uncharacterized protein conserved in bacteria [Fun 95.97
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 95.91
PRK13256226 thiopurine S-methyltransferase; Reviewed 95.89
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 95.79
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 95.69
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 95.59
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 95.48
PLN02366308 spermidine synthase 95.44
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 95.4
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 95.38
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 95.29
KOG1271227 consensus Methyltransferases [General function pre 95.29
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 95.25
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 95.07
COG4976287 Predicted methyltransferase (contains TPR repeat) 95.01
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 94.74
PF07942270 N2227: N2227-like protein; InterPro: IPR012901 Thi 94.63
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 94.59
smart00650169 rADc Ribosomal RNA adenine dimethylases. 94.38
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 94.33
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 94.33
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 94.31
COG4798238 Predicted methyltransferase [General function pred 94.2
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 93.93
PLN02672 1082 methionine S-methyltransferase 93.84
PRK00536262 speE spermidine synthase; Provisional 93.68
COG4122219 Predicted O-methyltransferase [General function pr 93.63
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 93.61
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 93.53
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 93.49
KOG2899288 consensus Predicted methyltransferase [General fun 93.33
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 93.32
KOG2352 482 consensus Predicted spermine/spermidine synthase [ 93.21
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 93.05
PLN02823336 spermine synthase 92.68
PRK13699227 putative methylase; Provisional 92.4
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 92.38
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 92.37
PHA03412241 putative methyltransferase; Provisional 92.12
KOG1709271 consensus Guanidinoacetate methyltransferase and r 92.07
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 91.9
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 91.62
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 91.55
PF03141506 Methyltransf_29: Putative S-adenosyl-L-methionine- 91.37
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 91.24
COG0421282 SpeE Spermidine synthase [Amino acid transport and 91.03
PF05430124 Methyltransf_30: S-adenosyl-L-methionine-dependent 90.99
COG1092393 Predicted SAM-dependent methyltransferases [Genera 90.94
PRK11524284 putative methyltransferase; Provisional 90.79
PF03269177 DUF268: Caenorhabditis protein of unknown function 90.45
PLN02476278 O-methyltransferase 90.4
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 90.04
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 89.33
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 89.1
COG2890280 HemK Methylase of polypeptide chain release factor 88.96
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 88.77
PLN02589247 caffeoyl-CoA O-methyltransferase 88.41
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 88.0
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 85.62
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 84.55
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 83.71
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 83.08
KOG3201201 consensus Uncharacterized conserved protein [Funct 82.53
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 82.34
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 81.95
PF0809036 Enterotoxin_HS1: Heat stable E.coli enterotoxin 1; 81.75
PRK11933470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 81.61
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 80.04
>KOG4020 consensus Protein DRE2, required for cell viability [Function unknown] Back     alignment and domain information
Probab=100.00  E-value=4.1e-46  Score=328.99  Aligned_cols=235  Identities=29%  Similarity=0.367  Sum_probs=152.4

Q ss_pred             EEEecCCccChHHHHHHHHHHHHHHhhhc--CCCeEEEeccCCCCCCCCCceeEEEecCccCCCChHHHHHHHHHhccCC
Q 022285           11 LALSEDKILPVSAVLNAIRDLGDEAVEQC--DPQIITQASSLSQLPVESFSIDTVLSISSSHELPGDQLLEEISRVLKPG   88 (299)
Q Consensus        11 LlL~~~~~vt~~dlse~m~~~A~~~~~~~--~~~i~~~~gd~~~Lp~~~~sfD~Vls~~~~~~~~~~~~L~ei~RvLKPG   88 (299)
                      |++.+. ..+.++..+-..+++.-.+...  ...+..+.+....+  +.++||+.+...  .|...-.+....+..|+|+
T Consensus         4 l~~~l~-~~~~~~~~~~~K~~~~i~~~~ggdl~li~~~~~~~~t~--~~~~~e~~~~e~--a~~~~~~V~~l~~~~l~P~   78 (257)
T KOG4020|consen    4 LLLCLT-GTTTSELAELLKAQALIKAVKGGDLFLINKVNGSVSTL--ENARYELLTPEA--ATLSGLKVKSLLRASLKPE   78 (257)
T ss_pred             eeEEec-ccchhhHHHHHHhHHhhhcccCcchhheeccccccccc--cccceeccchhh--ccccccchhhhhhcccCcc
Confidence            555555 5566777776666665322221  23344444444444  477899554432  2322114566677899999


Q ss_pred             cEEEEEecCCCCccchHHHHHHHHHHHHHCCceeceeecccccC--ccceeeeeeeecCCCCCcCCccccccCcc-----
Q 022285           89 GTILIYKKLTSDKGDVDKAISALEGKLLLAGFLDAQRIQLKSVV--PAEVVSFGVKGKKPTWKIGSSFAIKKAPK-----  161 (299)
Q Consensus        89 G~l~i~~~~~~~~g~~~~~~~~l~~~L~laGFv~v~~~~~kp~~--~~~~~~~~i~a~KP~~~~gs~~~l~~~~~-----  161 (299)
                      |.+.+.++...    -    +++.....+.|+.+..  |..+..  .+.+        |+.....+++.++.+.+     
T Consensus        79 gtl~v~s~~g~----~----~~~l~~~~i~g~~~~~--~~s~d~~s~~ql--------kl~~~K~ss~~~q~a~k~~~~k  140 (257)
T KOG4020|consen   79 GTLSVLSHIGH----A----DDLLLFVKITGEKDYC--WISPDVSSANQL--------KLSITKKSSPSLQSASKNAAAK  140 (257)
T ss_pred             ceEehhhhccc----h----hhHHHHHHHhCCcccc--ccCccccccccc--------cccceeccCcccccccccHHHH
Confidence            99998776421    1    1445667888888753  222221  1111        23333333333332211     


Q ss_pred             cc-----cccccCCCCCccCcCcCCCccccCCCCCCCCC-CCCCCCCccCCCCCccchHHHHHHHHhcCCCccccCCCCC
Q 022285          162 SL-----AKLQVDDDSDLIDEDTLLTEEDLKKPQLPSVG-DCEVGSTRKACKNCICGRAEAEEKVEKLGLTMDQLKNPQS  235 (299)
Q Consensus       162 ~~-----~~~~~d~d~dlIded~Ll~~~dl~~p~~~~~~-~C~~~~krkACknCtCGlaE~e~~~~~~~~~~~~~~~~~s  235 (299)
                      .+     ..+..|.++|+||||+||+|||+.+|++.+.. .|++++||||||||||||||+||.|..   ......+++|
T Consensus       141 nl~s~sand~s~d~~~dlide~elldee~~~k~~~~~~~a~~~~~kKkkaCk~CtcGl~Ee~E~Eks---~~q~s~~~~s  217 (257)
T KOG4020|consen  141 NLWSLSANDMSDDLRQDLIDEEELLDEEDLKKPDPASLRASCSPGKKKKACKNCTCGLAEEEEKEKS---REQISSNPKS  217 (257)
T ss_pred             HhhhhhccccccchhhhccChhhccCHhhcCCCCccccccCCCCcccchhhhcCCcccHHHHHhhhh---hhhhccCccc
Confidence            11     12233445799999999999999999988765 899999999999999999999997742   2223456999


Q ss_pred             CCCcchh--hhccCCCCCCCCCCCCCCCCCCCCcEEeecCCCcc
Q 022285          236 ACGSVMW--TWRCFPLRYMPLQGSASIQTGREGVTVKQLPRSRH  277 (299)
Q Consensus       236 sCGsC~L--AFRC~~CPYlGlPaFkp~~~~~~~~~~~~~~~~~~  277 (299)
                      +||||||  ||||+|||||||||||      ||++|.+-+++-+
T Consensus       218 ~CGnCylGdaFrCs~CPylG~Pafk------PGe~v~ls~~~~~  255 (257)
T KOG4020|consen  218 ACGNCYLGDAFRCSGCPYLGMPAFK------PGEKVLLSDNSDK  255 (257)
T ss_pred             ccCcccccccceecCCCcCCCCCCC------CCCeEEecccccc
Confidence            9999999  9999999999999999      5677877666544



>PF05093 CIAPIN1: Cytokine-induced anti-apoptosis inhibitor 1, Fe-S biogenesis; InterPro: IPR007785 Anamorsin, subsequently named CIAPIN1 for cytokine-induced anti-apoptosis inhibitor 1, in humans is the homologue of yeast Dre2, a conserved soluble eukaryotic Fe-S cluster protein, that functions in cytosolic Fe-S protein biogenesis Back     alignment and domain information
>COG5636 Uncharacterized conserved protein, contains Zn-ribbon-like motif [Function unknown] Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>KOG2940 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>KOG2352 consensus Predicted spermine/spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05430 Methyltransf_30: S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>KOG3201 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>PF08090 Enterotoxin_HS1: Heat stable E Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
2ld4_A176 Solution Structure Of The N-Terminal Domain Of Huma 4e-05
2yui_A182 Solution Structure Of The N-Terminal Domain In Huma 2e-04
>pdb|2LD4|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Anamorsin Length = 176 Back     alignment and structure

Iteration: 1

Score = 45.4 bits (106), Expect = 4e-05, Method: Compositional matrix adjust. Identities = 33/113 (29%), Positives = 56/113 (49%), Gaps = 18/113 (15%) Query: 59 SIDTVLS--ISSSHELPGDQLLEEISRVLKPGGTILIYKKLTS--DKGDVDKAISALEGK 114 S D +LS + S L ++L EI+R+L+PGG + + + + + D K S L Sbjct: 63 SFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSA 122 Query: 115 LLLAGFLDAQRIQLKSVVPAEVVS--------------FGVKGKKPTWKIGSS 153 L L+G ++ + +Q + + P EV S + GKKP +++GSS Sbjct: 123 LTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSS 175
>pdb|2YUI|A Chain A, Solution Structure Of The N-Terminal Domain In Human Cytokine-Induced Apoptosis Inhibitor Anamorsin Length = 182 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query299
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 2e-14
3i9f_A170 Putative type 11 methyltransferase; structural gen 3e-09
3dh0_A219 SAM dependent methyltransferase; cystal structure, 3e-08
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 9e-07
3f4k_A257 Putative methyltransferase; structural genomics, P 1e-06
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 3e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 4e-06
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 1e-05
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 2e-05
3ege_A261 Putative methyltransferase from antibiotic biosyn 2e-05
3hnr_A220 Probable methyltransferase BT9727_4108; structural 3e-05
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 4e-05
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 4e-05
1vlm_A219 SAM-dependent methyltransferase; possible histamin 5e-05
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 2e-04
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 2e-04
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 3e-04
3dtn_A234 Putative methyltransferase MM_2633; structural gen 4e-04
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 4e-04
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 5e-04
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 5e-04
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 5e-04
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 5e-04
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 6e-04
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 7e-04
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 9e-04
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Length = 176 Back     alignment and structure
 Score = 68.7 bits (167), Expect = 2e-14
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 18/128 (14%)

Query: 44  ITQASSLSQLPVESFSIDTVLS--ISSSHELPGDQLLEEISRVLKPGGTILIYKKLTSD- 100
           +     L Q   +  S D +LS  +  S  L   ++L EI+R+L+PGG + + + + +  
Sbjct: 48  VENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAV 107

Query: 101 -KGDVDKAISALEGKLLLAGFLDAQRIQLKSVVPAE--------------VVSFGVKGKK 145
                 K  S L   L L+G ++ + +Q + + P E              ++   + GKK
Sbjct: 108 DNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKK 167

Query: 146 PTWKIGSS 153
           P +++GSS
Sbjct: 168 PNFEVGSS 175


>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Length = 215 Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Length = 219 Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Length = 383 Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Length = 273 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Length = 269 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Length = 263 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.71
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.24
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.08
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.03
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.03
3dtn_A234 Putative methyltransferase MM_2633; structural gen 99.02
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 98.96
1xxl_A239 YCGJ protein; structural genomics, protein structu 98.96
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.96
3f4k_A257 Putative methyltransferase; structural genomics, P 98.95
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.95
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.95
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 98.94
2km1_A136 Protein DRE2; yeast, antiapoptotic, protein bindin 98.93
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.92
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.9
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.89
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 98.89
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.88
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.87
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.87
3ocj_A305 Putative exported protein; structural genomics, PS 98.87
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.86
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.86
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.85
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.84
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.83
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.81
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.81
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.81
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.8
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.79
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.79
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.76
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.76
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.75
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.75
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.73
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.73
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.72
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.71
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.71
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.69
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.69
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.68
3lcc_A235 Putative methyl chloride transferase; halide methy 98.65
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.65
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.64
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.64
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.63
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.61
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.61
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.61
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 98.6
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.59
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.59
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.58
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.56
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.55
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.54
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.54
3cc8_A230 Putative methyltransferase; structural genomics, j 98.52
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.52
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.52
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 98.51
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.51
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.51
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.51
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.49
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.47
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.46
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 98.46
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.46
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.45
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.44
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.43
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.41
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 98.41
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.41
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.38
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.37
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 98.35
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.35
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 98.34
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.33
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 98.32
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 98.32
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.32
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.31
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.29
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 98.28
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.28
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.28
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.26
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.25
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.24
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.24
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.21
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.19
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.17
3lpm_A259 Putative methyltransferase; structural genomics, p 98.16
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 98.15
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.15
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.15
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 98.13
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.13
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.13
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.11
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.11
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.11
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 98.1
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 98.1
1yb2_A275 Hypothetical protein TA0852; structural genomics, 98.06
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 98.05
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.05
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 98.05
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 98.03
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.03
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 98.03
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 98.0
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.0
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.99
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.99
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.99
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.99
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.99
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 97.99
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.99
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.95
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 97.94
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.93
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 97.92
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 97.89
2qm3_A373 Predicted methyltransferase; putative methyltransf 97.89
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.87
2fyt_A340 Protein arginine N-methyltransferase 3; structural 97.87
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 97.87
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 97.85
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 97.85
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 97.82
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.82
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 97.8
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.78
2fpo_A202 Methylase YHHF; structural genomics, putative meth 97.78
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 97.77
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.77
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.76
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.76
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.73
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.73
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 97.71
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 97.71
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 97.7
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 97.69
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.68
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 97.65
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.65
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 97.65
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 97.64
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.64
1jsx_A207 Glucose-inhibited division protein B; methyltransf 97.63
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 97.63
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.63
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 97.62
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 97.61
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 97.61
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 97.61
2esr_A177 Methyltransferase; structural genomics, hypothetic 97.59
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.57
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.56
3gjy_A317 Spermidine synthase; APC62791, structural genomics 97.53
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.53
3sso_A419 Methyltransferase; macrolide, natural product, ros 97.5
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 97.49
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 97.48
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.48
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 97.47
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 97.47
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 97.45
1ws6_A171 Methyltransferase; structural genomics, riken stru 97.42
2b25_A336 Hypothetical protein; structural genomics, methyl 97.41
2i7c_A283 Spermidine synthase; transferase, structural genom 97.4
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 97.39
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 97.39
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 97.38
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 97.33
1xj5_A334 Spermidine synthase 1; structural genomics, protei 97.31
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 97.3
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 97.29
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 97.28
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.28
2o07_A304 Spermidine synthase; structural genomics, structur 97.28
2pt6_A321 Spermidine synthase; transferase, structural genom 97.27
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 97.21
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 97.2
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 97.16
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 97.16
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 97.1
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 97.08
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 97.06
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 97.03
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 97.02
2cmg_A262 Spermidine synthase; transferase, putrescine amino 96.99
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 96.99
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 96.98
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 96.97
3duw_A223 OMT, O-methyltransferase, putative; alternating of 96.97
2h00_A254 Methyltransferase 10 domain containing protein; st 96.95
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 96.91
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 96.9
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.88
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 96.8
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 96.78
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 96.76
2efj_A384 3,7-dimethylxanthine methyltransferase; SAM-depend 96.75
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 96.75
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 96.7
3b5i_A374 S-adenosyl-L-methionine:salicylic acid carboxyl me 96.7
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 96.68
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 96.65
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosy 96.63
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.6
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 96.58
2avd_A229 Catechol-O-methyltransferase; structural genomics, 96.56
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 96.54
1m6e_X359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 96.53
1ne2_A200 Hypothetical protein TA1320; structural genomics, 96.51
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 96.49
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 96.42
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 96.4
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 96.39
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 96.32
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcy 96.26
2b78_A385 Hypothetical protein SMU.776; structure genomics, 96.22
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 96.21
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 96.21
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 96.17
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 96.16
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 96.16
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 96.13
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 96.04
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 95.9
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 95.83
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 95.82
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 95.81
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 95.7
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 95.68
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 95.51
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 95.43
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 95.35
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 95.21
3k6r_A278 Putative transferase PH0793; structural genomics, 95.2
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 95.12
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 95.07
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 94.93
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 94.91
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 94.71
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 94.58
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 93.79
2zig_A297 TTHA0409, putative modification methylase; methylt 93.05
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 92.64
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransf 92.61
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 91.42
3cvo_A202 Methyltransferase-like protein of unknown functio; 90.62
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 90.58
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 90.48
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 90.25
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 90.24
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein 90.18
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 90.06
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 88.73
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 88.16
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 88.14
3axs_A392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 87.36
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 86.64
3khk_A544 Type I restriction-modification system methylation 86.24
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 80.14
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
Probab=99.71  E-value=6.1e-17  Score=137.09  Aligned_cols=146  Identities=22%  Similarity=0.319  Sum_probs=109.2

Q ss_pred             ccccceEEEEecCCccChHHHHHHHHHHHHHHhhhcCCCeEEEeccCCCCCC---CCCceeEEEecCccCCC-C-hHHHH
Q 022285            4 GKMQSAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPV---ESFSIDTVLSISSSHEL-P-GDQLL   78 (299)
Q Consensus         4 ~~~~~~vLlL~~~~~vt~~dlse~m~~~A~~~~~~~~~~i~~~~gd~~~Lp~---~~~sfD~Vls~~~~~~~-~-~~~~L   78 (299)
                      .+.|++||.|+.+.+.  .|+++.|++.|+++...   ++.+.++|++.+|+   ++++||+|++.+++||+ + ...++
T Consensus        10 ~~~g~~vL~~~~g~v~--vD~s~~ml~~a~~~~~~---~~~~~~~d~~~~~~~~~~~~~fD~V~~~~~l~~~~~~~~~~l   84 (176)
T 2ld4_A           10 ISAGQFVAVVWDKSSP--VEALKGLVDKLQALTGN---EGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEIL   84 (176)
T ss_dssp             CCTTSEEEEEECTTSC--HHHHHHHHHHHHHHTTT---TSEEEEEEGGGGGGGCCCSSCEEEEEECCSTTCCCCCCHHHH
T ss_pred             CCCCCEEEEecCCcee--eeCCHHHHHHHHHhccc---CcEEEEechhcCccccCCCCCEeEEEECChhhhcccCHHHHH
Confidence            4578999999998754  99999999999876532   48999999999988   89999999999999998 5 78899


Q ss_pred             HHHHHhccCCcEEEEEecCCCCcc--chHHHHHHHHHHHHHCCceeceeecccccCc--------------cceeeeeee
Q 022285           79 EEISRVLKPGGTILIYKKLTSDKG--DVDKAISALEGKLLLAGFLDAQRIQLKSVVP--------------AEVVSFGVK  142 (299)
Q Consensus        79 ~ei~RvLKPGG~l~i~~~~~~~~g--~~~~~~~~l~~~L~laGFv~v~~~~~kp~~~--------------~~~~~~~i~  142 (299)
                      ++++|+|||||+|++..+.....+  .+....+++...|..+||+.+......+..+              +.+..+.++
T Consensus        85 ~~~~r~LkpgG~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~aGfi~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~  164 (176)
T 2ld4_A           85 AEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQIT  164 (176)
T ss_dssp             HHHHHHEEEEEEEEEEEEEESSSCSSSSSCCHHHHHHHHHHTTCEEEEEEEEECCCHHHHHHHHHHTCCCCSSEEEEEEE
T ss_pred             HHHHHHCCCCEEEEEEcccccccccccccCCHHHHHHHHHHCCCcEeecCcccCCCHHHHHHHHHHhcccCCceEEEEEe
Confidence            999999999999999765321111  0111234788899999995433322111111              122355688


Q ss_pred             ecCCCCCcCCcc
Q 022285          143 GKKPTWKIGSSF  154 (299)
Q Consensus       143 a~KP~~~~gs~~  154 (299)
                      ++||+|++|||+
T Consensus       165 a~Kp~~~~gs~~  176 (176)
T 2ld4_A          165 GKKPNFEVGSSR  176 (176)
T ss_dssp             EECCCSSCCSCC
T ss_pred             ccCCcccccCCC
Confidence            999999999984



>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2km1_A Protein DRE2; yeast, antiapoptotic, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 299
d2g72a1263 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltr 2e-04
d2i6ga1198 c.66.1.44 (A:1-198) Putative methyltransferase Teh 0.001
d1ve3a1226 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {A 0.004
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: Arylamine N-methyltransferase
domain: Phenylethanolamine N-methyltransferase, PNMTase
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 39.4 bits (91), Expect = 2e-04
 Identities = 20/103 (19%), Positives = 33/103 (32%), Gaps = 9/103 (8%)

Query: 8   SAVLALSEDKILPVSAVLNAIRDLGDEAVEQCDPQIITQASSLSQLPVESFSIDTVLSIS 67
           S    L E K          +R    + V   D   + Q   L          D ++S  
Sbjct: 110 SQHACLIEGKGECWQDKERQLRARV-KRVLPID---VHQPQPLGAGSPAPLPADALVSAF 165

Query: 68  SSHELPGD-----QLLEEISRVLKPGGTILIYKKLTSDKGDVD 105
               +  D     + L+ I+ +L+PGG +L+   L        
Sbjct: 166 CLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAG 208


>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 226 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query299
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.34
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.24
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.12
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.05
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.04
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.0
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.98
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.93
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.84
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.78
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.71
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.71
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.63
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.62
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.61
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.53
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.52
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.49
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.48
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.43
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.35
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 98.32
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 98.3
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 98.29
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.26
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.17
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 98.16
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.16
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 98.15
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 98.14
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 98.12
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 98.09
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 98.08
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 98.07
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.05
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 98.04
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.03
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 98.01
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 97.88
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 97.85
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 97.8
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 97.69
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 97.51
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 97.51
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 97.5
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 97.37
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 97.29
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 97.21
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 97.17
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 97.0
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 96.93
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 96.75
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 96.71
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 96.37
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 96.06
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 96.06
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 95.67
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 95.14
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 94.81
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 94.78
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 94.62
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 94.59
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 94.31
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 94.26
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 92.71
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 92.65
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 92.53
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 91.74
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 91.69
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 91.24
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 90.95
d2h00a1250 Methyltransferase 10 domain containing protein MET 90.68
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 90.61
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 88.57
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 88.38
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 87.71
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 87.31
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 87.17
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 86.97
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 86.64
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 86.3
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 86.18
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 82.59
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 82.13
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein BH2331
species: Bacillus halodurans [TaxId: 86665]
Probab=99.34  E-value=9.9e-13  Score=113.27  Aligned_cols=120  Identities=22%  Similarity=0.254  Sum_probs=91.5

Q ss_pred             cccceEEEEecC------------CccChHHHHHHHHHHHHHHhhhc-CCCeEEEeccCCCCCCCCCceeEEEecCccCC
Q 022285            5 KMQSAVLALSED------------KILPVSAVLNAIRDLGDEAVEQC-DPQIITQASSLSQLPVESFSIDTVLSISSSHE   71 (299)
Q Consensus         5 ~~~~~vLlL~~~------------~~vt~~dlse~m~~~A~~~~~~~-~~~i~~~~gd~~~Lp~~~~sfD~Vls~~~~~~   71 (299)
                      +.+++||-|--|            ..++..|+++.|++.|++++... .+++.++++|++.+||++++||+|++..++||
T Consensus        14 ~~~~rVLDiGcG~G~~~~~l~~~~~~v~gvD~s~~~i~~A~~~~~~~~~~~i~~~~~d~~~l~~~~~~fD~v~~~~~l~~   93 (231)
T d1vl5a_          14 KGNEEVLDVATGGGHVANAFAPFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQMPFTDERFHIVTCRIAAHH   93 (231)
T ss_dssp             CSCCEEEEETCTTCHHHHHHGGGSSEEEEEESCHHHHHHHHHHHHHTTCCSEEEEECCC-CCCSCTTCEEEEEEESCGGG
T ss_pred             CCcCEEEEecccCcHHHHHHHHhCCEEEEEECCHHHHhhhhhcccccccccccccccccccccccccccccccccccccc
Confidence            445566666433            34556799999999998876543 68999999999999999999999999999999


Q ss_pred             CC-hHHHHHHHHHhccCCcEEEEEecCCCCccchHH-----------------HHHHHHHHHHHCCceece
Q 022285           72 LP-GDQLLEEISRVLKPGGTILIYKKLTSDKGDVDK-----------------AISALEGKLLLAGFLDAQ  124 (299)
Q Consensus        72 ~~-~~~~L~ei~RvLKPGG~l~i~~~~~~~~g~~~~-----------------~~~~l~~~L~laGFv~v~  124 (299)
                      ++ +..++++++|+|||||+|+|.++.......+..                 ..+++...+..+||..++
T Consensus        94 ~~d~~~~l~~~~r~LkpgG~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~aGf~~~~  164 (231)
T d1vl5a_          94 FPNPASFVSEAYRVLKKGGQLLLVDNSAPENDAFDVFYNYVEKERDYSHHRAWKKSDWLKMLEEAGFELEE  164 (231)
T ss_dssp             CSCHHHHHHHHHHHEEEEEEEEEEEEEBCSSHHHHHHHHHHHHHHCTTCCCCCBHHHHHHHHHHHTCEEEE
T ss_pred             cCCHHHHHHHHHHhcCCCcEEEEEeCCCCCCHHHHHHHHHHHhhcccCcccCCCHHHHHHHHHHCCCEEEE
Confidence            97 789999999999999999998764322111111                 124577788899998654



>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure