Citrus Sinensis ID: 022543


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MMLRASQLASPVLCAITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPASNSNSFHIHIISRSFTSPKAASFSSGTEGSSPGGGDREILVQHLLVKEDDLNLLSELQRRVSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSIPTY
ccccccccccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHccccccccHHHHHHccccccccccccccccccccccccccEEEEEEEEccccHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccccccccccccEEEEEEHHcHHHHHccccHHHHHHHccccccHHHHHHHHHccHHHHHHccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccc
cHHHHHHHHcHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHHcccccccHHHHHHcccHcccccHHHHHHHHHHcccccccccEEEEEEEEEccHHHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccccHHHHHHHHHcccccEccEcccccEEEEEEEcccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHccHHHHHHHcccccccccHHHHHcccHHHHHHccccccEEEEEcccHHHHHHHHHHHHccccEEEEEcccHEHEEEEcccccccc
mmlrasqlaspVLCAITQsliptlnlssssslsifqkpasfasfykslnpasnsnsfhihiisrsftspkaasfssgtegsspgggdrEILVQHLLVKEDDLNLLSELQRRVSqgkdlsdlavehsicpskgeggmlgwvrkgqlvpefeevafttplnkvaRCKTKFGWHLLQVLSEREASLlqdiqpdelhkkmqdpnfhkeaqlidvrepeevalsslpgfqvlplrqfgswgpditvkfdpqkdtyvmchhgMRSLQVAQWLQTQGFRrvfnvsggihayatkvdpsipty
mmlrasqlASPVLCAITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPASNSNSFHIHIISRSFTSPKAAsfssgtegsspggGDREILVQHLLVKEDDLNLLSELQRRVSqgkdlsdlaVEHSIcpskgeggmlGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGgihayatkvdpsipty
MMLRASQLASPVLCAITQsliptlnlssssslsIFQKPASFASFYKSLNPAsnsnsfhihiisrsftsPKAAsfssgtegsspgggDREILVQHLLVKEDDLNLLSELQRRVSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSIPTY
**********PVLCAITQSLIPTLNL*******IFQ**ASFASFYK**********FHIHII***************************ILVQHLLVKEDDLNLLSEL***********DLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSER************************************VALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATK********
**************AITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPASNSNSFHIHIISRSFTSPK*******************ILVQHLLVKEDDLNLLSELQRRVSQGKDLSDLA***************GWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPL**************DPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSIPTY
********ASPVLCAITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPASNSNSFHIHIISRSFT*****************GGDREILVQHLLVKEDDLNLLSELQRRVSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSIPTY
MMLRASQLASPVLCAITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPASNSNSFHIHIISRSFTSPKAASFSSGTEGSSPGGGDREILVQHLLVKEDDLNLLSELQRRVSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSIPTY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMLRASQLASPVLCAITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPASNSNSFHIHIISRSFTSPKAASFSSGTEGSSPGGGDREILVQHLLVKEDDLNLLSELQRRVSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSIPTY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
Q93WI0299 Rhodanese-like/PpiC domai yes no 0.698 0.688 0.658 3e-81
P0A26593 Peptidyl-prolyl cis-trans yes no 0.284 0.903 0.436 4e-13
P0A26693 Peptidyl-prolyl cis-trans N/A no 0.284 0.903 0.436 4e-13
P0A9L593 Peptidyl-prolyl cis-trans N/A no 0.274 0.870 0.452 5e-13
P0A9L693 Peptidyl-prolyl cis-trans yes no 0.274 0.870 0.452 5e-13
P0A9L793 Peptidyl-prolyl cis-trans N/A no 0.274 0.870 0.452 5e-13
Q5WZN0429 Chaperone SurA OS=Legione yes no 0.389 0.268 0.322 2e-12
Q5ZYR3429 Chaperone SurA OS=Legione yes no 0.389 0.268 0.322 2e-12
Q5X877429 Chaperone SurA OS=Legione yes no 0.389 0.268 0.322 2e-12
Q60B78454 Chaperone SurA OS=Methylo no no 0.369 0.240 0.404 4e-12
>sp|Q93WI0|STR12_ARATH Rhodanese-like/PpiC domain-containing protein 12 OS=Arabidopsis thaliana GN=At5g19370 PE=2 SV=1 Back     alignment and function desciption
 Score =  301 bits (772), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 137/208 (65%), Positives = 172/208 (82%), Gaps = 2/208 (0%)

Query: 88  REILVQHLLVKEDDLNLLSELQRRVSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVP 147
           REILVQHLLVK +D+ L +ELQ++   G+++SDLA E+SICPSK +GG+LGWV+ GQ+VP
Sbjct: 94  REILVQHLLVKNNDVELFAELQKKFLDGEEMSDLAAEYSICPSKKDGGILGWVKLGQMVP 153

Query: 148 EFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQL 207
           EFEE AF   LN+V RC+T+FG HLLQVLSERE   ++DIQ +ELH KMQDP F  EAQL
Sbjct: 154 EFEEAAFKAELNQVVRCRTQFGLHLLQVLSEREP--VKDIQVEELHSKMQDPVFMDEAQL 211

Query: 208 IDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQ 267
           IDVREP E+ ++SLPGF+V PLRQFG+W PDIT K +P+KDT+V+C  G RS+QVA WLQ
Sbjct: 212 IDVREPNEIEIASLPGFKVFPLRQFGTWAPDITSKLNPEKDTFVLCKVGGRSMQVANWLQ 271

Query: 268 TQGFRRVFNVSGGIHAYATKVDPSIPTY 295
           +QGF+ V+N++GGI AY+ KVDPSIPTY
Sbjct: 272 SQGFKSVYNITGGIQAYSLKVDPSIPTY 299





Arabidopsis thaliana (taxid: 3702)
>sp|P0A265|PPIC_SALTY Peptidyl-prolyl cis-trans isomerase C OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ppiC PE=3 SV=2 Back     alignment and function description
>sp|P0A266|PPIC_SALTI Peptidyl-prolyl cis-trans isomerase C OS=Salmonella typhi GN=ppiC PE=3 SV=2 Back     alignment and function description
>sp|P0A9L5|PPIC_ECOLI Peptidyl-prolyl cis-trans isomerase C OS=Escherichia coli (strain K12) GN=ppiC PE=1 SV=2 Back     alignment and function description
>sp|P0A9L6|PPIC_ECOL6 Peptidyl-prolyl cis-trans isomerase C OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ppiC PE=3 SV=2 Back     alignment and function description
>sp|P0A9L7|PPIC_ECO57 Peptidyl-prolyl cis-trans isomerase C OS=Escherichia coli O157:H7 GN=ppiC PE=3 SV=2 Back     alignment and function description
>sp|Q5WZN0|SURA_LEGPL Chaperone SurA OS=Legionella pneumophila (strain Lens) GN=surA PE=3 SV=1 Back     alignment and function description
>sp|Q5ZYR3|SURA_LEGPH Chaperone SurA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=surA PE=3 SV=2 Back     alignment and function description
>sp|Q5X877|SURA_LEGPA Chaperone SurA OS=Legionella pneumophila (strain Paris) GN=surA PE=3 SV=1 Back     alignment and function description
>sp|Q60B78|SURA_METCA Chaperone SurA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=surA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
225436662296 PREDICTED: UPF0176 protein Pput_3956 [Vi 0.969 0.966 0.707 1e-105
356554167291 PREDICTED: UPF0176 protein Pput_3956-lik 0.779 0.790 0.774 1e-104
255639033291 unknown [Glycine max] 0.779 0.790 0.770 1e-104
358249358292 uncharacterized protein LOC100803404 [Gl 0.779 0.787 0.766 1e-103
357493891 649 Peptidyl-prolyl cis-trans isomerase C [M 0.966 0.439 0.646 1e-102
388516905291 unknown [Medicago truncatula] 0.966 0.979 0.646 1e-102
449480987292 PREDICTED: LOW QUALITY PROTEIN: rhodanes 0.969 0.979 0.636 1e-102
255570207294 rotamase, putative [Ricinus communis] gi 0.969 0.972 0.645 1e-100
152955225289 parvulin-type peptidyl prolyl cis/trans 0.783 0.799 0.757 3e-97
224103965296 predicted protein [Populus trichocarpa] 0.705 0.702 0.818 2e-92
>gi|225436662|ref|XP_002276538.1| PREDICTED: UPF0176 protein Pput_3956 [Vitis vinifera] gi|296083867|emb|CBI24255.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 215/304 (70%), Positives = 244/304 (80%), Gaps = 18/304 (5%)

Query: 2   MLRASQL---ASPVLCAITQSLIPTLNLSSSSSLSIFQKPASFASFYKSLNPAS--NSNS 56
           MLRA+ L   ASP L A+  SLIPTLNL+S S   I +K +SF+S +  L P +   S+ 
Sbjct: 1   MLRAAHLPPGASPALVALKLSLIPTLNLTSPS---IIRKFSSFSSLHAFL-PKTFLPSSP 56

Query: 57  FHIHIISRSFTSPKA-----ASFSSGTEGSSPGGGDREILVQHLLVKEDDLNLLSELQRR 111
           + + +  + F    A     ASFSSG  G++  G  REILVQHLLVKEDDL LL ELQ+R
Sbjct: 57  YPLSLGLKRFPPMVAQPCPRASFSSG--GNT--GSGREILVQHLLVKEDDLKLLLELQQR 112

Query: 112 VSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVARCKTKFGWH 171
           +S G DLSDLAVE+SICPSK EGGMLGWVRKGQ+VPEFEE AF  PLNKV RCKTKFGWH
Sbjct: 113 ISGGVDLSDLAVEYSICPSKEEGGMLGWVRKGQMVPEFEEAAFKAPLNKVVRCKTKFGWH 172

Query: 172 LLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQ 231
           LLQV+SERE SLLQDIQP ELH KMQDPNF +E QLIDVREPEEVA +SLPGFQVLPL+Q
Sbjct: 173 LLQVISEREESLLQDIQPVELHAKMQDPNFFEEVQLIDVREPEEVAQASLPGFQVLPLQQ 232

Query: 232 FGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPS 291
           FG+WGP+IT KFDP+KDTY+MCHHGMRSLQVA+WLQTQGF+RVFNVSGGIHAYATK DPS
Sbjct: 233 FGNWGPEITTKFDPEKDTYLMCHHGMRSLQVAKWLQTQGFKRVFNVSGGIHAYATKADPS 292

Query: 292 IPTY 295
           IPTY
Sbjct: 293 IPTY 296




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|356554167|ref|XP_003545420.1| PREDICTED: UPF0176 protein Pput_3956-like [Glycine max] Back     alignment and taxonomy information
>gi|255639033|gb|ACU19817.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|358249358|ref|NP_001240041.1| uncharacterized protein LOC100803404 [Glycine max] gi|255636250|gb|ACU18465.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357493891|ref|XP_003617234.1| Peptidyl-prolyl cis-trans isomerase C [Medicago truncatula] gi|355518569|gb|AET00193.1| Peptidyl-prolyl cis-trans isomerase C [Medicago truncatula] Back     alignment and taxonomy information
>gi|388516905|gb|AFK46514.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449480987|ref|XP_004156048.1| PREDICTED: LOW QUALITY PROTEIN: rhodanese-like/PpiC domain-containing protein 12-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255570207|ref|XP_002526064.1| rotamase, putative [Ricinus communis] gi|223534645|gb|EEF36341.1| rotamase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|152955225|emb|CAM59673.1| parvulin-type peptidyl prolyl cis/trans isomerase [Lotus japonicus] Back     alignment and taxonomy information
>gi|224103965|ref|XP_002313264.1| predicted protein [Populus trichocarpa] gi|222849672|gb|EEE87219.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
TAIR|locus:2150235299 AT5G19370 [Arabidopsis thalian 0.698 0.688 0.658 8.4e-74
UNIPROTKB|Q607L7106 MCA1742 "Rhodanese-like domain 0.359 1.0 0.392 1.1e-16
TIGR_CMR|CPS_363692 CPS_3636 "peptidyl-prolyl cis- 0.274 0.880 0.464 1.1e-14
TIGR_CMR|CPS_348292 CPS_3482 "peptidyl-prolyl cis- 0.274 0.880 0.464 2.3e-14
UNIPROTKB|P0A9L593 ppiC "peptidyl-prolyl cis-tran 0.274 0.870 0.452 3.8e-14
TIGR_CMR|SO_183292 SO_1832 "peptidyl-prolyl cis-t 0.281 0.902 0.441 2.1e-13
TIGR_CMR|GSU_082392 GSU_0823 "peptidyl-prolyl cis- 0.274 0.880 0.369 7.1e-13
UNIPROTKB|Q4KAR293 ppiC_1 "Peptidyl-prolyl cis-tr 0.291 0.924 0.393 1.5e-12
UNIPROTKB|Q5LWL7276 SPO0058 "PPIC-type PPIASE doma 0.464 0.496 0.333 1.8e-12
TIGR_CMR|SPO_0058276 SPO_0058 "PPIC-type PPIASE dom 0.464 0.496 0.333 1.8e-12
TAIR|locus:2150235 AT5G19370 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 745 (267.3 bits), Expect = 8.4e-74, P = 8.4e-74
 Identities = 137/208 (65%), Positives = 172/208 (82%)

Query:    88 REILVQHLLVKEDDLNLLSELQRRVSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVP 147
             REILVQHLLVK +D+ L +ELQ++   G+++SDLA E+SICPSK +GG+LGWV+ GQ+VP
Sbjct:    94 REILVQHLLVKNNDVELFAELQKKFLDGEEMSDLAAEYSICPSKKDGGILGWVKLGQMVP 153

Query:   148 EFEEVAFTTPLNKVARCKTKFGWHLLQVLSEREASLLQDIQPDELHKKMQDPNFHKEAQL 207
             EFEE AF   LN+V RC+T+FG HLLQVLSERE   ++DIQ +ELH KMQDP F  EAQL
Sbjct:   154 EFEEAAFKAELNQVVRCRTQFGLHLLQVLSEREP--VKDIQVEELHSKMQDPVFMDEAQL 211

Query:   208 IDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQ 267
             IDVREP E+ ++SLPGF+V PLRQFG+W PDIT K +P+KDT+V+C  G RS+QVA WLQ
Sbjct:   212 IDVREPNEIEIASLPGFKVFPLRQFGTWAPDITSKLNPEKDTFVLCKVGGRSMQVANWLQ 271

Query:   268 TQGFRRVFNVSGGIHAYATKVDPSIPTY 295
             +QGF+ V+N++GGI AY+ KVDPSIPTY
Sbjct:   272 SQGFKSVYNITGGIQAYSLKVDPSIPTY 299




GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016853 "isomerase activity" evidence=IEA;ISS
UNIPROTKB|Q607L7 MCA1742 "Rhodanese-like domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3636 CPS_3636 "peptidyl-prolyl cis-trans isomerase C" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_3482 CPS_3482 "peptidyl-prolyl cis-trans isomerase C" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
UNIPROTKB|P0A9L5 ppiC "peptidyl-prolyl cis-trans isomerase C (rotamase C)" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1832 SO_1832 "peptidyl-prolyl cis-trans isomerase C" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_0823 GSU_0823 "peptidyl-prolyl cis-trans isomerase C" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KAR2 ppiC_1 "Peptidyl-prolyl cis-trans isomerase C" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LWL7 SPO0058 "PPIC-type PPIASE domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0058 SPO_0058 "PPIC-type PPIASE domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93WI0STR12_ARATHNo assigned EC number0.65860.69830.6889yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.8.1.1LOW CONFIDENCE prediction!
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!
3rd Layer2.8.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00022284001
SubName- Full=Chromosome chr6 scaffold_25, whole genome shotgun sequence; (296 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00036804001
SubName- Full=Chromosome chr4 scaffold_83, whole genome shotgun sequence; (118 aa)
      0.482

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
cd01528101 cd01528, RHOD_2, Member of the Rhodanese Homology 1e-41
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 3e-21
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 4e-19
pfam0063994 pfam00639, Rotamase, PPIC-type PPIASE domain 3e-18
PRK1544193 PRK15441, PRK15441, peptidyl-prolyl cis-trans isom 7e-17
cd01526122 cd01526, RHOD_ThiF, Member of the Rhodanese Homolo 1e-16
cd0144496 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and 1e-14
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 9e-14
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 1e-13
PRK03095287 PRK03095, prsA, peptidylprolyl isomerase; Reviewed 1e-13
PRK07878392 PRK07878, PRK07878, molybdopterin biosynthesis-lik 1e-12
pfam13616114 pfam13616, Rotamase_3, PPIC-type PPIASE domain 2e-12
COG0760320 COG0760, SurA, Parvulin-like peptidyl-prolyl isome 4e-11
cd0152490 cd01524, RHOD_Pyr_redox, Member of the Rhodanese H 1e-10
PRK02998283 PRK02998, prsA, peptidylprolyl isomerase; Reviewed 5e-10
TIGR02933256 TIGR02933, nifM_nitrog, nitrogen fixation protein 3e-09
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 4e-09
PRK07411390 PRK07411, PRK07411, hypothetical protein; Validate 5e-09
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 2e-08
PRK03002285 PRK03002, prsA, peptidylprolyl isomerase; Reviewed 5e-08
PRK00162108 PRK00162, glpE, thiosulfate sulfurtransferase; Val 8e-08
PRK00059336 PRK00059, prsA, peptidylprolyl isomerase; Provisio 8e-08
cd01447103 cd01447, Polysulfide_ST, Polysulfide-sulfurtransfe 2e-07
cd01518101 cd01518, RHOD_YceA, Member of the Rhodanese Homolo 2e-07
cd01519106 cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom 1e-06
COG1054308 COG1054, COG1054, Predicted sulfurtransferase [Gen 1e-05
PTZ00356115 PTZ00356, PTZ00356, peptidyl-prolyl cis-trans isom 4e-05
PRK00142314 PRK00142, PRK00142, putative rhodanese-related sul 6e-05
cd01522117 cd01522, RHOD_1, Member of the Rhodanese Homology 1e-04
cd0152799 cd01527, RHOD_YgaP, Member of the Rhodanese Homolo 4e-04
TIGR04271101 TIGR04271, ThiI_C_thiazole, thiazole biosynthesis 0.002
PRK10770413 PRK10770, PRK10770, peptidyl-prolyl cis-trans isom 0.002
PRK01269482 PRK01269, PRK01269, tRNA s(4)U8 sulfurtransferase; 0.002
>gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
 Score =  139 bits (351), Expect = 1e-41
 Identities = 47/104 (45%), Positives = 65/104 (62%), Gaps = 3/104 (2%)

Query: 186 DIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDP 245
            I   EL + + D    +E  LIDVREPEE+ ++ LPGF  LP+ +      ++    +P
Sbjct: 1   QISVAELAEWLADER--EEPVLIDVREPEELEIAFLPGFLHLPMSEIPERSKELD-SDNP 57

Query: 246 QKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVD 289
            KD  V+CHHG RS+QVAQWL  QGF  V+N+ GGI A++ +VD
Sbjct: 58  DKDIVVLCHHGGRSMQVAQWLLRQGFENVYNLQGGIDAWSLEVD 101


Subgroup 2 includes uncharacterized putative rhodanese-related domains. Length = 101

>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|216038 pfam00639, Rotamase, PPIC-type PPIASE domain Back     alignment and domain information
>gnl|CDD|185338 PRK15441, PRK15441, peptidyl-prolyl cis-trans isomerase C; Provisional Back     alignment and domain information
>gnl|CDD|238784 cd01526, RHOD_ThiF, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238721 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|179537 PRK03095, prsA, peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>gnl|CDD|222266 pfam13616, Rotamase_3, PPIC-type PPIASE domain Back     alignment and domain information
>gnl|CDD|223831 COG0760, SurA, Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|179522 PRK02998, prsA, peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>gnl|CDD|131979 TIGR02933, nifM_nitrog, nitrogen fixation protein NifM Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|101162 PRK03002, prsA, peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>gnl|CDD|178908 PRK00162, glpE, thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>gnl|CDD|234605 PRK00059, prsA, peptidylprolyl isomerase; Provisional Back     alignment and domain information
>gnl|CDD|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238776 cd01518, RHOD_YceA, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|223982 COG1054, COG1054, Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|185573 PTZ00356, PTZ00356, peptidyl-prolyl cis-trans isomerase (PPIase); Provisional Back     alignment and domain information
>gnl|CDD|234663 PRK00142, PRK00142, putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>gnl|CDD|238785 cd01527, RHOD_YgaP, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|211994 TIGR04271, ThiI_C_thiazole, thiazole biosynthesis domain Back     alignment and domain information
>gnl|CDD|236758 PRK10770, PRK10770, peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>gnl|CDD|234932 PRK01269, PRK01269, tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
PRK10770413 peptidyl-prolyl cis-trans isomerase SurA; Provisio 99.92
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.87
PF13616117 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3 99.87
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.86
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.85
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.85
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.84
PRK1544193 peptidyl-prolyl cis-trans isomerase C; Provisional 99.84
TIGR02933256 nifM_nitrog nitrogen fixation protein NifM. Member 99.83
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.83
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.83
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.82
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.82
PTZ00356115 peptidyl-prolyl cis-trans isomerase (PPIase); Prov 99.81
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.81
PLN02160136 thiosulfate sulfurtransferase 99.81
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.81
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.81
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.81
PF0063995 Rotamase: PPIC-type PPIASE domain; InterPro: IPR00 99.8
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.8
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.8
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.79
PRK01415247 hypothetical protein; Validated 99.79
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.79
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.78
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.78
PRK05320257 rhodanese superfamily protein; Provisional 99.78
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.78
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.77
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.77
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 99.77
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.77
PRK02998283 prsA peptidylprolyl isomerase; Reviewed 99.77
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.76
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.76
KOG3259163 consensus Peptidyl-prolyl cis-trans isomerase [Pos 99.76
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.76
PRK04405298 prsA peptidylprolyl isomerase; Provisional 99.76
PRK10770413 peptidyl-prolyl cis-trans isomerase SurA; Provisio 99.75
PRK07411390 hypothetical protein; Validated 99.75
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.75
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.75
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.74
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.73
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.73
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.73
PRK03095287 prsA peptidylprolyl isomerase; Reviewed 99.72
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.72
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.71
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.7
KOG3258133 consensus Parvulin-like peptidyl-prolyl cis-trans 99.7
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.68
PRK00059336 prsA peptidylprolyl isomerase; Provisional 99.68
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.65
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.65
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.64
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.62
PRK10788 623 periplasmic folding chaperone; Provisional 99.61
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.61
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.61
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.61
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.61
PRK12450309 foldase protein PrsA; Reviewed 99.6
PRK01326310 prsA foldase protein PrsA; Reviewed 99.59
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.59
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.58
COG1054308 Predicted sulfurtransferase [General function pred 99.57
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.54
TIGR02925232 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase 99.54
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.53
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.51
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.35
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.29
COG0760320 SurA Parvulin-like peptidyl-prolyl isomerase [Post 99.2
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 99.16
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.96
KOG1529 286 consensus Mercaptopyruvate sulfurtransferase/thios 98.59
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 98.16
PF0063995 Rotamase: PPIC-type PPIASE domain; InterPro: IPR00 97.89
PRK10788623 periplasmic folding chaperone; Provisional 97.88
PF13145121 Rotamase_2: PPIC-type PPIASE domain; PDB: 3NRK_A 2 97.86
KOG3259163 consensus Peptidyl-prolyl cis-trans isomerase [Pos 97.84
PF13616117 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3 97.74
KOG3258133 consensus Parvulin-like peptidyl-prolyl cis-trans 97.53
PTZ00356115 peptidyl-prolyl cis-trans isomerase (PPIase); Prov 97.16
PRK1544193 peptidyl-prolyl cis-trans isomerase C; Provisional 96.98
TIGR02933256 nifM_nitrog nitrogen fixation protein NifM. Member 96.74
PRK04405298 prsA peptidylprolyl isomerase; Provisional 96.58
PRK03095287 prsA peptidylprolyl isomerase; Reviewed 96.15
COG2603 334 Predicted ATPase [General function prediction only 95.83
PRK02998283 prsA peptidylprolyl isomerase; Reviewed 95.81
PRK03002285 prsA peptidylprolyl isomerase; Reviewed 95.36
KOG1093725 consensus Predicted protein kinase (contains TBC a 94.28
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 93.97
PRK01326310 prsA foldase protein PrsA; Reviewed 93.43
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 93.04
PRK12450309 foldase protein PrsA; Reviewed 92.83
PRK00059336 prsA peptidylprolyl isomerase; Provisional 92.33
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 85.09
COG0760320 SurA Parvulin-like peptidyl-prolyl isomerase [Post 84.68
KOG1717 343 consensus Dual specificity phosphatase [Defense me 84.64
TIGR03167311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 81.31
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
Probab=99.92  E-value=7.2e-26  Score=212.12  Aligned_cols=171  Identities=17%  Similarity=0.227  Sum_probs=148.4

Q ss_pred             chhhhhccccccccccccCcchhhhccCchhh-hhhccccCCCCCCCccceeecccccCchhhhccccCCCCCCCC----
Q 022543           10 SPVLCAITQSLIPTLNLSSSSSLSIFQKPASF-ASFYKSLNPASNSNSFHIHIISRSFTSPKAASFSSGTEGSSPG----   84 (295)
Q Consensus        10 ~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~e~~~y~~~~~~~~~~----   84 (295)
                      +..+++.++......+.+++.+..+ .+|+.+ +.||+++. +.+||.+||+..+.+.++|+.+.|.+++|.++.+    
T Consensus       167 ~~~s~~~~~~~~~~a~~l~~~l~~g-~~F~~lA~~yS~~~~-a~~gGdlg~~~~~~l~~~~~~~~~~l~~G~is~Pi~t~  244 (413)
T PRK10770        167 ENPTQDQVDEAESQARSIVDQARNG-ADFGKLAIAYSADQQ-ALKGGQMGWGRIQELPGLFAQALSTAKKGDIVGPIRSG  244 (413)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCC-CCHHHHHHHhCCCcc-cccCCcCCccccccccHHHHHHHHhCCCCCCCCcEECC
Confidence            3456666667777788888888776 599999 99999986 7899999999999999999999999988765541    


Q ss_pred             ----------CC-------CceEEEeeEEeccc-------hHHHHHHHHHHhCCCC-cHHHHHHHhCCCC-CccCCCccc
Q 022543           85 ----------GG-------DREILVQHLLVKED-------DLNLLSELQRRVSQGK-DLSDLAVEHSICP-SKGEGGMLG  138 (295)
Q Consensus        85 ----------~~-------~~~~~~~~Il~~~~-------~~~~a~~i~~~i~~g~-~F~~~a~~~S~d~-~~~~gG~lg  138 (295)
                                .+       .++++++|||+++.       ++++|++++.+|.+|. +|+++|++||+|+ ++.+||++|
T Consensus       245 ~GyhIikl~~~~~~~~~~~~~e~~~~hIli~~~~~~~~~~a~~~~~~i~~~i~~g~~~F~~~A~~~S~d~~s~~~gG~lg  324 (413)
T PRK10770        245 VGFHILKVNDLRGESQNISVTEVHARHILLKPSPIMTDEQARAKLEQIAADIKSGKTTFAAAAKEFSQDPGSANQGGDLG  324 (413)
T ss_pred             CceEEEEEeeeccccccchHHhhhhhheEECCCCCCCHHHHHHHHHHHHHHHHcCcccHHHHHHHhCCCCChHhhCCcCC
Confidence                      11       23699999999863       4677999999999996 9999999999999 899999999


Q ss_pred             ceeCCCCcHHHHHHHhcCCCCcee-eeeecCceeeeehhhhhhhh
Q 022543          139 WVRKGQLVPEFEEVAFTTPLNKVA-RCKTKFGWHLLQVLSEREAS  182 (295)
Q Consensus       139 ~~~~~~~~~~~~~~~~~l~~g~is-pv~~~~G~~ii~v~~~~~~~  182 (295)
                      |+..+.++|+|..++++|++|++| |+.+++||||+++++.+...
T Consensus       325 ~~~~~~~~~~~~~~~~~l~~GeiS~pv~t~~g~~ii~v~~~~~~~  369 (413)
T PRK10770        325 WATPDIFDPAFRDALMRLNKGQISAPVHSSFGWHLIELLDTRQVD  369 (413)
T ss_pred             ccCccccCHHHHHHHHcCCCCCcCCcEEcCCeEEEEEEeecccCC
Confidence            999999999999999999999999 99999999999998876543



>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF13616 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3UI5_A 3UI4_A 1FJD_A 1EQ3_A 1ZK6_A Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK15441 peptidyl-prolyl cis-trans isomerase C; Provisional Back     alignment and domain information
>TIGR02933 nifM_nitrog nitrogen fixation protein NifM Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PTZ00356 peptidyl-prolyl cis-trans isomerase (PPIase); Provisional Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>PF00639 Rotamase: PPIC-type PPIASE domain; InterPro: IPR000297 Peptidylprolyl isomerase (5 Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK02998 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>PRK04405 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK03095 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>KOG3258 consensus Parvulin-like peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK10788 periplasmic folding chaperone; Provisional Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>TIGR02925 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase, EpsD family Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>COG0760 SurA Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF00639 Rotamase: PPIC-type PPIASE domain; InterPro: IPR000297 Peptidylprolyl isomerase (5 Back     alignment and domain information
>PRK10788 periplasmic folding chaperone; Provisional Back     alignment and domain information
>PF13145 Rotamase_2: PPIC-type PPIASE domain; PDB: 3NRK_A 2KGJ_A Back     alignment and domain information
>KOG3259 consensus Peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13616 Rotamase_3: PPIC-type PPIASE domain; PDB: 3RFW_A 3UI5_A 3UI4_A 1FJD_A 1EQ3_A 1ZK6_A Back     alignment and domain information
>KOG3258 consensus Parvulin-like peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00356 peptidyl-prolyl cis-trans isomerase (PPIase); Provisional Back     alignment and domain information
>PRK15441 peptidyl-prolyl cis-trans isomerase C; Provisional Back     alignment and domain information
>TIGR02933 nifM_nitrog nitrogen fixation protein NifM Back     alignment and domain information
>PRK04405 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK03095 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK02998 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK03002 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>COG0760 SurA Parvulin-like peptidyl-prolyl isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
1jns_A92 Nmr Structure Of The E. Coli Peptidyl-Prolyl CisTRA 5e-14
3iwh_A103 Crystal Structure Of Rhodanese-Like Domain Protein 2e-09
3foj_A100 Crystal Structure Of Ssp1007 From Staphylococcus Sa 5e-08
1zk6_A93 Nmr Solution Structure Of B. Subtilis Prsa Ppiase L 1e-06
1yw5_A177 Peptidyl-Prolyl Isomerase Ess1 From Candida Albican 2e-06
1gn0_A108 Escherichia Coli Glpe Sulfurtransferase Soaked With 4e-06
3ui4_A101 0.8 A Resolution Crystal Structure Of Human Parvuli 5e-06
1fjd_A104 Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMER 7e-06
3icr_A588 Crystal Structure Of Oxidized Bacillus Anthracis Co 1e-05
1eq3_A96 Nmr Structure Of Human Parvulin Hpar14 Length = 96 3e-05
3rfw_A252 The Virulence Factor Peb4 And The Periplasmic Prote 3e-05
1qxn_A137 Solution Structure Of The 30 Kda Polysulfide-Sulfur 5e-05
1gmx_A108 Escherichia Coli Glpe Sulfurtransferase Length = 10 1e-04
2rqs_A97 3d Structure Of Pin From The Psychrophilic Archeon 1e-04
1m5y_A408 Crystallographic Structure Of Sura, A Molecular Cha 3e-04
>pdb|1JNS|A Chain A, Nmr Structure Of The E. Coli Peptidyl-Prolyl CisTRANS- Isomerase Parvulin 10 Length = 92 Back     alignment and structure

Iteration: 1

Score = 75.1 bits (183), Expect = 5e-14, Method: Compositional matrix adjust. Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 3/84 (3%) Query: 94 HLLVKEDDLNLLSELQRRVSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVA 153 H+LVKE+ L L +L ++ G D LA +HSICPS GG LG R+GQ+VP F++V Sbjct: 8 HILVKEEKLAL--DLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVV 65 Query: 154 FTTP-LNKVARCKTKFGWHLLQVL 176 F+ P L T+FG+H+++VL Sbjct: 66 FSCPVLEPTGPLHTQFGYHIIKVL 89
>pdb|3IWH|A Chain A, Crystal Structure Of Rhodanese-Like Domain Protein From Staphylococcus Aureus Length = 103 Back     alignment and structure
>pdb|3FOJ|A Chain A, Crystal Structure Of Ssp1007 From Staphylococcus Saprophyticus Subsp. Saprophyticus. Northeast Structural Genomics Target Syr101a Length = 100 Back     alignment and structure
>pdb|1ZK6|A Chain A, Nmr Solution Structure Of B. Subtilis Prsa Ppiase Length = 93 Back     alignment and structure
>pdb|1YW5|A Chain A, Peptidyl-Prolyl Isomerase Ess1 From Candida Albicans Length = 177 Back     alignment and structure
>pdb|1GN0|A Chain A, Escherichia Coli Glpe Sulfurtransferase Soaked With Kcn Length = 108 Back     alignment and structure
>pdb|3UI4|A Chain A, 0.8 A Resolution Crystal Structure Of Human Parvulin 14 Length = 101 Back     alignment and structure
>pdb|1FJD|A Chain A, Human Parvulin-Like Peptidyl Prolyl CisTRANS ISOMERASE, Hpar14 Length = 104 Back     alignment and structure
>pdb|3ICR|A Chain A, Crystal Structure Of Oxidized Bacillus Anthracis Coadr-Rhd Length = 588 Back     alignment and structure
>pdb|1EQ3|A Chain A, Nmr Structure Of Human Parvulin Hpar14 Length = 96 Back     alignment and structure
>pdb|3RFW|A Chain A, The Virulence Factor Peb4 And The Periplasmic Protein Cj1289 Are Two Structurally-Related Sura-Like Chaperones In The Human Pathogen Campylobacter Jejuni Length = 252 Back     alignment and structure
>pdb|1QXN|A Chain A, Solution Structure Of The 30 Kda Polysulfide-Sulfur Transferase Homodimer From Wolinella Succinogenes Length = 137 Back     alignment and structure
>pdb|1GMX|A Chain A, Escherichia Coli Glpe Sulfurtransferase Length = 108 Back     alignment and structure
>pdb|2RQS|A Chain A, 3d Structure Of Pin From The Psychrophilic Archeon Cenarcheaum Symbiosum (Cspin) Length = 97 Back     alignment and structure
>pdb|1M5Y|A Chain A, Crystallographic Structure Of Sura, A Molecular Chaperone That Facilitates Outer Membrane Porin Folding Length = 408 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 2e-37
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 4e-33
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 2e-32
3foj_A100 Uncharacterized protein; protein SSP1007, structur 4e-31
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 5e-30
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 3e-28
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 8e-27
1tq1_A129 AT5G66040, senescence-associated family protein; C 4e-26
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 7e-26
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 8e-26
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomer 7e-25
3ui4_A101 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 9e-25
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 1e-24
2rqs_A97 Parvulin-like peptidyl-prolyl isomerase; CIS/trans 4e-24
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 4e-24
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 1e-23
4g2p_A110 Chaperone SURA; structural genomics, PSI-biology, 3e-23
3rfw_A252 Cell-binding factor 2; SURA-like, chaperone; 2.20A 2e-21
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 3e-21
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 4e-21
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-proly 6e-21
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 9e-21
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 1e-20
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 5e-20
2jtq_A85 Phage shock protein E; solution structure rhodanes 8e-20
1vee_A134 Proline-rich protein family; hypothetical protein, 2e-19
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline is 5e-19
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 5e-18
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 7e-18
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 7e-18
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 9e-18
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 5e-17
3nrk_A325 LIC12922; NC domain, parvulin domain, SURA homolog 4e-16
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 5e-15
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 5e-14
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-11
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 4e-11
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 6e-15
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 3e-13
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 5e-14
3r2u_A466 Metallo-beta-lactamase family protein; structural 3e-13
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 4e-13
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 5e-13
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 4e-10
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 3e-09
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 3e-09
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 6e-07
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 4e-06
3op3_A216 M-phase inducer phosphatase 3; structural genomics 6e-06
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 2e-05
3rgc_A252 Possible periplasmic protein; ppiase, chaperone; 2 1e-04
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 4e-04
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
 Score =  128 bits (324), Expect = 2e-37
 Identities = 28/128 (21%), Positives = 47/128 (36%), Gaps = 22/128 (17%)

Query: 187 IQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQF-------------G 233
           +   +  + +          L+DVR   EV +  LP    +PL+                
Sbjct: 3   VSVTDYKRLLDS---GAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEA 59

Query: 234 SWGPDITVKFDPQKDTYVMCHHGMRSLQVAQWLQTQGFRR------VFNVSGGIHAYATK 287
            W      +       YV+C  G  S +  + LQ+    +      V +V GG+ A+A K
Sbjct: 60  IWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAK 119

Query: 288 VDPSIPTY 295
           +D + P Y
Sbjct: 120 IDGTFPQY 127


>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Length = 92 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Length = 93 Back     alignment and structure
>3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} PDB: 3ui5_A 1fjd_A 1eq3_A Length = 101 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} Length = 97 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} Length = 112 Back     alignment and structure
>4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} Length = 110 Back     alignment and structure
>3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} Length = 252 Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Length = 166 Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Length = 123 Back     alignment and structure
>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Length = 103 Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Length = 139 Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Length = 102 Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Length = 177 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Length = 111 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} Length = 325 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Length = 408 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Length = 152 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 Back     alignment and structure
>3rgc_A Possible periplasmic protein; ppiase, chaperone; 2.30A {Campylobacter jejuni} Length = 252 Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Length = 265 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.92
2lj4_A115 Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; 99.91
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.91
4g2p_A110 Chaperone SURA; structural genomics, PSI-biology, 99.91
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 99.91
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.91
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 99.9
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 99.9
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.89
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.89
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-proly 99.89
2rqs_A97 Parvulin-like peptidyl-prolyl isomerase; CIS/trans 99.89
3ui4_A101 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 99.89
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomer 99.89
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 99.88
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.88
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.88
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 99.88
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 99.88
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.87
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline is 99.87
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.87
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.87
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.87
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.87
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.86
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.86
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 99.86
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.86
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 99.83
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.83
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.83
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.83
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.82
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.8
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.79
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.79
1vee_A134 Proline-rich protein family; hypothetical protein, 99.77
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.77
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.77
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.75
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.75
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.75
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.75
3rfw_A252 Cell-binding factor 2; SURA-like, chaperone; 2.20A 99.75
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.75
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.75
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.75
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.75
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.74
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.74
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.73
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.73
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.73
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.72
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.72
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.71
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.71
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.71
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.71
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.7
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.7
3nrk_A325 LIC12922; NC domain, parvulin domain, SURA homolog 99.7
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.7
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.69
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.69
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.68
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.68
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal 99.68
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.67
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.67
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.66
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.66
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.64
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.63
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.62
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 99.59
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.57
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.57
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.44
3rgc_A252 Possible periplasmic protein; ppiase, chaperone; 2 99.35
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.3
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.21
2lj4_A115 Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; 98.55
4g2p_A110 Chaperone SURA; structural genomics, PSI-biology, 98.25
3i6c_A123 Peptidyl-prolyl CIS-trans isomerase NIMA- interact 98.02
3gpk_A112 PPIC-type peptidyl-prolyl CIS-trans isomerase; rot 98.01
3tc5_A166 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 97.9
2pv1_A103 Chaperone SURA; surviVal protein A, peptidyl-proly 97.82
2jzv_A111 Foldase protein PRSA; ppiase, parvulin, proline is 97.79
1zk6_A93 Foldase protein PRSA; alpha/beta structure, isomer 97.66
1j6y_A139 Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN 97.64
1yw5_A177 Peptidyl prolyl CIS/trans isomerase; WW-domain, pp 97.62
2kgj_A102 Peptidyl-prolyl CIS-trans isomerase D; prolyl isom 97.59
3ui4_A101 Peptidyl-prolyl CIS-trans isomerase NIMA-interact; 97.58
2rqs_A97 Parvulin-like peptidyl-prolyl isomerase; CIS/trans 97.58
1jns_A92 Peptidyl-prolyl CIS-trans isomerase C; alpha-beta 97.54
2f46_A156 Hypothetical protein; structural genomics, joint c 97.09
3nrk_A325 LIC12922; NC domain, parvulin domain, SURA homolog 96.62
3rfw_A252 Cell-binding factor 2; SURA-like, chaperone; 2.20A 96.3
1v8c_A168 MOAD related protein; riken structural genomics/pr 87.83
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
Probab=99.92  E-value=2.6e-25  Score=167.27  Aligned_cols=99  Identities=31%  Similarity=0.591  Sum_probs=88.0

Q ss_pred             cccchhHHHhhhcCCCccccceEEeccChhhhhccCCCCceecCcccccCCCCCccccCCCCCcEEEEeCCChhHHHHHH
Q 022543          185 QDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKFDPQKDTYVMCHHGMRSLQVAQ  264 (295)
Q Consensus       185 ~~is~~el~~~l~~~~~~~~~~liDvR~~~e~~~ghIpgAinip~~~l~~~~~~~~~~~~~~~~iv~~C~~g~rs~~a~~  264 (295)
                      ..++++++++.+.+.   +...+||||++.||+.||||||+|||+..|...    +..++++++||+||.+|.||..++.
T Consensus         2 k~Is~~el~~~l~~~---~~~~liDvR~~~e~~~ghIpgA~~ip~~~l~~~----~~~l~~~~~ivv~C~~G~rS~~aa~   74 (103)
T 3iwh_A            2 KSITTDELKNKLLES---KPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDN----LNSFNKNEIYYIVCAGGVRSAKVVE   74 (103)
T ss_dssp             CEECHHHHHHGGGSS---SCCEEEECSCHHHHTTCBCTTCEECCGGGGGGC----GGGCCTTSEEEEECSSSSHHHHHHH
T ss_pred             CCcCHHHHHHHHhCC---CCeEEEECCChhHHhcCccCCcccCcccchhhh----hhhhcCCCeEEEECCCCHHHHHHHH
Confidence            458899999988764   568899999999999999999999999988654    4557899999999999999999999


Q ss_pred             HHHHcCCCCeEEecchHHHcccccCCC
Q 022543          265 WLQTQGFRRVFNVSGGIHAYATKVDPS  291 (295)
Q Consensus       265 ~L~~~G~~~v~~l~GG~~~W~~~~~p~  291 (295)
                      .|++.||+++ +|.||+.+|..++.|.
T Consensus        75 ~L~~~G~~~~-~l~GG~~~W~~~g~pv  100 (103)
T 3iwh_A           75 YLEANGIDAV-NVEGGMHAWGDEGLEI  100 (103)
T ss_dssp             HHHTTTCEEE-EETTHHHHHCSSSCBC
T ss_pred             HHHHcCCCEE-EecChHHHHHHCCCcc
Confidence            9999999654 7999999999998874



>2lj4_A Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; tbpin1; NMR {Trypanosoma brucei} Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Back     alignment and structure
>2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} Back     alignment and structure
>3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} SCOP: d.26.1.1 PDB: 3ui5_A 3ui6_A 1fjd_A 1eq3_A Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3rgc_A Possible periplasmic protein; ppiase, chaperone; 2.30A {Campylobacter jejuni} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2lj4_A Peptidyl-prolyl CIS-trans isomerase/rotamase, PUT; tbpin1; NMR {Trypanosoma brucei} Back     alignment and structure
>4g2p_A Chaperone SURA; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, pcsep; 1.82A {Salmonella enterica subsp} Back     alignment and structure
>3i6c_A Peptidyl-prolyl CIS-trans isomerase NIMA- interacting 1; SBDD, small molecule, ppiase, cell cycle, nucleus, phosphoprotein, rotamase; HET: GIA; 1.30A {Homo sapiens} PDB: 3ik8_A 3ikd_A* 3ikg_A* 3jyj_A* 3kac_A* 1nmw_A Back     alignment and structure
>3gpk_A PPIC-type peptidyl-prolyl CIS-trans isomerase; rotamase,ppiase domain, 11189O3,PSI2., structural genomics; 1.55A {Novosphingobium aromaticivorans} Back     alignment and structure
>3tc5_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; PIN1 mutant (R14A), oncogenic transformation, small molecule cycle, rotamase, phosphoprotein; HET: 3T5 P6G; 1.40A {Homo sapiens} PDB: 2itk_A* 2q5a_A* 2xp3_A* 2xp4_A* 2xp5_A* 2xp7_A* 2xp8_A* 2xp9_A* 2xpa_A* 2xpb_A* 3kab_A* 3kag_A* 3kah_A* 3kai_A* 3kce_A* 3ntp_A* 3odk_A* 3oob_A* 2zr6_A* 1f8a_B* ... Back     alignment and structure
>2pv1_A Chaperone SURA; surviVal protein A, peptidyl-prolyl CIS-trans isomerase domain, peptide, complex; 1.30A {Escherichia coli} SCOP: d.26.1.1 PDB: 2pv2_A Back     alignment and structure
>2jzv_A Foldase protein PRSA; ppiase, parvulin, proline isomerase, lipoprotein, membrane, palmitate, rotamase; NMR {Staphylococcus aureus} Back     alignment and structure
>1zk6_A Foldase protein PRSA; alpha/beta structure, isomerase; NMR {Bacillus subtilis} Back     alignment and structure
>1j6y_A Peptidyl-prolyl CIS-trans isomerase; parvulin, PIN1, phosphorylation; NMR {Arabidopsis thaliana} SCOP: d.26.1.1 Back     alignment and structure
>1yw5_A Peptidyl prolyl CIS/trans isomerase; WW-domain, ppiase domain, ordered linker; 1.60A {Candida albicans} Back     alignment and structure
>2kgj_A Peptidyl-prolyl CIS-trans isomerase D; prolyl isomerase, parvulin, cell inner membrane, cell membrane, membrane, rotamase, stress response; NMR {Escherichia coli} Back     alignment and structure
>3ui4_A Peptidyl-prolyl CIS-trans isomerase NIMA-interact; peptidyl-prolyl-isomerase; 0.80A {Homo sapiens} SCOP: d.26.1.1 PDB: 3ui5_A 3ui6_A 1fjd_A 1eq3_A Back     alignment and structure
>2rqs_A Parvulin-like peptidyl-prolyl isomerase; CIS/trans isomerisation, cenarcheaum symbiosum, low temperat NIMA-kinase, PIN1, cell cycle; NMR {Cenarchaeum symbiosum} Back     alignment and structure
>1jns_A Peptidyl-prolyl CIS-trans isomerase C; alpha-beta sandwich, CIS peptide bond; NMR {Escherichia coli} SCOP: d.26.1.1 PDB: 1jnt_A Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>3nrk_A LIC12922; NC domain, parvulin domain, SURA homology, probable chaperon unknown function; 3.10A {Leptospira interrogans serovar copenhaorganism_taxid} Back     alignment and structure
>3rfw_A Cell-binding factor 2; SURA-like, chaperone; 2.20A {Campylobacter jejuni} Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 295
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 6e-20
d1qxna_137 c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf 4e-15
d1eq3a_96 d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar 4e-13
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 9e-13
d1jnsa_92 d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichi 2e-12
d1j6ya_120 d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Tha 3e-12
d1yt8a3157 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase 8e-11
d1yt8a2101 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P 3e-10
d1yt8a1136 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase 3e-10
d1m5ya3108 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase 5e-10
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 7e-10
d1pina2119 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2e-09
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 3e-09
d1ymka1174 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) 3e-08
d1e0ca2136 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte 1e-07
d2pv2a1103 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase 3e-07
d1e0ca1135 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter 1e-06
d1t3ka_132 c.46.1.1 (A:) Dual specificity phosphatase Cdc25 { 3e-06
d1rhsa2144 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [ 4e-06
d1urha2120 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtran 2e-05
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 3e-05
d1uara1143 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther 0.001
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 0.003
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Sulfurtransferase GlpE
species: Escherichia coli [TaxId: 562]
 Score = 80.9 bits (199), Expect = 6e-20
 Identities = 27/109 (24%), Positives = 46/109 (42%), Gaps = 8/109 (7%)

Query: 184 LQDIQPDELHKKMQDPNFHKEAQLIDVREPEEVALSSLPGFQVLPLRQFGSWGPDITVKF 243
            + I   + H+K+Q+      A L+D+R+P+  A+        L                
Sbjct: 4   FECINVADAHQKLQEKE----AVLVDIRDPQSFAMGHAVQAFHLTND----TLGAFMRDN 55

Query: 244 DPQKDTYVMCHHGMRSLQVAQWLQTQGFRRVFNVSGGIHAYATKVDPSI 292
           D      VMC+HG  S   AQ+L  QG+  V+++ GG  A+  +    +
Sbjct: 56  DFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEAWQRQFPAEV 104


>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure
>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Length = 92 Back     information, alignment and structure
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 120 Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 Back     information, alignment and structure
>d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Length = 103 Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 132 Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 144 Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d1jnsa_92 Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 99.9
d1pina2119 Mitotic rotamase PIN1, domain 2 {Human (Homo sapie 99.89
d1eq3a_96 Parvulin {Human (Homo sapiens), hpar14 [TaxId: 960 99.89
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.88
d1m5ya3108 Porin chaperone SurA, PPIase domains {Escherichia 99.87
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.87
d1j6ya_120 Mitotic rotamase PIN1, domain 2 {Thale cress (Arab 99.87
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.86
d2pv2a1103 Porin chaperone SurA, PPIase domains {Escherichia 99.86
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.86
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.86
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.85
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.84
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.83
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.81
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.79
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.78
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.77
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.77
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.77
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.76
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.74
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.63
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.56
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.46
d1m5ya3108 Porin chaperone SurA, PPIase domains {Escherichia 98.0
d1pina2119 Mitotic rotamase PIN1, domain 2 {Human (Homo sapie 97.92
d1j6ya_120 Mitotic rotamase PIN1, domain 2 {Thale cress (Arab 97.77
d1eq3a_96 Parvulin {Human (Homo sapiens), hpar14 [TaxId: 960 97.76
d1jnsa_92 Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 97.44
d2pv2a1103 Porin chaperone SurA, PPIase domains {Escherichia 97.15
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 85.27
>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Parvulin 10 (rotamase C)
species: Escherichia coli [TaxId: 562]
Probab=99.90  E-value=9.4e-25  Score=158.76  Aligned_cols=89  Identities=40%  Similarity=0.756  Sum_probs=83.7

Q ss_pred             ceEEEeeEEeccchHHHHHHHHHHhCCCCcHHHHHHHhCCCCCccCCCcccceeCCCCcHHHHHHHhcCCCCcee-eeee
Q 022543           88 REILVQHLLVKEDDLNLLSELQRRVSQGKDLSDLAVEHSICPSKGEGGMLGWVRKGQLVPEFEEVAFTTPLNKVA-RCKT  166 (295)
Q Consensus        88 ~~~~~~~Il~~~~~~~~a~~i~~~i~~g~~F~~~a~~~S~d~~~~~gG~lg~~~~~~~~~~~~~~~~~l~~g~is-pv~~  166 (295)
                      +.++++|||++.+++  |++++++|++|++|+++|++||+|+++.+||+|||+..++++++|.++++.|++|++| ||+|
T Consensus         2 ~~~~a~HIlv~~~~~--A~~i~~~l~~g~~F~~lA~~~S~d~s~~~gG~lG~~~~~~l~~~f~~~~~~l~~G~vs~pi~t   79 (92)
T d1jnsa_           2 KTAAALHILVKEEKL--ALDLLEQIKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVPAFDKVVFSCPVLEPTGPLHT   79 (92)
T ss_dssp             CEEEEEEEEESSHHH--HHHHHHHHHHTCCHHHHHHHHHCSTTTTTGGGCCEEETTSSCHHHHHHHHHSCTTCCEEEEEE
T ss_pred             CcceEEEEEeCCHHH--HHHHHHHHHCCCCHHHHHHHhCCCcccchhhhhceeeHhhhhhHHHHHHHhCCCCCcCCCEEe
Confidence            468999999987755  9999999999999999999999999888999999999999999999999999999999 9999


Q ss_pred             cCceeeeehhhh
Q 022543          167 KFGWHLLQVLSE  178 (295)
Q Consensus       167 ~~G~~ii~v~~~  178 (295)
                      ++||||+++.++
T Consensus        80 ~~G~HIikv~dr   91 (92)
T d1jnsa_          80 QFGYHIIKVLYR   91 (92)
T ss_dssp             TTEEEEEEEECC
T ss_pred             CCeEEEEEEEeC
Confidence            999999998764



>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m5ya3 d.26.1.1 (A:279-386) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pina2 d.26.1.1 (A:45-163) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j6ya_ d.26.1.1 (A:) Mitotic rotamase PIN1, domain 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eq3a_ d.26.1.1 (A:) Parvulin {Human (Homo sapiens), hpar14 [TaxId: 9606]} Back     information, alignment and structure
>d1jnsa_ d.26.1.1 (A:) Parvulin 10 (rotamase C) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv2a1 d.26.1.1 (A:172-274) Porin chaperone SurA, PPIase domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure