Citrus Sinensis ID: 022491
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| 157042763 | 340 | glyceraldehyde 3-phosphate dehydrogenase | 1.0 | 0.870 | 0.935 | 1e-160 | |
| 224110772 | 341 | predicted protein [Populus trichocarpa] | 1.0 | 0.868 | 0.922 | 1e-159 | |
| 418731090 | 337 | glyceraldehyde 3-phosphate dehydrogenase | 0.983 | 0.863 | 0.938 | 1e-159 | |
| 74419004 | 341 | glyceraldehyde-3-phosphate dehydrogenase | 1.0 | 0.868 | 0.922 | 1e-159 | |
| 297828898 | 338 | glyceraldehyde-3-phosphate dehydrogenase | 0.993 | 0.869 | 0.928 | 1e-158 | |
| 386870483 | 337 | glyceraldehyde 3-phosphate dehydrogenase | 0.983 | 0.863 | 0.934 | 1e-158 | |
| 15229231 | 338 | glyceraldehyde-3-phosphate dehydrogenase | 0.993 | 0.869 | 0.925 | 1e-158 | |
| 257815169 | 337 | NAD-dependent glyceraldehyde 3-P dehydro | 0.983 | 0.863 | 0.927 | 1e-158 | |
| 166706 | 338 | cystolic glyceraldehyde-3-phosphate dehy | 0.993 | 0.869 | 0.925 | 1e-158 | |
| 359806082 | 340 | uncharacterized protein LOC100807342 [Gl | 1.0 | 0.870 | 0.918 | 1e-158 |
| >gi|157042763|gb|ABV02033.1| glyceraldehyde 3-phosphate dehydrogenase [Nicotiana langsdorffii x Nicotiana sanderae] | Back alignment and taxonomy information |
|---|
Score = 569 bits (1466), Expect = e-160, Method: Compositional matrix adjust.
Identities = 277/296 (93%), Positives = 289/296 (97%)
Query: 1 MAGDKKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK 60
MA DKKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK
Sbjct: 1 MASDKKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK 60
Query: 61 HNELKVKDEKTLLFGEKPVAVFGFRNPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGG 120
H+ELKVKDEKTLLFGEK V VFG RNPEEIPWA+ GA++VVESTGVFTDKDKAAAHLKGG
Sbjct: 61 HHELKVKDEKTLLFGEKSVRVFGIRNPEEIPWAEAGADFVVESTGVFTDKDKAAAHLKGG 120
Query: 121 AKKVVISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLAPLAKVIHDKFGIVEGLM 180
AKKVVISAPSKDAPMFVVGVNEKEYKPE DIVSNASCTTNCLAPLAKVI+D+FGIVEGLM
Sbjct: 121 AKKVVISAPSKDAPMFVVGVNEKEYKPEYDIVSNASCTTNCLAPLAKVINDRFGIVEGLM 180
Query: 181 TTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRV 240
TTVHS+TATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGM+FRV
Sbjct: 181 TTVHSLTATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMAFRV 240
Query: 241 PTVDVSVVDLTVRLEKEATYEEIKNAIKEESEGKLKGILGYTEEDVVSTDFVGDSR 296
PTVDVSVVDLTVRLEKEA+Y+EIK AIKEESEGKLKGILG+TE+DVVSTDFVGDSR
Sbjct: 241 PTVDVSVVDLTVRLEKEASYDEIKAAIKEESEGKLKGILGFTEDDVVSTDFVGDSR 296
|
Source: Nicotiana langsdorffii x Nicotiana sanderae Species: Nicotiana langsdorffii x Nicotiana sanderae Genus: Nicotiana Family: Solanaceae Order: Solanales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224110772|ref|XP_002315632.1| predicted protein [Populus trichocarpa] gi|118481113|gb|ABK92510.1| unknown [Populus trichocarpa] gi|118486257|gb|ABK94970.1| unknown [Populus trichocarpa] gi|222864672|gb|EEF01803.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|418731090|gb|AFX67011.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum] | Back alignment and taxonomy information |
|---|
| >gi|74419004|gb|ABA03227.1| glyceraldehyde-3-phosphate dehydrogenase [Populus maximowiczii x Populus nigra] | Back alignment and taxonomy information |
|---|
| >gi|297828898|ref|XP_002882331.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis lyrata subsp. lyrata] gi|297328171|gb|EFH58590.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|386870483|gb|AFJ42572.1| glyceraldehyde 3-phosphate dehydrogenase [Sesamum indicum] | Back alignment and taxonomy information |
|---|
| >gi|15229231|ref|NP_187062.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Arabidopsis thaliana] gi|20455492|sp|P25858.2|G3PC1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic gi|6721173|gb|AAF26801.1|AC016829_25 glyceraldehyde-3-phosphate dehydrogenase C subunit (GapC) [Arabidopsis thaliana] gi|15529286|gb|AAK97737.1| AT3g04120/T6K12_26 [Arabidopsis thaliana] gi|16974417|gb|AAL31134.1| AT3g04120/T6K12_26 [Arabidopsis thaliana] gi|22655270|gb|AAM98225.1| unknown protein [Arabidopsis thaliana] gi|110741920|dbj|BAE98901.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis thaliana] gi|332640518|gb|AEE74039.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|257815169|gb|ACV69976.1| NAD-dependent glyceraldehyde 3-P dehydrogenase [Solanum chacoense] | Back alignment and taxonomy information |
|---|
| >gi|166706|gb|AAA32794.1| cystolic glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana] gi|166710|gb|AAA32796.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|359806082|ref|NP_001241184.1| uncharacterized protein LOC100807342 [Glycine max] gi|255638912|gb|ACU19758.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 296 | ||||||
| TAIR|locus:2103085 | 338 | GAPC1 "glyceraldehyde-3-phosph | 0.989 | 0.866 | 0.877 | 2.3e-135 | |
| TAIR|locus:2010007 | 338 | GAPC2 "glyceraldehyde-3-phosph | 0.989 | 0.866 | 0.860 | 3e-133 | |
| TAIR|locus:2032810 | 420 | GAPCP-2 "glyceraldehyde-3-phos | 0.979 | 0.690 | 0.718 | 2.1e-107 | |
| TAIR|locus:2206435 | 422 | GAPCP-1 "glyceraldehyde-3-phos | 0.979 | 0.687 | 0.711 | 9.2e-107 | |
| CGD|CAL0005657 | 335 | TDH3 [Candida albicans (taxid: | 0.969 | 0.856 | 0.698 | 3.7e-103 | |
| UNIPROTKB|Q5ADM7 | 335 | TDH3 "Glyceraldehyde-3-phospha | 0.969 | 0.856 | 0.698 | 3.7e-103 | |
| SGD|S000003769 | 332 | TDH2 "Glyceraldehyde-3-phospha | 0.969 | 0.864 | 0.657 | 9.4e-98 | |
| POMBASE|SPBC32F12.11 | 336 | tdh1 "glyceraldehyde-3-phospha | 0.966 | 0.851 | 0.649 | 2.5e-97 | |
| UNIPROTKB|G4NCH2 | 336 | MGG_01084 "Glyceraldehyde-3-ph | 0.969 | 0.854 | 0.660 | 3.2e-97 | |
| ASPGD|ASPL0000009927 | 336 | gpdA [Emericella nidulans (tax | 0.969 | 0.854 | 0.647 | 8.4e-97 |
| TAIR|locus:2103085 GAPC1 "glyceraldehyde-3-phosphate dehydrogenase C subunit 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1326 (471.8 bits), Expect = 2.3e-135, P = 2.3e-135
Identities = 257/293 (87%), Positives = 270/293 (92%)
Query: 4 DKKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNE 63
DKKI+IGINGFGRIGRLVARV LQRDDVELVAVNDPFI+T+YMTYMFKYDSVHGQWKHNE
Sbjct: 3 DKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHNE 62
Query: 64 LKVKDEKTLLFGEKPVAVFGFRNPEEIPWAKTGAEYVVESTGVFTXXXXXXXXXXXXXXX 123
LK+KDEKTLLFGEKPV VFG RNPE+IPWA+ GA+YVVESTGVFT
Sbjct: 63 LKIKDEKTLLFGEKPVTVFGIRNPEDIPWAEAGADYVVESTGVFTDKDKAAAHLKGGAKK 122
Query: 124 VVISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTTV 183
VVISAPSKDAPMFVVGVNE EYK +LDIVSNASCTTNCLAPLAKVI+D+FGIVEGLMTTV
Sbjct: 123 VVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTTV 182
Query: 184 HSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV 243
HSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV
Sbjct: 183 HSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTV 242
Query: 244 DVSVVDLTVRLEKEATYEEIKNAIKEESEGKLKGILGYTEEDVVSTDFVGDSR 296
DVSVVDLTVRLEK ATY+EIK AIKEESEGKLKGILGYTE+DVVSTDFVGD+R
Sbjct: 243 DVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNR 295
|
|
| TAIR|locus:2010007 GAPC2 "glyceraldehyde-3-phosphate dehydrogenase C2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0005657 TDH3 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ADM7 TDH3 "Glyceraldehyde-3-phosphate dehydrogenase" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
| SGD|S000003769 TDH2 "Glyceraldehyde-3-phosphate dehydrogenase, isozyme 2" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC32F12.11 tdh1 "glyceraldehyde-3-phosphate dehydrogenase Tdh1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4NCH2 MGG_01084 "Glyceraldehyde-3-phosphate dehydrogenase" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000009927 gpdA [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 296 | |||
| PLN02358 | 338 | PLN02358, PLN02358, glyceraldehyde-3-phosphate deh | 0.0 | |
| PLN02272 | 421 | PLN02272, PLN02272, glyceraldehyde-3-phosphate deh | 0.0 | |
| PTZ00023 | 337 | PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh | 1e-153 | |
| TIGR01534 | 326 | TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh | 1e-153 | |
| COG0057 | 335 | COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog | 1e-152 | |
| PRK15425 | 331 | PRK15425, gapA, glyceraldehyde-3-phosphate dehydro | 1e-122 | |
| PTZ00434 | 361 | PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho | 1e-117 | |
| PRK07729 | 343 | PRK07729, PRK07729, glyceraldehyde-3-phosphate deh | 1e-110 | |
| PRK07403 | 337 | PRK07403, PRK07403, glyceraldehyde-3-phosphate deh | 3e-97 | |
| PLN03096 | 395 | PLN03096, PLN03096, glyceraldehyde-3-phosphate deh | 6e-95 | |
| PLN02237 | 442 | PLN02237, PLN02237, glyceraldehyde-3-phosphate deh | 3e-94 | |
| PRK08955 | 334 | PRK08955, PRK08955, glyceraldehyde-3-phosphate deh | 1e-86 | |
| pfam02800 | 157 | pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh | 2e-79 | |
| PRK13535 | 336 | PRK13535, PRK13535, erythrose 4-phosphate dehydrog | 5e-78 | |
| pfam00044 | 148 | pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh | 9e-73 | |
| TIGR01532 | 325 | TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de | 8e-72 | |
| smart00846 | 149 | smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de | 3e-71 | |
| PRK08289 | 477 | PRK08289, PRK08289, glyceraldehyde-3-phosphate deh | 1e-69 | |
| PTZ00353 | 342 | PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph | 8e-56 | |
| COG0136 | 334 | COG0136, Asd, Aspartate-semialdehyde dehydrogenase | 2e-08 | |
| TIGR01296 | 338 | TIGR01296, asd_B, aspartate-semialdehyde dehydroge | 2e-04 | |
| PRK04207 | 341 | PRK04207, PRK04207, glyceraldehyde-3-phosphate deh | 2e-04 | |
| pfam01113 | 122 | pfam01113, DapB_N, Dihydrodipicolinate reductase, | 3e-04 | |
| PRK00048 | 257 | PRK00048, PRK00048, dihydrodipicolinate reductase; | 3e-04 | |
| COG0289 | 266 | COG0289, DapB, Dihydrodipicolinate reductase [Amin | 5e-04 |
| >gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
Score = 539 bits (1389), Expect = 0.0
Identities = 268/294 (91%), Positives = 284/294 (96%)
Query: 3 GDKKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHN 62
DKKI+IGINGFGRIGRLVARV LQRDDVELVAVNDPFI+T+YMTYMFKYDSVHGQWKH+
Sbjct: 2 ADKKIRIGINGFGRIGRLVARVVLQRDDVELVAVNDPFITTEYMTYMFKYDSVHGQWKHH 61
Query: 63 ELKVKDEKTLLFGEKPVAVFGFRNPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGGAK 122
ELKVKD+KTLLFGEKPV VFG RNPE+IPW + GA++VVESTGVFTDKDKAAAHLKGGAK
Sbjct: 62 ELKVKDDKTLLFGEKPVTVFGIRNPEDIPWGEAGADFVVESTGVFTDKDKAAAHLKGGAK 121
Query: 123 KVVISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLAPLAKVIHDKFGIVEGLMTT 182
KVVISAPSKDAPMFVVGVNE EYK +LDIVSNASCTTNCLAPLAKVI+D+FGIVEGLMTT
Sbjct: 122 KVVISAPSKDAPMFVVGVNEHEYKSDLDIVSNASCTTNCLAPLAKVINDRFGIVEGLMTT 181
Query: 183 VHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPT 242
VHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLP+LNGKLTGMSFRVPT
Sbjct: 182 VHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMSFRVPT 241
Query: 243 VDVSVVDLTVRLEKEATYEEIKNAIKEESEGKLKGILGYTEEDVVSTDFVGDSR 296
VDVSVVDLTVRLEK ATY+EIK AIKEESEGKLKGILGYTE+DVVSTDFVGD+R
Sbjct: 242 VDVSVVDLTVRLEKAATYDEIKKAIKEESEGKLKGILGYTEDDVVSTDFVGDNR 295
|
Length = 338 |
| >gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I | Back alignment and domain information |
|---|
| >gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
| >gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223214 COG0136, Asd, Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233347 TIGR01296, asd_B, aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >gnl|CDD|179786 PRK04207, PRK04207, glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216304 pfam01113, DapB_N, Dihydrodipicolinate reductase, N-terminus | Back alignment and domain information |
|---|
| >gnl|CDD|234595 PRK00048, PRK00048, dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223366 COG0289, DapB, Dihydrodipicolinate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| PTZ00434 | 361 | cytosolic glyceraldehyde 3-phosphate dehydrogenase | 100.0 | |
| PRK15425 | 331 | gapA glyceraldehyde-3-phosphate dehydrogenase A; P | 100.0 | |
| PTZ00023 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 100.0 | |
| PLN02237 | 442 | glyceraldehyde-3-phosphate dehydrogenase B | 100.0 | |
| PRK07403 | 337 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 100.0 | |
| PLN02358 | 338 | glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| PLN02272 | 421 | glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| PLN03096 | 395 | glyceraldehyde-3-phosphate dehydrogenase A; Provis | 100.0 | |
| PRK07729 | 343 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 100.0 | |
| TIGR01534 | 327 | GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, | 100.0 | |
| PTZ00353 | 342 | glycosomal glyceraldehyde-3-phosphate dehydrogenas | 100.0 | |
| PRK08955 | 334 | glyceraldehyde-3-phosphate dehydrogenase; Validate | 100.0 | |
| PRK13535 | 336 | erythrose 4-phosphate dehydrogenase; Provisional | 100.0 | |
| COG0057 | 335 | GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt | 100.0 | |
| PRK08289 | 477 | glyceraldehyde-3-phosphate dehydrogenase; Reviewed | 100.0 | |
| TIGR01532 | 325 | E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas | 100.0 | |
| KOG0657 | 285 | consensus Glyceraldehyde 3-phosphate dehydrogenase | 100.0 | |
| TIGR01546 | 333 | GAPDH-II_archae glyceraldehyde-3-phosphate dehydro | 100.0 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 100.0 | |
| PRK04207 | 341 | glyceraldehyde-3-phosphate dehydrogenase; Provisio | 100.0 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 100.0 | |
| TIGR01296 | 339 | asd_B aspartate-semialdehyde dehydrogenase (peptid | 100.0 | |
| COG0002 | 349 | ArgC Acetylglutamate semialdehyde dehydrogenase [A | 100.0 | |
| PRK05671 | 336 | aspartate-semialdehyde dehydrogenase; Reviewed | 100.0 | |
| PRK06728 | 347 | aspartate-semialdehyde dehydrogenase; Provisional | 100.0 | |
| PRK06598 | 369 | aspartate-semialdehyde dehydrogenase; Reviewed | 100.0 | |
| PRK06901 | 322 | aspartate-semialdehyde dehydrogenase; Provisional | 100.0 | |
| TIGR00978 | 341 | asd_EA aspartate-semialdehyde dehydrogenase (non-p | 100.0 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 100.0 | |
| PF00044 | 151 | Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, | 100.0 | |
| COG0136 | 334 | Asd Aspartate-semialdehyde dehydrogenase [Amino ac | 100.0 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 100.0 | |
| PRK08664 | 349 | aspartate-semialdehyde dehydrogenase; Reviewed | 100.0 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 100.0 | |
| TIGR01745 | 366 | asd_gamma aspartate-semialdehyde dehydrogenase, ga | 100.0 | |
| PRK11863 | 313 | N-acetyl-gamma-glutamyl-phosphate reductase; Provi | 100.0 | |
| TIGR01851 | 310 | argC_other N-acetyl-gamma-glutamyl-phosphate reduc | 100.0 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 100.0 | |
| smart00846 | 149 | Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, | 100.0 | |
| PF02800 | 157 | Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, | 100.0 | |
| KOG4354 | 340 | consensus N-acetyl-gamma-glutamyl-phosphate reduct | 99.92 | |
| KOG4777 | 361 | consensus Aspartate-semialdehyde dehydrogenase [Am | 99.85 | |
| PRK08300 | 302 | acetaldehyde dehydrogenase; Validated | 99.69 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 99.65 | |
| TIGR03215 | 285 | ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati | 99.52 | |
| PF02774 | 184 | Semialdhyde_dhC: Semialdehyde dehydrogenase, dimer | 99.27 | |
| TIGR01921 | 324 | DAP-DH diaminopimelate dehydrogenase. This model r | 99.16 | |
| smart00859 | 122 | Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin | 98.96 | |
| PRK13302 | 271 | putative L-aspartate dehydrogenase; Provisional | 98.72 | |
| PRK13303 | 265 | L-aspartate dehydrogenase; Provisional | 98.61 | |
| PRK13301 | 267 | putative L-aspartate dehydrogenase; Provisional | 98.46 | |
| TIGR00036 | 266 | dapB dihydrodipicolinate reductase. | 98.44 | |
| PF01408 | 120 | GFO_IDH_MocA: Oxidoreductase family, NAD-binding R | 98.43 | |
| COG4569 | 310 | MhpF Acetaldehyde dehydrogenase (acetylating) [Sec | 98.38 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 98.38 | |
| COG1712 | 255 | Predicted dinucleotide-utilizing enzyme [General f | 98.33 | |
| PRK11579 | 346 | putative oxidoreductase; Provisional | 98.32 | |
| PRK00048 | 257 | dihydrodipicolinate reductase; Provisional | 98.3 | |
| COG0289 | 266 | DapB Dihydrodipicolinate reductase [Amino acid tra | 98.29 | |
| PRK13304 | 265 | L-aspartate dehydrogenase; Reviewed | 98.24 | |
| PRK06270 | 341 | homoserine dehydrogenase; Provisional | 98.2 | |
| PRK10206 | 344 | putative oxidoreductase; Provisional | 98.04 | |
| COG0673 | 342 | MviM Predicted dehydrogenases and related proteins | 98.0 | |
| PRK06349 | 426 | homoserine dehydrogenase; Provisional | 97.86 | |
| KOG2741 | 351 | consensus Dimeric dihydrodiol dehydrogenase [Carbo | 97.71 | |
| PRK08374 | 336 | homoserine dehydrogenase; Provisional | 97.66 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 97.6 | |
| PF03447 | 117 | NAD_binding_3: Homoserine dehydrogenase, NAD bindi | 97.58 | |
| PLN02775 | 286 | Probable dihydrodipicolinate reductase | 97.57 | |
| PRK06392 | 326 | homoserine dehydrogenase; Provisional | 97.48 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 97.42 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 97.42 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 97.41 | |
| PRK06813 | 346 | homoserine dehydrogenase; Validated | 97.39 | |
| COG2344 | 211 | AT-rich DNA-binding protein [General function pred | 97.39 | |
| TIGR01761 | 343 | thiaz-red thiazolinyl imide reductase. This reduct | 97.18 | |
| PRK05472 | 213 | redox-sensing transcriptional repressor Rex; Provi | 97.16 | |
| TIGR02130 | 275 | dapB_plant dihydrodipicolinate reductase. This nar | 97.09 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 97.08 | |
| COG0460 | 333 | ThrA Homoserine dehydrogenase [Amino acid transpor | 97.05 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 97.0 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 96.96 | |
| PF02629 | 96 | CoA_binding: CoA binding domain; InterPro: IPR0037 | 96.83 | |
| COG4091 | 438 | Predicted homoserine dehydrogenase [Amino acid tra | 96.81 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 96.76 | |
| PRK05447 | 385 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P | 96.66 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.62 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 96.53 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 96.52 | |
| PRK08507 | 275 | prephenate dehydrogenase; Validated | 96.46 | |
| PLN02256 | 304 | arogenate dehydrogenase | 96.41 | |
| KOG4039 | 238 | consensus Serine/threonine kinase TIP30/CC3 [Signa | 96.37 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 96.3 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 96.27 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 96.24 | |
| PLN02700 | 377 | homoserine dehydrogenase family protein | 96.2 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 96.2 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 96.13 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 96.09 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 96.01 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 95.96 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 95.9 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 95.89 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 95.83 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 95.8 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 95.8 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 95.76 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 95.74 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 95.74 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 95.72 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 95.7 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 95.62 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 95.6 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 95.55 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 95.54 | |
| PLN02696 | 454 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | 95.46 | |
| PLN02712 | 667 | arogenate dehydrogenase | 95.45 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 95.44 | |
| PRK09436 | 819 | thrA bifunctional aspartokinase I/homoserine dehyd | 95.44 | |
| PLN02712 | 667 | arogenate dehydrogenase | 95.42 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 95.38 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 95.26 | |
| PTZ00431 | 260 | pyrroline carboxylate reductase; Provisional | 95.25 | |
| PRK06046 | 326 | alanine dehydrogenase; Validated | 95.24 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 95.2 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 95.19 | |
| COG3804 | 350 | Uncharacterized conserved protein related to dihyd | 95.18 | |
| PRK06928 | 277 | pyrroline-5-carboxylate reductase; Reviewed | 95.18 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 95.15 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 95.12 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 95.03 | |
| PF13380 | 116 | CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 | 94.94 | |
| PRK09466 | 810 | metL bifunctional aspartate kinase II/homoserine d | 94.9 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 94.84 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 94.84 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 94.73 | |
| TIGR02371 | 325 | ala_DH_arch alanine dehydrogenase, Archaeoglobus f | 94.67 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 94.54 | |
| COG0345 | 266 | ProC Pyrroline-5-carboxylate reductase [Amino acid | 94.47 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 94.43 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 94.43 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 94.39 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 94.38 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 94.35 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 94.19 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 94.15 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 94.05 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 94.01 | |
| PRK14806 | 735 | bifunctional cyclohexadienyl dehydrogenase/ 3-phos | 93.88 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AF | 93.85 | |
| PRK06249 | 313 | 2-dehydropantoate 2-reductase; Provisional | 93.83 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 93.71 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 93.7 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 93.54 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 93.54 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 93.51 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 93.51 | |
| TIGR03736 | 244 | PRTRC_ThiF PRTRC system ThiF family protein. A nov | 93.49 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 93.25 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 93.21 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 93.2 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 93.15 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 93.06 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 93.06 | |
| PF02670 | 129 | DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re | 93.02 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 93.0 | |
| PLN00016 | 378 | RNA-binding protein; Provisional | 92.82 | |
| COG0240 | 329 | GpsA Glycerol-3-phosphate dehydrogenase [Energy pr | 92.79 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 92.77 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 92.68 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 92.68 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 92.61 | |
| TIGR02717 | 447 | AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP | 92.54 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 92.53 | |
| PLN02602 | 350 | lactate dehydrogenase | 92.48 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 92.39 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 92.36 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 92.29 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 92.22 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 92.14 | |
| PRK12921 | 305 | 2-dehydropantoate 2-reductase; Provisional | 92.11 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 92.1 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 92.01 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 91.92 | |
| PTZ00345 | 365 | glycerol-3-phosphate dehydrogenase; Provisional | 91.89 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 91.88 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 91.82 | |
| PRK06522 | 304 | 2-dehydropantoate 2-reductase; Reviewed | 91.81 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 91.6 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 91.48 | |
| COG5322 | 351 | Predicted dehydrogenase [General function predicti | 91.42 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 91.34 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 91.26 | |
| KOG2711 | 372 | consensus Glycerol-3-phosphate dehydrogenase/dihyd | 91.1 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 91.01 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 90.96 | |
| PRK05678 | 291 | succinyl-CoA synthetase subunit alpha; Validated | 90.94 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 90.85 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 90.82 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 90.72 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 90.42 | |
| PRK12439 | 341 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 90.41 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 90.38 | |
| PRK05442 | 326 | malate dehydrogenase; Provisional | 90.36 | |
| PF01073 | 280 | 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso | 90.27 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 90.23 | |
| PLN02477 | 410 | glutamate dehydrogenase | 90.15 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 90.03 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 90.01 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 89.99 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 89.98 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 89.78 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 89.7 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 89.61 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 89.59 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 89.54 | |
| TIGR00243 | 389 | Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras | 89.51 | |
| cd01483 | 143 | E1_enzyme_family Superfamily of activating enzymes | 89.49 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 89.42 | |
| TIGR01019 | 286 | sucCoAalpha succinyl-CoA synthetase, alpha subunit | 89.36 | |
| PLN00106 | 323 | malate dehydrogenase | 89.32 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 89.32 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 89.29 | |
| PRK06199 | 379 | ornithine cyclodeaminase; Validated | 89.19 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 89.16 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 89.11 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 88.97 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 88.73 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 88.69 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 88.64 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 88.46 | |
| PRK06407 | 301 | ornithine cyclodeaminase; Provisional | 88.36 | |
| PLN02928 | 347 | oxidoreductase family protein | 88.29 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 88.1 | |
| KOG2380 | 480 | consensus Prephenate dehydrogenase (NADP+) [Amino | 88.06 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 87.92 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 87.79 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 87.77 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 87.77 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 87.74 | |
| PRK07236 | 386 | hypothetical protein; Provisional | 87.63 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 87.52 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 87.46 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 87.31 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 87.25 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 87.19 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 87.15 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 87.07 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 87.06 | |
| TIGR03376 | 342 | glycerol3P_DH glycerol-3-phosphate dehydrogenase ( | 87.01 | |
| PLN02494 | 477 | adenosylhomocysteinase | 86.89 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 86.67 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 86.56 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 86.34 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 86.21 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 86.1 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 86.05 | |
| cd01486 | 307 | Apg7 Apg7 is an E1-like protein, that activates tw | 86.03 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 86.02 | |
| COG0743 | 385 | Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras | 85.97 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 85.8 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 85.79 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 85.73 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 85.71 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 85.65 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 85.64 | |
| COG3268 | 382 | Uncharacterized conserved protein [Function unknow | 85.49 | |
| PRK06823 | 315 | ornithine cyclodeaminase; Validated | 85.47 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 85.02 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 84.99 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 84.77 | |
| PLN00112 | 444 | malate dehydrogenase (NADP); Provisional | 84.69 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 84.59 | |
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase | 84.35 | |
| KOG0024 | 354 | consensus Sorbitol dehydrogenase [Secondary metabo | 84.34 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 84.14 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 84.09 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 83.93 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 83.67 | |
| COG1893 | 307 | ApbA Ketopantoate reductase [Coenzyme metabolism] | 83.48 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 83.44 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 83.34 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 83.24 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 82.81 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 82.8 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 82.66 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 82.66 | |
| PF02423 | 313 | OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst | 82.61 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 82.51 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 82.32 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 82.02 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 81.97 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 81.97 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 81.96 | |
| TIGR01757 | 387 | Malate-DH_plant malate dehydrogenase, NADP-depende | 81.87 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 81.78 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 81.68 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 81.68 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 81.51 | |
| KOG1399 | 448 | consensus Flavin-containing monooxygenase [Seconda | 81.24 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 81.21 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 81.0 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 80.93 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 80.76 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 80.71 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 80.57 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 80.48 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 80.48 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 80.48 | |
| PRK07589 | 346 | ornithine cyclodeaminase; Validated | 80.42 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 80.06 |
| >PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.5e-78 Score=552.60 Aligned_cols=290 Identities=57% Similarity=0.942 Sum_probs=274.8
Q ss_pred CeeEEEEEecCHHHHHHHHHHHcC----CCcEEEEEecCCCChhhhhhcccccccCCCCcCcceee--------eCCcee
Q 022491 5 KKIKIGINGFGRIGRLVARVALQR----DDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNELKV--------KDEKTL 72 (296)
Q Consensus 5 m~i~vgI~G~G~iG~~l~r~l~~~----p~~elv~i~~~~~~~~~~a~~l~~~s~~~~~~~~~v~~--------~~~~~l 72 (296)
|++||||||||||||.++|++.+. +++|+|+|||+..++++++|+|+|||+||+|+ +.+.. +++ .|
T Consensus 2 m~ikVgINGFGRIGR~v~R~~~~~~~~~~~ievVAINd~~~~~~~~ayLlkyDS~hG~~~-~~v~~~~~~~~~~~~~-~l 79 (361)
T PTZ00434 2 APIKVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNAEYFAYQMKYDTVHGRPK-YTVETTKSSPSVKTDD-VL 79 (361)
T ss_pred CceEEEEECcChHHHHHHHHHHHcccCCCCeEEEEEeCCCCChhheeeeeeeecCCCCcC-CceeecccccccccCC-EE
Confidence 558999999999999999998764 68999999997678999999999999999999 77765 344 69
Q ss_pred EECCEEEEEE-ecCCCCCCCcccCCCcEEEEccCCccCHHHHHHHHHCCCCeEEeeCCCCC-CCeEEcccChhccCC-CC
Q 022491 73 LFGEKPVAVF-GFRNPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKD-APMFVVGVNEKEYKP-EL 149 (296)
Q Consensus 73 ~~~~~~i~~~-~~~d~~~i~~~~~~~DvV~~at~~~~~~~~~~~~l~~G~k~vvid~~~~d-~~~~v~gvn~~~l~~-~~ 149 (296)
.+||+.|.++ +++||++++|.+.++|+|+||||.|.+++.+..|+++|+|||+||+|++| .+++|||+|++.|++ ..
T Consensus 80 ~ing~~I~~~~~~~dP~~ipW~~~gvD~ViE~TG~f~t~~~a~~Hl~~GAKkViiSAP~~d~~~t~V~GVN~~~y~~~~~ 159 (361)
T PTZ00434 80 VVNGHRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTEH 159 (361)
T ss_pred EECCEEEEEEEecCChhhCchhhcCCCEEEeCceeeccHHHHhhhhhcCCCEEEECCCCCCCCceEEEcCChHHcCcccC
Confidence 9999999986 88899999999999999999999999999999999999999999999886 679999999999985 47
Q ss_pred CeEEcCCcchhhhHhHHHHH-HhhcCeeEEEEEEEeecCCcccccCCCCCccccCcccccceeeeccCChhhHHHHhccc
Q 022491 150 DIVSNASCTTNCLAPLAKVI-HDKFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPA 228 (296)
Q Consensus 150 ~iIs~p~C~~tal~~~l~~L-~~~~gi~~~~~~~v~a~sg~~~~~d~~~~~~~~~~r~~~~ni~P~~~g~~~~~~~~~pe 228 (296)
++|||+||||+||+|+++.| +++|||++++|||+|++|++|+++|+++++|||++|++++||||+.+|+++++.+++|+
T Consensus 160 ~IiSnASCTTNcLAP~~kvL~~~~fGI~~g~mTTVHayT~~Q~~~D~~~~kD~Rr~Raaa~nIIPtsTGAAkAv~~VlP~ 239 (361)
T PTZ00434 160 HVVSNASCTTNCLAPIVHVLTKEGFGIETGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPS 239 (361)
T ss_pred cEEECCChHHHhhHHHHHHhhcCCcceEEEEEEEEecccCCcccccCcCcccccccccccccCccCCcchhhhhceeccc
Confidence 89999999999999999999 79999999999999999999999999966799999999999999999999999999999
Q ss_pred cCCceeEEEEEeeeCceEEEEEEEEeecCCCHHHHHHHHHHhhcCcCCCcccccCCceeeecCCCCCC
Q 022491 229 LNGKLTGMSFRVPTVDVSVVDLTVRLEKEATYEEIKNAIKEESEGKLKGILGYTEEDVVSTDFVGDSR 296 (296)
Q Consensus 229 l~~~v~~~~~~VP~~~g~~~~~~~~l~~~~~~~ev~~~~~~~~~~~~~~~~~~~~~~~vs~d~~~~~~ 296 (296)
|+|+++++++|||+.+|++++++++++++++.|||+++|+++++++|||||+|+|+|+||+||+|+||
T Consensus 240 L~GKl~G~a~RVPt~nvS~vDLt~~l~k~~t~eein~a~k~aa~~~lkgIl~y~~~plVS~Df~g~~~ 307 (361)
T PTZ00434 240 TKGKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDAAIKRASQTYMKGILGFTDDELVSADFINDNR 307 (361)
T ss_pred cCCceeeEEEecccCcEeEEEEEEEeCCCCCHHHHHHHHHHhhhccccCcccccCCCccccccCCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999996
|
|
| >PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02237 glyceraldehyde-3-phosphate dehydrogenase B | Back alignment and domain information |
|---|
| >PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN02358 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02272 glyceraldehyde-3-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional | Back alignment and domain information |
|---|
| >PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I | Back alignment and domain information |
|---|
| >PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK13535 erythrose 4-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase | Back alignment and domain information |
|---|
| >KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) | Back alignment and domain information |
|---|
| >COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06728 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06901 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial | Back alignment and domain information |
|---|
| >PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate | Back alignment and domain information |
|---|
| >KOG4354 consensus N-acetyl-gamma-glutamyl-phosphate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08300 acetaldehyde dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) | Back alignment and domain information |
|---|
| >PF02774 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimerisation domain; InterPro: IPR012280 This domain contains N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >TIGR01921 DAP-DH diaminopimelate dehydrogenase | Back alignment and domain information |
|---|
| >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >PRK13302 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13303 L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13301 putative L-aspartate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00036 dapB dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot | Back alignment and domain information |
|---|
| >COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11579 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK00048 dihydrodipicolinate reductase; Provisional | Back alignment and domain information |
|---|
| >COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13304 L-aspartate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK06270 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10206 putative oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06349 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK08374 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway | Back alignment and domain information |
|---|
| >PLN02775 Probable dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >PRK06392 homoserine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06813 homoserine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG2344 AT-rich DNA-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01761 thiaz-red thiazolinyl imide reductase | Back alignment and domain information |
|---|
| >PRK05472 redox-sensing transcriptional repressor Rex; Provisional | Back alignment and domain information |
|---|
| >TIGR02130 dapB_plant dihydrodipicolinate reductase | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases | Back alignment and domain information |
|---|
| >COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08507 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >PLN02700 homoserine dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00431 pyrroline carboxylate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06046 alanine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] | Back alignment and domain information |
|---|
| >PRK06928 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A | Back alignment and domain information |
|---|
| >PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >COG0345 ProC Pyrroline-5-carboxylate reductase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family | Back alignment and domain information |
|---|
| >PRK06249 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PLN00016 RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12921 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06522 2-dehydropantoate 2-reductase; Reviewed | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >COG5322 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG2711 consensus Glycerol-3-phosphate dehydrogenase/dihydroxyacetone 3-phosphate reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK05678 succinyl-CoA synthetase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK12439 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >PRK05442 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase | Back alignment and domain information |
|---|
| >cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06199 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06407 ornithine cyclodeaminase; Provisional | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >KOG2380 consensus Prephenate dehydrogenase (NADP+) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07236 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >cd01486 Apg7 Apg7 is an E1-like protein, that activates two different ubiquitin-like proteins, Apg12 and Apg8, and assigns them to specific E2 enzymes, Apg10 and Apg3, respectively | Back alignment and domain information |
|---|
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >COG3268 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK06823 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >PLN00112 malate dehydrogenase (NADP); Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG1399 consensus Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PRK07589 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 296 | ||||
| 3e5r_O | 337 | Crystal Structure And Functional Analysis Of Glycer | 1e-140 | ||
| 3e6a_O | 336 | Crystal Structure And Functional Analysis Of Glycer | 1e-140 | ||
| 1ihx_A | 333 | Crystal Structure Of Two D-Glyceraldehyde-3-Phospha | 1e-107 | ||
| 1gpd_G | 334 | Studies Of Asymmetry In The Three-Dimensional Struc | 1e-107 | ||
| 4gpd_1 | 333 | The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho | 1e-107 | ||
| 1szj_G | 333 | Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr | 1e-107 | ||
| 4iq8_A | 340 | Crystal Structure Of Glyceraldehyde-3-phosphate Deh | 1e-106 | ||
| 3pym_A | 332 | Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res | 1e-106 | ||
| 1u8f_O | 335 | Crystal Structure Of Human Placental Glyceraldehyde | 1e-106 | ||
| 1znq_O | 338 | Crsytal Structure Of Human Liver Gapdh Length = 338 | 1e-106 | ||
| 2i5p_O | 342 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 1e-106 | ||
| 1dss_G | 333 | Structure Of Active-Site Carboxymethylated D-Glycer | 1e-105 | ||
| 3gpd_R | 334 | Twinning In Crystals Of Human Skeletal Muscle D-Gly | 1e-103 | ||
| 1j0x_O | 332 | Crystal Structure Of The Rabbit Muscle Glyceraldehy | 1e-103 | ||
| 2vyn_D | 334 | Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet | 1e-98 | ||
| 3h9e_B | 346 | Crystal Structure Of Human Sperm-Specific Glycerald | 1e-98 | ||
| 1vsu_A | 359 | Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate | 1e-98 | ||
| 3cps_A | 354 | Crystal Structure Of Cryptosporidium Parvum Glycera | 1e-98 | ||
| 1s7c_A | 331 | Crystal Structure Of Mes Buffer Bound Form Of Glyce | 5e-98 | ||
| 1gad_O | 330 | Comparison Of The Structures Of Wild Type And A N31 | 5e-98 | ||
| 1gae_O | 330 | Comparison Of The Structures Of Wild Type And A N31 | 6e-98 | ||
| 3cif_A | 359 | Crystal Structure Of C153s Mutant Glyceraldehyde 3- | 2e-97 | ||
| 2vyn_A | 331 | Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet | 9e-97 | ||
| 1ywg_O | 337 | The Structure Of Glyceraldehyde-3-Phosphate Dehydro | 7e-94 | ||
| 2b4r_O | 345 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 1e-93 | ||
| 3sth_A | 361 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 2e-92 | ||
| 1dc4_A | 330 | Structural Analysis Of Glyceraldehyde 3-Phosphate D | 4e-88 | ||
| 2x0n_A | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 2e-83 | ||
| 1k3t_A | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 9e-82 | ||
| 3dmt_C | 359 | Structure Of Glycosomal Glyceraldehyde-3-Phosphate | 2e-80 | ||
| 1a7k_A | 360 | Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase | 7e-80 | ||
| 1gyp_A | 358 | Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph | 7e-80 | ||
| 1gd1_O | 334 | Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr | 1e-74 | ||
| 3dbv_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 4e-74 | ||
| 1dbv_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 8e-74 | ||
| 1npt_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 1e-73 | ||
| 1nq5_O | 334 | Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit | 2e-73 | ||
| 1hdg_O | 332 | The Crystal Structure Of Holo-glyceraldehyde-3-phos | 5e-71 | ||
| 3doc_A | 335 | Crystal Structure Of Trka Glyceraldehyde-3-Phosphat | 3e-67 | ||
| 3hja_A | 356 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 2e-64 | ||
| 2ep7_A | 342 | Structural Study Of Project Id Aq_1065 From Aquifex | 2e-64 | ||
| 3l0d_A | 356 | Crystal Structure Of Glyceraldehyde-3-phosphate Deh | 1e-63 | ||
| 4dib_A | 345 | The Crystal Structure Of Glyceraldehyde-3-Phosphate | 4e-60 | ||
| 2pkq_O | 368 | Crystal Structure Of The Photosynthetic A2b2-Glycer | 1e-59 | ||
| 3gnq_A | 344 | Crystal Structure Of Glyceraldehyde-3-Phosphate Deh | 2e-58 | ||
| 1vc2_A | 331 | Crystal Structure Of Glyceraldehyde 3-Phosphate Deh | 6e-58 | ||
| 1cer_O | 331 | Determinants Of Enzyme Thermostability Observed In | 1e-57 | ||
| 1rm3_O | 337 | Crystal Structure Of Mutant T33a Of Photosynthetic | 2e-57 | ||
| 1nbo_O | 337 | The Dual Coenzyme Specificity Of Photosynthetic Gly | 2e-57 | ||
| 2pkr_O | 365 | Crystal Structure Of (A+cte)4 Chimeric Form Of Phot | 3e-57 | ||
| 1rm5_O | 337 | Crystal Structure Of Mutant S188a Of Photosynthetic | 5e-57 | ||
| 1jn0_O | 335 | Crystal Structure Of The Non-Regulatory A4 Isoform | 1e-56 | ||
| 2g82_O | 331 | High Resolution Structures Of Thermus Aquaticus Gly | 3e-56 | ||
| 3vaz_P | 344 | Crystal Structure Of Staphylococcal Gapdh1 In A Hex | 2e-55 | ||
| 3lvf_P | 338 | Crystal Structure Of Holo Glyceraldehyde-3-Phosphat | 2e-55 | ||
| 3lc7_O | 339 | Crystal Structure Of Apo Glyceraldehyde-3-Phosphate | 4e-55 | ||
| 3k73_Q | 336 | Crystal Structure Of Phosphate Bound Holo Glycerald | 6e-55 | ||
| 3lc1_P | 336 | Crystal Structure Of H178n Mutant Of Glyceraldehyde | 4e-54 | ||
| 1obf_O | 335 | The Crystal Structure Of Glyceraldehyde 3-Phosphate | 6e-54 | ||
| 3hq4_R | 336 | Crystal Structure Of C151s Mutant Of Glyceraldehyde | 8e-54 | ||
| 2d2i_A | 380 | Crystal Structure Of Nadp-Dependent Glyceraldehyde- | 1e-53 | ||
| 3b1j_A | 339 | Crystal Structure Of Dehydrogenese Length = 339 | 1e-53 | ||
| 3k9q_Q | 336 | Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde | 1e-53 | ||
| 3ksd_Q | 336 | Crystal Structure Of C151s+h178n Mutant Of Glyceral | 6e-53 | ||
| 3k2b_A | 337 | Crystal Structure Of Photosynthetic A4 Isoform Glyc | 4e-52 | ||
| 2x5j_O | 339 | Crystal Structure Of The Apoform Of The D-Erythrose | 5e-46 | ||
| 2xf8_A | 338 | Structure Of The D-Erythrose-4-Phosphate Dehydrogen | 5e-46 | ||
| 2x5k_O | 339 | Structure Of An Active Site Mutant Of The D-Erythro | 2e-43 |
| >pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 | Back alignment and structure |
|
| >pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 | Back alignment and structure |
| >pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 | Back alignment and structure |
| >pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 | Back alignment and structure |
| >pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 | Back alignment and structure |
| >pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 | Back alignment and structure |
| >pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 | Back alignment and structure |
| >pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 | Back alignment and structure |
| >pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 | Back alignment and structure |
| >pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 | Back alignment and structure |
| >pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 | Back alignment and structure |
| >pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 | Back alignment and structure |
| >pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 | Back alignment and structure |
| >pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 | Back alignment and structure |
| >pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 | Back alignment and structure |
| >pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 | Back alignment and structure |
| >pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 | Back alignment and structure |
| >pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 | Back alignment and structure |
| >pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 | Back alignment and structure |
| >pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 | Back alignment and structure |
| >pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 | Back alignment and structure |
| >pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 | Back alignment and structure |
| >pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 | Back alignment and structure |
| >pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 | Back alignment and structure |
| >pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 | Back alignment and structure |
| >pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 | Back alignment and structure |
| >pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 | Back alignment and structure |
| >pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 | Back alignment and structure |
| >pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 | Back alignment and structure |
| >pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 | Back alignment and structure |
| >pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 | Back alignment and structure |
| >pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 | Back alignment and structure |
| >pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 | Back alignment and structure |
| >pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 | Back alignment and structure |
| >pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 | Back alignment and structure |
| >pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 | Back alignment and structure |
| >pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 | Back alignment and structure |
| >pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 | Back alignment and structure |
| >pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 | Back alignment and structure |
| >pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 | Back alignment and structure |
| >pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 | Back alignment and structure |
| >pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 | Back alignment and structure |
| >pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 | Back alignment and structure |
| >pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 | Back alignment and structure |
| >pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 | Back alignment and structure |
| >pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 | Back alignment and structure |
| >pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 | Back alignment and structure |
| >pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 | Back alignment and structure |
| >pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 | Back alignment and structure |
| >pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 | Back alignment and structure |
| >pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 | Back alignment and structure |
| >pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 | Back alignment and structure |
| >pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 | Back alignment and structure |
| >pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 | Back alignment and structure |
| >pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 | Back alignment and structure |
| >pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 | Back alignment and structure |
| >pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 | Back alignment and structure |
| >pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 | Back alignment and structure |
| >pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 | Back alignment and structure |
| >pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 | Back alignment and structure |
| >pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 296 | |||
| 3e5r_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 0.0 | |
| 3pym_A | 332 | GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase | 0.0 | |
| 3h9e_O | 346 | Glyceraldehyde-3-phosphate dehydrogenase, testis-; | 0.0 | |
| 3cps_A | 354 | Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g | 0.0 | |
| 2b4r_O | 345 | Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st | 0.0 | |
| 1gad_O | 330 | D-glyceraldehyde-3-phosphate dehydrogenase; oxidor | 0.0 | |
| 1u8f_O | 335 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l | 0.0 | |
| 3ids_C | 359 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g | 0.0 | |
| 3cmc_O | 334 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m | 0.0 | |
| 1rm4_O | 337 | Glyceraldehyde 3-phosphate dehydrogenase A; rossma | 1e-177 | |
| 3lvf_P | 338 | GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase | 1e-177 | |
| 4dib_A | 345 | GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n | 1e-176 | |
| 2g82_O | 331 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G | 1e-175 | |
| 2ep7_A | 342 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o | 1e-175 | |
| 2d2i_A | 380 | Glyceraldehyde 3-phosphate dehydrogenase; rossmann | 1e-172 | |
| 3b1j_A | 339 | Glyceraldehyde 3-phosphate dehydrogenase (NADP+); | 1e-171 | |
| 3hja_A | 356 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n | 1e-171 | |
| 1hdg_O | 332 | Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o | 1e-168 | |
| 3doc_A | 335 | Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, | 1e-160 | |
| 2x5j_O | 339 | E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid | 1e-154 | |
| 1obf_O | 335 | Glyceraldehyde 3-phosphate dehydrogenase; glycolyt | 1e-153 | |
| 1cf2_P | 337 | Protein (glyceraldehyde-3-phosphate dehydrogenase) | 1e-116 | |
| 2yyy_A | 343 | Glyceraldehyde-3-phosphate dehydrogenase; glyceral | 1e-112 | |
| 2czc_A | 334 | Glyceraldehyde-3-phosphate dehydrogenase; glycolys | 1e-107 | |
| 1b7g_O | 340 | Protein (glyceraldehyde 3-phosphate dehydrogenase; | 1e-69 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 2e-08 | |
| 1f06_A | 320 | MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH | 3e-07 | |
| 2ep5_A | 350 | 350AA long hypothetical aspartate-semialdehyde deh | 3e-06 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 1e-05 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 3e-05 | |
| 1lc0_A | 294 | Biliverdin reductase A; oxidoreductase, tetrapyrro | 6e-05 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 7e-05 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 7e-05 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 8e-05 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 1e-04 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 1e-04 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 2e-04 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 2e-04 | |
| 2ixa_A | 444 | Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver | 3e-04 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 4e-04 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 5e-04 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 6e-04 | |
| 3moi_A | 387 | Probable dehydrogenase; structural genomics, PSI2, | 6e-04 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 7e-04 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 8e-04 |
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 | Back alignment and structure |
|---|
Score = 606 bits (1564), Expect = 0.0
Identities = 253/296 (85%), Positives = 274/296 (92%), Gaps = 3/296 (1%)
Query: 1 MAGDKKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWK 60
M KIKIGINGFGRIGRLVARVALQ +DVELVAVNDPFI+TDYMTYMFKYD+VHGQWK
Sbjct: 1 MG---KIKIGINGFGRIGRLVARVALQSEDVELVAVNDPFITTDYMTYMFKYDTVHGQWK 57
Query: 61 HNELKVKDEKTLLFGEKPVAVFGFRNPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGG 120
H+++K+KD KTLL GEKPV VFG RNP+EIPWA+ GAEYVVESTGVFTDK+KAAAHLKGG
Sbjct: 58 HSDIKIKDSKTLLLGEKPVTVFGIRNPDEIPWAEAGAEYVVESTGVFTDKEKAAAHLKGG 117
Query: 121 AKKVVISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLAPLAKVIHDKFGIVEGLM 180
AKKVVISAPSKDAPMFV GVNE +Y ++DIVSNASCTTNCLAPLAKVIHD FGI+EGLM
Sbjct: 118 AKKVVISAPSKDAPMFVCGVNEDKYTSDIDIVSNASCTTNCLAPLAKVIHDNFGIIEGLM 177
Query: 181 TTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRV 240
TTVH+ITATQKTVDGPS KDWRGGRAASFNIIPSSTGAAKAVGKVLP LNGKLTGMSFRV
Sbjct: 178 TTVHAITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPDLNGKLTGMSFRV 237
Query: 241 PTVDVSVVDLTVRLEKEATYEEIKNAIKEESEGKLKGILGYTEEDVVSTDFVGDSR 296
PTVDVSVVDLTVR+EK A+Y+ IK+AIK SEGKLKGI+GY EED+VSTDFVGDSR
Sbjct: 238 PTVDVSVVDLTVRIEKAASYDAIKSAIKSASEGKLKGIIGYVEEDLVSTDFVGDSR 293
|
| >3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 | Back alignment and structure |
|---|
| >2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 | Back alignment and structure |
|---|
| >3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 | Back alignment and structure |
|---|
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 | Back alignment and structure |
|---|
| >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 | Back alignment and structure |
|---|
| >4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 | Back alignment and structure |
|---|
| >2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 | Back alignment and structure |
|---|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 | Back alignment and structure |
|---|
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 | Back alignment and structure |
|---|
| >3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Length = 304 | Back alignment and structure |
|---|
| >1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Length = 320 | Back alignment and structure |
|---|
| >2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Length = 350 | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Length = 315 | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Length = 346 | Back alignment and structure |
|---|
| >1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Length = 294 | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Length = 308 | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Length = 344 | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Length = 273 | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Length = 319 | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Length = 354 | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Length = 288 | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Length = 357 | Back alignment and structure |
|---|
| >2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Length = 444 | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Length = 344 | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Length = 354 | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Length = 243 | Back alignment and structure |
|---|
| >3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Length = 387 | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Length = 236 | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Length = 272 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| 3pym_A | 332 | GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| 3v1y_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 100.0 | |
| 3doc_A | 335 | Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, | 100.0 | |
| 3ids_C | 359 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g | 100.0 | |
| 4dib_A | 345 | GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n | 100.0 | |
| 3h9e_O | 346 | Glyceraldehyde-3-phosphate dehydrogenase, testis-; | 100.0 | |
| 3lvf_P | 338 | GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase | 100.0 | |
| 3hja_A | 356 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n | 100.0 | |
| 2b4r_O | 345 | Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st | 100.0 | |
| 1obf_O | 335 | Glyceraldehyde 3-phosphate dehydrogenase; glycolyt | 100.0 | |
| 2ep7_A | 342 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o | 100.0 | |
| 3cmc_O | 334 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m | 100.0 | |
| 1gad_O | 330 | D-glyceraldehyde-3-phosphate dehydrogenase; oxidor | 100.0 | |
| 2d2i_A | 380 | Glyceraldehyde 3-phosphate dehydrogenase; rossmann | 100.0 | |
| 3cps_A | 354 | Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g | 100.0 | |
| 1hdg_O | 332 | Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o | 100.0 | |
| 3e5r_O | 337 | PP38, glyceraldehyde-3-phosphate dehydrogenase, cy | 100.0 | |
| 3b1j_A | 339 | Glyceraldehyde 3-phosphate dehydrogenase (NADP+); | 100.0 | |
| 1rm4_O | 337 | Glyceraldehyde 3-phosphate dehydrogenase A; rossma | 100.0 | |
| 2g82_O | 331 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G | 100.0 | |
| 1u8f_O | 335 | GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l | 100.0 | |
| 2x5j_O | 339 | E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid | 100.0 | |
| 2yyy_A | 343 | Glyceraldehyde-3-phosphate dehydrogenase; glyceral | 100.0 | |
| 2r00_A | 336 | Aspartate-semialdehyde dehydrogenase; conformation | 100.0 | |
| 1cf2_P | 337 | Protein (glyceraldehyde-3-phosphate dehydrogenase) | 100.0 | |
| 2yv3_A | 331 | Aspartate-semialdehyde dehydrogenase; aspartate pa | 100.0 | |
| 4dpk_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 100.0 | |
| 4dpl_A | 359 | Malonyl-COA/succinyl-COA reductase; dinucleotide b | 100.0 | |
| 2hjs_A | 340 | USG-1 protein homolog; aspartate-semialdehyde dehy | 100.0 | |
| 1xyg_A | 359 | Putative N-acetyl-gamma-glutamyl-phosphate reduct; | 100.0 | |
| 2ep5_A | 350 | 350AA long hypothetical aspartate-semialdehyde deh | 100.0 | |
| 2ozp_A | 345 | N-acetyl-gamma-glutamyl-phosphate reductase; amino | 100.0 | |
| 3hsk_A | 381 | Aspartate-semialdehyde dehydrogenase; candida albi | 100.0 | |
| 1ys4_A | 354 | Aspartate-semialdehyde dehydrogenase; oxidoreducta | 100.0 | |
| 1t4b_A | 367 | Aspartate-semialdehyde dehydrogenase; asadh, HOSR, | 100.0 | |
| 3dr3_A | 337 | N-acetyl-gamma-glutamyl-phosphate reductase; csgid | 100.0 | |
| 3pwk_A | 366 | Aspartate-semialdehyde dehydrogenase; NADP binding | 100.0 | |
| 1b7g_O | 340 | Protein (glyceraldehyde 3-phosphate dehydrogenase; | 100.0 | |
| 3tz6_A | 344 | Aspartate-semialdehyde dehydrogenase; asadh, ASD, | 100.0 | |
| 3pzr_A | 370 | Aspartate-semialdehyde dehydrogenase; NADP, oxidor | 100.0 | |
| 3uw3_A | 377 | Aspartate-semialdehyde dehydrogenase; structural g | 100.0 | |
| 2czc_A | 334 | Glyceraldehyde-3-phosphate dehydrogenase; glycolys | 100.0 | |
| 2nqt_A | 352 | N-acetyl-gamma-glutamyl-phosphate reductase; apopr | 100.0 | |
| 1vkn_A | 351 | N-acetyl-gamma-glutamyl-phosphate reductase; TM178 | 100.0 | |
| 1nvm_B | 312 | Acetaldehyde dehydrogenase (acylating), 4-hydroxy- | 99.37 | |
| 3bio_A | 304 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 98.73 | |
| 3gdo_A | 358 | Uncharacterized oxidoreductase YVAA; structural ge | 98.66 | |
| 3i23_A | 349 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 98.64 | |
| 3ezy_A | 344 | Dehydrogenase; structural genomics, unknown functi | 98.64 | |
| 4had_A | 350 | Probable oxidoreductase protein; structural genomi | 98.63 | |
| 4hkt_A | 331 | Inositol 2-dehydrogenase; structural genomics, nys | 98.6 | |
| 4fb5_A | 393 | Probable oxidoreductase protein; PSI-biology, nysg | 98.6 | |
| 3e9m_A | 330 | Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, | 98.59 | |
| 3e82_A | 364 | Putative oxidoreductase; NAD, GFO/IDH/MOCA family, | 98.58 | |
| 3ijp_A | 288 | DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, | 98.58 | |
| 3kux_A | 352 | Putative oxidoreductase; oxidoreductase family, cs | 98.58 | |
| 3ohs_X | 334 | Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d | 98.57 | |
| 3fhl_A | 362 | Putative oxidoreductase; NAD-binding domain, PSI-2 | 98.56 | |
| 3mz0_A | 344 | Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; | 98.56 | |
| 3ec7_A | 357 | Putative dehydrogenase; alpha-beta, structural gen | 98.55 | |
| 3euw_A | 344 | MYO-inositol dehydrogenase; protein structure init | 98.55 | |
| 3evn_A | 329 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 98.53 | |
| 3e18_A | 359 | Oxidoreductase; dehydrogenase, NAD-binding, struct | 98.53 | |
| 4f3y_A | 272 | DHPR, dihydrodipicolinate reductase; structural ge | 98.52 | |
| 3f4l_A | 345 | Putative oxidoreductase YHHX; structural genomics, | 98.5 | |
| 3q2i_A | 354 | Dehydrogenase; rossmann fold, UDP-sugar binding, N | 98.48 | |
| 1f06_A | 320 | MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH | 98.48 | |
| 3db2_A | 354 | Putative NADPH-dependent oxidoreductase; two domai | 98.48 | |
| 3cea_A | 346 | MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore | 98.47 | |
| 3m2t_A | 359 | Probable dehydrogenase; PSI, SGXNY, structural gen | 98.45 | |
| 4h3v_A | 390 | Oxidoreductase domain protein; structural genomics | 98.45 | |
| 3rc1_A | 350 | Sugar 3-ketoreductase; sugar biosynthesis, TDP bin | 98.42 | |
| 3uuw_A | 308 | Putative oxidoreductase with NAD(P)-binding rossm | 98.39 | |
| 4gqa_A | 412 | NAD binding oxidoreductase; structural genomics, P | 98.39 | |
| 4ew6_A | 330 | D-galactose-1-dehydrogenase protein; nysgrc, PSI-b | 98.39 | |
| 1tlt_A | 319 | Putative oxidoreductase (virulence factor MVIM HO; | 98.36 | |
| 3moi_A | 387 | Probable dehydrogenase; structural genomics, PSI2, | 98.34 | |
| 1dih_A | 273 | Dihydrodipicolinate reductase; oxidoreductase; HET | 98.31 | |
| 1lc0_A | 294 | Biliverdin reductase A; oxidoreductase, tetrapyrro | 98.31 | |
| 2ho3_A | 325 | Oxidoreductase, GFO/IDH/MOCA family; streptococcus | 98.31 | |
| 1zh8_A | 340 | Oxidoreductase; TM0312, structural genomics, JO ce | 98.29 | |
| 1h6d_A | 433 | Precursor form of glucose-fructose oxidoreductase; | 98.29 | |
| 3c1a_A | 315 | Putative oxidoreductase; ZP_00056571.1, oxidoreduc | 98.28 | |
| 3qy9_A | 243 | DHPR, dihydrodipicolinate reductase; rossmann fold | 98.27 | |
| 1ydw_A | 362 | AX110P-like protein; structural genomics, protein | 98.26 | |
| 3btv_A | 438 | Galactose/lactose metabolism regulatory protein GA | 98.24 | |
| 2ixa_A | 444 | Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver | 98.21 | |
| 1xea_A | 323 | Oxidoreductase, GFO/IDH/MOCA family; structural ge | 98.21 | |
| 3ing_A | 325 | Homoserine dehydrogenase; NP_394635.1, structural | 98.19 | |
| 3mtj_A | 444 | Homoserine dehydrogenase; rossmann-fold, PSI, MCSG | 98.19 | |
| 3o9z_A | 312 | Lipopolysaccaride biosynthesis protein WBPB; oxido | 98.19 | |
| 2ejw_A | 332 | HDH, homoserine dehydrogenase; NAD-dependent, oxid | 98.18 | |
| 3ip3_A | 337 | Oxidoreductase, putative; structural genomics, PSI | 98.18 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 98.17 | |
| 3do5_A | 327 | HOM, homoserine dehydrogenase; NP_069768.1, putati | 98.17 | |
| 2nvw_A | 479 | Galactose/lactose metabolism regulatory protein GA | 98.16 | |
| 3oa2_A | 318 | WBPB; oxidoreductase, sugar biosynthesis, dehydrog | 98.11 | |
| 3u3x_A | 361 | Oxidoreductase; structural genomics, PSI-biology, | 98.11 | |
| 3v5n_A | 417 | Oxidoreductase; structural genomics, PSI-biology, | 98.11 | |
| 3upl_A | 446 | Oxidoreductase; rossmann fold, NADPH binding; 1.50 | 98.09 | |
| 3c8m_A | 331 | Homoserine dehydrogenase; structural genomics, APC | 98.08 | |
| 2p2s_A | 336 | Putative oxidoreductase; YP_050235.1, structural g | 98.05 | |
| 1p9l_A | 245 | Dihydrodipicolinate reductase; oxidoreductase, lys | 97.99 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 97.97 | |
| 3dty_A | 398 | Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram | 97.97 | |
| 4gmf_A | 372 | Yersiniabactin biosynthetic protein YBTU; rossmann | 97.96 | |
| 2glx_A | 332 | 1,5-anhydro-D-fructose reductase; NADP(H) dependen | 97.95 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 97.87 | |
| 2dt5_A | 211 | AT-rich DNA-binding protein; REX, NADH, NAD, rossm | 97.86 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 97.76 | |
| 2vt3_A | 215 | REX, redox-sensing transcriptional repressor REX; | 97.76 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 97.74 | |
| 3oqb_A | 383 | Oxidoreductase; structural genomics, protein struc | 97.72 | |
| 1j5p_A | 253 | Aspartate dehydrogenase; TM1643, structural genomi | 97.71 | |
| 1ebf_A | 358 | Homoserine dehydrogenase; dinucleotide, NAD, dimer | 97.69 | |
| 3keo_A | 212 | Redox-sensing transcriptional repressor REX; DNA b | 97.61 | |
| 2i76_A | 276 | Hypothetical protein; NADP, dehydrogenase, TM1727, | 97.56 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 97.38 | |
| 2nu8_A | 288 | Succinyl-COA ligase [ADP-forming] subunit alpha; c | 97.33 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 97.16 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 97.14 | |
| 1r0k_A | 388 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N | 97.13 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 97.1 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 97.07 | |
| 1vm6_A | 228 | DHPR, dihydrodipicolinate reductase; TM1520, struc | 96.95 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 96.86 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 96.84 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 96.79 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 96.79 | |
| 2duw_A | 145 | Putative COA-binding protein; ligand binding prote | 96.79 | |
| 2d59_A | 144 | Hypothetical protein PH1109; COA binding, structur | 96.76 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 96.68 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 96.66 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 96.63 | |
| 1oi7_A | 288 | Succinyl-COA synthetase alpha chain; SCS, ligase, | 96.62 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 96.54 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 96.44 | |
| 3nkl_A | 141 | UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo | 96.43 | |
| 2yv1_A | 294 | Succinyl-COA ligase [ADP-forming] subunit alpha; C | 96.42 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 96.4 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 96.39 | |
| 3ff4_A | 122 | Uncharacterized protein; structural genomics, PSI- | 96.37 | |
| 1iuk_A | 140 | Hypothetical protein TT1466; structural genomics, | 96.36 | |
| 2yv2_A | 297 | Succinyl-COA synthetase alpha chain; COA-binding d | 96.36 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 96.35 | |
| 3a06_A | 376 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M | 96.34 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 96.33 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 96.18 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 96.17 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 96.17 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 96.16 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 96.15 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 96.14 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 96.14 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 96.11 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 96.09 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 96.09 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 96.08 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 96.07 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 96.06 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 96.02 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 95.98 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 95.97 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 95.95 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 95.93 | |
| 3c7a_A | 404 | Octopine dehydrogenase; L) stereospecific opine de | 95.92 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 95.87 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 95.83 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 95.81 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 95.8 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 95.79 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 95.78 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 95.74 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 95.69 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 95.68 | |
| 3ego_A | 307 | Probable 2-dehydropantoate 2-reductase; structural | 95.63 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 95.6 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 95.56 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 95.53 | |
| 2ph5_A | 480 | Homospermidine synthase; alpha-beta protein, struc | 95.53 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 95.53 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 95.53 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 95.52 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 95.49 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 95.46 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 95.43 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 95.42 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 95.37 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 95.36 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 95.36 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 95.32 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 95.3 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 95.25 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 95.24 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 95.24 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 95.22 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 95.22 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 95.17 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 95.12 | |
| 3hn2_A | 312 | 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str | 95.1 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 95.08 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 95.07 | |
| 3ktd_A | 341 | Prephenate dehydrogenase; structural genomics, joi | 94.99 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 94.95 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 94.92 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 94.92 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 94.91 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 94.89 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 94.89 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 94.86 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 94.83 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 94.81 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 94.79 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 94.71 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 94.62 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 94.6 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 94.54 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 94.54 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 94.52 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 94.5 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 94.41 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 94.41 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 94.39 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 94.39 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 94.34 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 94.33 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 94.31 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 94.24 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 94.23 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 94.18 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 94.15 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 94.15 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 94.12 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 94.11 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 94.06 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 94.05 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 93.98 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 93.94 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 93.9 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 93.81 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 93.78 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 93.78 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 93.74 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 93.7 | |
| 3dfu_A | 232 | Uncharacterized protein from 6-phosphogluconate de | 93.69 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.69 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 93.65 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 93.64 | |
| 3g17_A | 294 | Similar to 2-dehydropantoate 2-reductase; structur | 93.63 | |
| 2fp4_A | 305 | Succinyl-COA ligase [GDP-forming] alpha-chain, mit | 93.6 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 93.6 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 93.54 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 93.54 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 93.54 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 93.54 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 93.42 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 93.39 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 93.35 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 93.33 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 93.27 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 93.24 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 93.16 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 93.13 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 92.97 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 92.96 | |
| 2csu_A | 457 | 457AA long hypothetical protein; structural genomi | 92.95 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 92.78 | |
| 1zcj_A | 463 | Peroxisomal bifunctional enzyme; peroxisomal multi | 92.77 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 92.68 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 92.62 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 92.59 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 92.5 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 92.28 | |
| 2bma_A | 470 | Glutamate dehydrogenase (NADP+); malaria, drug des | 92.24 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 92.24 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 92.23 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 92.16 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 92.11 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 92.06 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 91.93 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 91.83 | |
| 4fgw_A | 391 | Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxi | 91.65 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 91.59 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 91.55 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 91.41 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 91.36 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 91.35 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 91.19 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 91.07 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 91.06 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 91.04 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 91.02 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 90.98 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 90.73 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 90.65 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 90.54 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 90.47 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 90.44 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 90.16 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 90.16 | |
| 2y1e_A | 398 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o | 90.07 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 90.03 | |
| 1q0q_A | 406 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o | 90.0 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 89.92 | |
| 4h7p_A | 345 | Malate dehydrogenase; ssgcid, structural G seattle | 89.88 | |
| 2qyt_A | 317 | 2-dehydropantoate 2-reductase; APC81190, porphyrom | 89.86 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 89.86 | |
| 3kkj_A | 336 | Amine oxidase, flavin-containing; oxidoreductase, | 89.76 | |
| 4fcc_A | 450 | Glutamate dehydrogenase; protein complex, rossmann | 89.68 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 89.56 | |
| 3r3j_A | 456 | Glutamate dehydrogenase; rossman fold, oxidoreduct | 89.54 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 89.16 | |
| 3fr7_A | 525 | Putative ketol-acid reductoisomerase (OS05G057370 | 89.14 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 89.05 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 88.91 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 88.85 | |
| 1bgv_A | 449 | Glutamate dehydrogenase; oxidoreductase; HET: GLU; | 88.8 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 88.67 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 88.61 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 88.39 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 88.36 | |
| 3mwd_B | 334 | ATP-citrate synthase; ATP-grAsp, phosphohistidine, | 88.13 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 88.12 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 88.12 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 88.02 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 87.91 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 87.91 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 87.71 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 87.71 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 87.69 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 87.69 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 87.65 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 87.52 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 87.44 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 87.41 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 87.38 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 87.33 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 87.07 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 87.05 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 86.77 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 86.77 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 86.74 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 86.71 | |
| 1gtm_A | 419 | Glutamate dehydrogenase; oxidoreductase, NAD, NADP | 86.69 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 86.65 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 86.49 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 86.43 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 86.05 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 85.92 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 85.89 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 85.76 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 85.66 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 85.47 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 85.38 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 85.24 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 84.91 | |
| 3fef_A | 450 | Putative glucosidase LPLD; gulosidase, structural | 84.82 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 84.66 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 84.49 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 84.49 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 84.45 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 84.37 | |
| 3au8_A | 488 | 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N | 84.32 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 84.26 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 84.2 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 83.99 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 83.92 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 83.87 | |
| 7mdh_A | 375 | Protein (malate dehydrogenase); chloroplastic mala | 83.85 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 83.8 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 83.74 | |
| 2gv8_A | 447 | Monooxygenase; FMO, FAD, NADPH, cofactor complex, | 83.33 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 82.73 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 82.72 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 82.71 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 82.31 | |
| 3f8d_A | 323 | Thioredoxin reductase (TRXB-3); redox protein, nuc | 82.19 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 82.11 | |
| 4hb9_A | 412 | Similarities with probable monooxygenase; flavin, | 82.08 | |
| 2xdo_A | 398 | TETX2 protein; tetracycline degradation, tigecycli | 82.01 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 82.01 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 81.99 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 81.91 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 81.86 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 81.81 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 81.75 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 81.1 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 81.07 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 80.73 | |
| 2y0c_A | 478 | BCEC, UDP-glucose dehydrogenase; oxidoreductase, c | 80.33 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 80.15 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 80.12 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 80.12 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 80.04 |
| >3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.3e-81 Score=566.24 Aligned_cols=289 Identities=66% Similarity=1.084 Sum_probs=279.8
Q ss_pred eeEEEEEecCHHHHHHHHHHHcCCCcEEEEEecCCCChhhhhhcccccccCCCCcCcceeeeCCceeEECCEEEEEEecC
Q 022491 6 KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNELKVKDEKTLLFGEKPVAVFGFR 85 (296)
Q Consensus 6 ~i~vgI~G~G~iG~~l~r~l~~~p~~elv~i~~~~~~~~~~a~~l~~~s~~~~~~~~~v~~~~~~~l~~~~~~i~~~~~~ 85 (296)
|+||||||||||||.++|++.+++++|+|+|||++.+.++++|+|+|||+||+|+ ++++.+++ .|.+||+.|++++++
T Consensus 1 ~~kv~INGfGrIGr~v~R~~~~~~~~~ivaiNd~~~d~~~~a~l~kyDS~hG~f~-~~v~~~~~-~l~i~Gk~I~v~~e~ 78 (332)
T 3pym_A 1 MVRVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYA-GEVSHDDK-HIIVDGKKIATYQER 78 (332)
T ss_dssp CCEEEEECCSHHHHHHHHHHHHSTTCEEEEEECTTCCHHHHHHHHHCCTTTCSCS-SCEEECSS-EEEETTEEEEEECCS
T ss_pred CeEEEEECCCcHHHHHHHHHHhCCCcEEEEEeCCCCCHHHHHHHhcccCCCCCCC-CcEEEcCC-EEEECCEEEEEEeec
Confidence 3799999999999999999999999999999998779999999999999999999 98888766 699999999999989
Q ss_pred CCCCCCcccCCCcEEEEccCCccCHHHHHHHHHCCCCeEEeeCCCCCCCeEEcccChhccCCCCCeEEcCCcchhhhHhH
Q 022491 86 NPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEKEYKPELDIVSNASCTTNCLAPL 165 (296)
Q Consensus 86 d~~~i~~~~~~~DvV~~at~~~~~~~~~~~~l~~G~k~vvid~~~~d~~~~v~gvn~~~l~~~~~iIs~p~C~~tal~~~ 165 (296)
||++++|.+.++|+||||||.++++++++.|+++|+|+|+||+|++|+|++|||+|++.|++..+|||||||+|+||+|+
T Consensus 79 dp~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViIsaps~d~p~vV~gVN~~~~~~~~~IISnasCTTn~Lap~ 158 (332)
T 3pym_A 79 DPANLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPL 158 (332)
T ss_dssp SGGGSCTTTTTCSEEEECSSSSCSHHHHHHHHHTTCSEEEESSCCSSSCBCCTTTTGGGCCTTCCEEECCCHHHHHHHHH
T ss_pred ccccCCccccCccEEEEecccccCHHHHHHHHHcCCCEEEECCCCCCCCeEeeccchhhcCccccEEecCcchhhhhHHH
Confidence 99999999899999999999999999999999999999999999988999999999999986679999999999999999
Q ss_pred HHHHHhhcCeeEEEEEEEeecCCcccccCCCCCccccCcccccceeeeccCChhhHHHHhccccCCceeEEEEEeeeCce
Q 022491 166 AKVIHDKFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDV 245 (296)
Q Consensus 166 l~~L~~~~gi~~~~~~~v~a~sg~~~~~d~~~~~~~~~~r~~~~ni~P~~~g~~~~~~~~~pel~~~v~~~~~~VP~~~g 245 (296)
++||+++|||++++|||+|++|++|+.+|++++++||++|++++|+||+.+|+++++.+++|||+++++++|+|||+++|
T Consensus 159 lkvL~d~fGI~~g~mTTvha~T~~Q~~vDg~~~kd~r~~r~aa~NiIP~~tGaakav~kVlPeL~gkltg~avRVPv~~~ 238 (332)
T 3pym_A 159 AKVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDV 238 (332)
T ss_dssp HHHHHHHHCEEEEEEEEEEECCTTSCSSSCCCTTCTGGGSCGGGCCEEEECSHHHHHHHHSGGGTTSEEEEEEEESCSSC
T ss_pred HHHHHHhcCeEEEEEEEEeeccccchhccCCCcccCccccchhhcccCCCCChHHHHHHhhhhhcCCEEEEEEEcCCCCc
Confidence 99999999999999999999999999999998789999999999999999999999999999999999999999999999
Q ss_pred EEEEEEEEeecCCCHHHHHHHHHHhhcCcCCCcccccCCceeeecCCCCCC
Q 022491 246 SVVDLTVRLEKEATYEEIKNAIKEESEGKLKGILGYTEEDVVSTDFVGDSR 296 (296)
Q Consensus 246 ~~~~~~~~l~~~~~~~ev~~~~~~~~~~~~~~~~~~~~~~~vs~d~~~~~~ 296 (296)
|+.+++++++++++.||++++++++++++|||||+|+|+|+||+||+||||
T Consensus 239 s~~dlt~~lek~~t~eei~~~lk~a~~g~lkgil~yte~~~VS~Df~~~~~ 289 (332)
T 3pym_A 239 SVVDLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSH 289 (332)
T ss_dssp EEEEEEEEESSCCCHHHHHHHHHHHHHTTTTTTEEEECSCCCGGGGTTCCC
T ss_pred EeeEEEEEECCcCCHHHHHHHHHHhccCccCceeEEEcCCeEeeccCCCCc
Confidence 999999999999999999999999999999999999999999999999997
|
| >3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O | Back alignment and structure |
|---|
| >3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* | Back alignment and structure |
|---|
| >3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* | Back alignment and structure |
|---|
| >4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* | Back alignment and structure |
|---|
| >3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* | Back alignment and structure |
|---|
| >3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} | Back alignment and structure |
|---|
| >2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* | Back alignment and structure |
|---|
| >1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* | Back alignment and structure |
|---|
| >2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* | Back alignment and structure |
|---|
| >1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* | Back alignment and structure |
|---|
| >2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A | Back alignment and structure |
|---|
| >3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* | Back alignment and structure |
|---|
| >1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O | Back alignment and structure |
|---|
| >3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* | Back alignment and structure |
|---|
| >1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* | Back alignment and structure |
|---|
| >2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* | Back alignment and structure |
|---|
| >1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 | Back alignment and structure |
|---|
| >2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* | Back alignment and structure |
|---|
| >2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* | Back alignment and structure |
|---|
| >1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* | Back alignment and structure |
|---|
| >4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* | Back alignment and structure |
|---|
| >2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A | Back alignment and structure |
|---|
| >2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} | Back alignment and structure |
|---|
| >1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* | Back alignment and structure |
|---|
| >3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A | Back alignment and structure |
|---|
| >3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A | Back alignment and structure |
|---|
| >1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A | Back alignment and structure |
|---|
| >3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A | Back alignment and structure |
|---|
| >3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A | Back alignment and structure |
|---|
| >1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 | Back alignment and structure |
|---|
| >3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A | Back alignment and structure |
|---|
| >3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A | Back alignment and structure |
|---|
| >3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} | Back alignment and structure |
|---|
| >3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} | Back alignment and structure |
|---|
| >3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} | Back alignment and structure |
|---|
| >3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X | Back alignment and structure |
|---|
| >3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* | Back alignment and structure |
|---|
| >3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} | Back alignment and structure |
|---|
| >3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} | Back alignment and structure |
|---|
| >4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* | Back alignment and structure |
|---|
| >1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* | Back alignment and structure |
|---|
| >3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} | Back alignment and structure |
|---|
| >3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} | Back alignment and structure |
|---|
| >3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* | Back alignment and structure |
|---|
| >3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} | Back alignment and structure |
|---|
| >4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} | Back alignment and structure |
|---|
| >1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* | Back alignment and structure |
|---|
| >1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* | Back alignment and structure |
|---|
| >1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* | Back alignment and structure |
|---|
| >3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} | Back alignment and structure |
|---|
| >3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A | Back alignment and structure |
|---|
| >3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A | Back alignment and structure |
|---|
| >2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* | Back alignment and structure |
|---|
| >1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 | Back alignment and structure |
|---|
| >3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* | Back alignment and structure |
|---|
| >2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A | Back alignment and structure |
|---|
| >3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* | Back alignment and structure |
|---|
| >3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* | Back alignment and structure |
|---|
| >2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* | Back alignment and structure |
|---|
| >2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} | Back alignment and structure |
|---|
| >1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* | Back alignment and structure |
|---|
| >1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* | Back alignment and structure |
|---|
| >3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* | Back alignment and structure |
|---|
| >2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} | Back alignment and structure |
|---|
| >2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} | Back alignment and structure |
|---|
| >2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A | Back alignment and structure |
|---|
| >2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken ST genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4fgw_A Glycerol-3-phosphate dehydrogenase [NAD(+)] 1; oxidoreductase; 2.45A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} | Back alignment and structure |
|---|
| >2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} | Back alignment and structure |
|---|
| >2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 296 | ||||
| d1u8fo2 | 164 | d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de | 2e-76 | |
| d3cmco2 | 163 | d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de | 5e-73 | |
| d1rm4a2 | 163 | d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de | 2e-71 | |
| d1u8fo1 | 169 | c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp | 6e-70 | |
| d1obfo2 | 162 | d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de | 6e-69 | |
| d1dssg1 | 169 | c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp | 2e-68 | |
| d1rm4a1 | 172 | c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp | 2e-66 | |
| d2g82a2 | 162 | d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de | 5e-64 | |
| d1gado1 | 166 | c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp | 6e-63 | |
| d1k3ta2 | 169 | d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de | 1e-62 | |
| d1hdgo1 | 169 | c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp | 1e-61 | |
| d3cmco1 | 171 | c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp | 2e-61 | |
| d2b4ro1 | 166 | c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp | 3e-61 | |
| d1k3ta1 | 190 | c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp | 3e-59 | |
| d1cf2o1 | 171 | c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp | 3e-54 | |
| d2g82a1 | 168 | c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp | 6e-52 | |
| d1obfo1 | 173 | c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp | 1e-50 | |
| d2czca2 | 172 | c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp | 2e-49 | |
| d1b7go1 | 178 | c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp | 1e-43 | |
| d1cf2o2 | 165 | d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de | 4e-39 | |
| d1b7go2 | 162 | d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de | 5e-37 | |
| d1f06a1 | 170 | c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid de | 3e-07 | |
| d2czca1 | 162 | d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate de | 4e-07 | |
| d1ydwa1 | 184 | c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductas | 3e-06 | |
| d1diha1 | 162 | c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate re | 5e-06 | |
| d1nvmb1 | 157 | c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydroge | 4e-05 | |
| d1lc0a1 | 172 | c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase { | 8e-05 | |
| d1zh8a1 | 181 | c.2.1.3 (A:4-131,A:276-328) Hypothetical protein T | 1e-04 | |
| d2g17a1 | 179 | c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamy | 1e-04 | |
| d1tlta1 | 164 | c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM | 2e-04 | |
| d1h6da1 | 221 | c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxid | 3e-04 | |
| d1vkna1 | 176 | c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamy | 4e-04 | |
| d2nvwa1 | 237 | c.2.1.3 (A:2-154,A:374-457) Galactose/lactose meta | 0.003 |
| >d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: FwdE/GAPDH domain-like superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain family: GAPDH-like domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) species: Human(Homo sapiens), liver isoform [TaxId: 9606]
Score = 228 bits (582), Expect = 2e-76
Identities = 108/140 (77%), Positives = 119/140 (85%)
Query: 157 CTTNCLAPLAKVIHDKFGIVEGLMTTVHSITATQKTVDGPSMKDWRGGRAASFNIIPSST 216
CTTNCLAPLAKVIHD FGIVEGLMTTVH+ITATQKTVDGPS K WR GR A NIIP+ST
Sbjct: 1 CTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPAST 60
Query: 217 GAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKEATYEEIKNAIKEESEGKLK 276
GAAKAVGKV+P LNGKLTGM+FRVPT +VSVVDLT RLEK A Y++IK +K+ SEG LK
Sbjct: 61 GAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLK 120
Query: 277 GILGYTEEDVVSTDFVGDSR 296
GILGYTE VVS+DF D+
Sbjct: 121 GILGYTEHQVVSSDFNSDTH 140
|
| >d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 | Back information, alignment and structure |
|---|
| >d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 | Back information, alignment and structure |
|---|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 | Back information, alignment and structure |
|---|
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 | Back information, alignment and structure |
|---|
| >d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 | Back information, alignment and structure |
|---|
| >d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 | Back information, alignment and structure |
|---|
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 | Back information, alignment and structure |
|---|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 | Back information, alignment and structure |
|---|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 | Back information, alignment and structure |
|---|
| >d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 | Back information, alignment and structure |
|---|
| >d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 | Back information, alignment and structure |
|---|
| >d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Length = 170 | Back information, alignment and structure |
|---|
| >d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 162 | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 184 | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Length = 162 | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Length = 157 | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 172 | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Length = 181 | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Length = 179 | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Length = 164 | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Length = 221 | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Length = 176 | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Length = 237 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 296 | |||
| d1gado1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1dssg1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d3cmco1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1u8fo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1rm4a1 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2b4ro1 | 166 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1k3ta1 | 190 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d3cmco2 | 163 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1u8fo2 | 164 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2g82a1 | 168 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1k3ta2 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1rm4a2 | 163 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1hdgo1 | 169 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1obfo2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d2g82a2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1obfo1 | 173 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 100.0 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.97 | |
| d1cf2o1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.96 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.96 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 99.93 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 99.92 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 99.92 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 99.91 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 99.91 | |
| d1cf2o2 | 165 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.81 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 99.77 | |
| d1t4ba2 | 221 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 99.77 | |
| d1mb4a2 | 222 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 99.77 | |
| d1b7go2 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.76 | |
| d2hjsa2 | 190 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 99.75 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 99.75 | |
| d2gz1a2 | 202 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 99.7 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 99.62 | |
| d2czca1 | 162 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 99.55 | |
| d2g17a2 | 155 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 99.49 | |
| d2cvoa2 | 165 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 99.37 | |
| d1vkna2 | 163 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 99.32 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 99.0 | |
| d1tlta1 | 164 | Virulence factor MviM {Escherichia coli [TaxId: 56 | 98.58 | |
| d1ydwa1 | 184 | Probable oxidoreductase At4g09670 {Thale cress (Ar | 98.58 | |
| d1zh8a1 | 181 | Hypothetical protein TM0312 {Thermotoga maritima [ | 98.53 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 98.51 | |
| d1diha1 | 162 | Dihydrodipicolinate reductase {Escherichia coli [T | 98.44 | |
| d1h6da1 | 221 | Glucose-fructose oxidoreductase, N-terminal domain | 98.43 | |
| d1xeaa1 | 167 | Putative oxidoreductase VCA1048 {Vibrio cholerae [ | 98.38 | |
| d1lc0a1 | 172 | Biliverdin reductase {Rat (Rattus norvegicus) [Tax | 98.21 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 98.09 | |
| d2nvwa1 | 237 | Galactose/lactose metabolism regulatory protein GA | 97.91 | |
| d2dt5a2 | 126 | Transcriptional repressor Rex, C-terminal domain { | 97.64 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 97.63 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 97.46 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 97.38 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 97.06 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 97.04 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 96.96 | |
| d1ebfa1 | 168 | Homoserine dehydrogenase {Baker's yeast (Saccharom | 96.86 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 96.86 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 96.78 | |
| d2csua1 | 129 | Acetate-CoA ligase alpha chain, AcdA, N-terminal d | 96.58 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 96.49 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 96.47 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 96.43 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 96.43 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 96.39 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 96.39 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 96.3 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 96.29 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 96.24 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 96.15 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 96.13 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 96.05 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 95.96 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 95.83 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 95.75 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 95.71 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 95.71 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 95.65 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 95.57 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 95.53 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 95.35 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 95.29 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 95.22 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 95.16 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 95.12 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 95.11 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 95.09 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 95.08 | |
| d1q0qa2 | 151 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E | 94.76 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 94.73 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 94.55 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 94.5 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 94.31 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 94.02 | |
| d1r0ka2 | 150 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 93.96 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 93.58 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 93.53 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 93.51 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 93.51 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 93.45 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 93.4 | |
| d1iuka_ | 136 | Hypothetical protein TT1466 {Thermus thermophilus | 93.29 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 93.23 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 92.82 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 92.78 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 92.74 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 92.73 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 92.58 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 92.36 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 92.21 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 91.82 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 91.64 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 91.53 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 91.34 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 91.26 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 90.53 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 90.5 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 90.18 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 90.17 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 89.63 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 89.41 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 89.24 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 89.12 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 88.97 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 88.94 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 88.64 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 88.51 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 87.52 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 87.47 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 87.42 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 87.28 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 87.19 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 86.95 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 86.84 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 86.75 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 86.53 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 86.5 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 86.23 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 86.0 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 85.83 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 85.55 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 85.48 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 85.44 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 85.39 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 85.36 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 85.19 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 85.13 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 85.09 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 84.74 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 84.71 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 84.68 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 84.66 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 84.25 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 84.15 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 83.93 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 83.88 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 83.68 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 83.51 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 83.12 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 82.93 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 82.91 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 82.84 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 82.76 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 82.5 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 81.67 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 81.24 | |
| d1x7da_ | 340 | Ornithine cyclodeaminase {Pseudomonas putida [TaxI | 81.2 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 80.99 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 80.89 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 80.74 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 80.64 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 80.54 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 80.45 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 80.12 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 80.04 |
| >d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=2.4e-43 Score=289.17 Aligned_cols=162 Identities=47% Similarity=0.803 Sum_probs=153.1
Q ss_pred eeEEEEEecCHHHHHHHHHHHcCCCcEEEEEecCCCChhhhhhcccccccCCCCcCcceeeeCCceeEECCEEEEEEecC
Q 022491 6 KIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFISTDYMTYMFKYDSVHGQWKHNELKVKDEKTLLFGEKPVAVFGFR 85 (296)
Q Consensus 6 ~i~vgI~G~G~iG~~l~r~l~~~p~~elv~i~~~~~~~~~~a~~l~~~s~~~~~~~~~v~~~~~~~l~~~~~~i~~~~~~ 85 (296)
+|||||||||||||.++|++.++|++++++||++ .+.++++|+|+|||+||+|+ +.+..+++ .|.+||+.|++++..
T Consensus 1 tikigINGFGRIGR~v~R~~~~~~~i~ivaINd~-~~~~~~ayLl~yDSvhG~~~-~~v~~~~~-~l~ing~~I~i~~~~ 77 (166)
T d1gado1 1 TIKVGINGFGRIGRIVFRAAQKRSDIEIVAINDL-LDADYMAYMLKYDSTHGRFD-GTVEVKDG-HLIVNGKKIRVTAER 77 (166)
T ss_dssp CEEEEEECCSHHHHHHHHHHHTCSSEEEEEEECS-SCHHHHHHHHHCCTTTCSCS-SCEEEETT-EEEETTEEEEEECCS
T ss_pred CeEEEEECCcHHHHHHHHHHhhCCCeEEEEEeCC-CCHHHHhhhheecCCCCCcC-CeEEEeCC-EEEECCEEEEEEeCC
Confidence 4799999999999999999999999999999997 78999999999999999999 88887666 699999999999999
Q ss_pred CCCCCCcccCCCcEEEEccCCccCHHHHHHHHHCCCCeEEeeCCCCC-CCeEEcccChhccCCCCCeEEcCCcchhhhHh
Q 022491 86 NPEEIPWAKTGAEYVVESTGVFTDKDKAAAHLKGGAKKVVISAPSKD-APMFVVGVNEKEYKPELDIVSNASCTTNCLAP 164 (296)
Q Consensus 86 d~~~i~~~~~~~DvV~~at~~~~~~~~~~~~l~~G~k~vvid~~~~d-~~~~v~gvn~~~l~~~~~iIs~p~C~~tal~~ 164 (296)
+|++++|.+.++|+|+||||.+.+++.++.|+++|+|+|++|+|+.| +|++|||+|++.|+ .+++||++||+|+|++|
T Consensus 78 ~p~~i~W~~~gvDiViEcTG~f~t~~~~~~hl~~gakkViiSaP~~d~~~~iV~GvN~~~~~-~~~iiS~aSCTTnclaP 156 (166)
T d1gado1 78 DPANLKWDEVGVDVVAEATGLFLTDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYA-GQDIVSNASNETGYSNK 156 (166)
T ss_dssp SGGGGCHHHHTCSEEEECSSSCCSHHHHTHHHHTTCSEEEESSCCSSSCCBCCTTTTGGGCC-SCSEEECCCTTHHHHHH
T ss_pred ChHHCCccccCCCEEEEccccccCHHHHHHHhcCCCceEEeeccccccCCEEEeCccccccC-CCCEEEeccHHHhHHHH
Confidence 99999999899999999999999999999999999999999999887 99999999999998 57899999999999999
Q ss_pred HHHHHHh
Q 022491 165 LAKVIHD 171 (296)
Q Consensus 165 ~l~~L~~ 171 (296)
+++.|..
T Consensus 157 v~kvl~~ 163 (166)
T d1gado1 157 VLDLIAH 163 (166)
T ss_dssp HHHHHHH
T ss_pred HHHHHHH
Confidence 9999864
|
| >d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} | Back information, alignment and structure |
|---|
| >d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2cvoa2 d.81.1.1 (A:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} | Back information, alignment and structure |
|---|
| >d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|