Citrus Sinensis ID: 022547
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 295 | 2.2.26 [Sep-21-2011] | |||||||
| O22682 | 404 | Probable cysteine synthas | yes | no | 0.938 | 0.685 | 0.642 | 3e-91 | |
| O81155 | 386 | Cysteine synthase, chloro | N/A | no | 0.688 | 0.525 | 0.724 | 5e-79 | |
| P31300 | 374 | Cysteine synthase, chloro | N/A | no | 0.711 | 0.561 | 0.690 | 1e-78 | |
| Q43725 | 430 | Cysteine synthase, mitoch | no | no | 0.691 | 0.474 | 0.694 | 3e-78 | |
| P32260 | 383 | Cysteine synthase, chloro | N/A | no | 0.684 | 0.527 | 0.693 | 3e-78 | |
| P47999 | 392 | Cysteine synthase, chloro | no | no | 0.681 | 0.512 | 0.716 | 8e-77 | |
| Q00834 | 325 | Cysteine synthase OS=Spin | N/A | no | 0.667 | 0.606 | 0.690 | 2e-73 | |
| P38076 | 325 | Cysteine synthase OS=Trit | N/A | no | 0.667 | 0.606 | 0.690 | 3e-72 | |
| Q9XEA8 | 325 | Cysteine synthase OS=Oryz | no | no | 0.677 | 0.615 | 0.675 | 1e-71 | |
| Q9XEA6 | 321 | Cysteine synthase OS=Oryz | no | no | 0.677 | 0.623 | 0.68 | 2e-71 |
| >sp|O22682|CYSK4_ARATH Probable cysteine synthase, chloroplastic OS=Arabidopsis thaliana GN=At3g03630 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 335 bits (858), Expect = 3e-91, Method: Compositional matrix adjust.
Identities = 185/288 (64%), Positives = 217/288 (75%), Gaps = 11/288 (3%)
Query: 14 LQLLPPHPLNIASQKRHRFARFKTS---SLSSINGALATRRRILPIVASAKAGAAASSSS 70
L+LLP PL + K HRF+ K S + +LA R + V A +G +++ +
Sbjct: 8 LRLLPQSPLGRITSKLHRFSTAKLSLFSFHHDSSSSLAVRTPVSSFVVGAISGKSSTGTK 67
Query: 71 SSLYATS--------TREIEKEEGNDFHGVNIAEDVTQLIGRTPMVYLNKVTEGCVGNVA 122
S T E++ + VNIAEDVTQLIG TPMVYLN+VT+GC+ ++A
Sbjct: 68 SKSKTKRKPPPPPPVTTVAEEQHIAESETVNIAEDVTQLIGSTPMVYLNRVTDGCLADIA 127
Query: 123 AKLESMEPCRSVKDRIGYSMITDAEESGDITPGKTVLVEPTTGNTGLGIAFVAAVKGYKL 182
AKLESMEPCRSVKDRIG SMI +AE SG ITP KTVLVEPTTGNTGLGIAFVAA KGYKL
Sbjct: 128 AKLESMEPCRSVKDRIGLSMINEAENSGAITPRKTVLVEPTTGNTGLGIAFVAAAKGYKL 187
Query: 183 IVTMPASTNLERRILLRAFGAEIILTDPEKGLRGALDKAEEIVLNTPNAYMFQQFDNMAN 242
IVTMPAS N+ERR+LLRA GAEI+LT+PEKGL+GA+DKA+EIVL T NAYMFQQFDN AN
Sbjct: 188 IVTMPASINIERRMLLRALGAEIVLTNPEKGLKGAVDKAKEIVLKTKNAYMFQQFDNTAN 247
Query: 243 LKIHFDSTGPEIWEDTLGCVDIFVAAIGTGGTITGTGRFLKMMNKEIK 290
KIHF++TGPEIWEDT+G VDIFVA IGTGGT+TGTG FLKMMNK+IK
Sbjct: 248 TKIHFETTGPEIWEDTMGNVDIFVAGIGTGGTVTGTGGFLKMMNKDIK 295
|
Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 4EC: 7 |
| >sp|O81155|CYSKP_SOLTU Cysteine synthase, chloroplastic/chromoplastic OS=Solanum tuberosum PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P31300|CYSKP_CAPAN Cysteine synthase, chloroplastic/chromoplastic OS=Capsicum annuum PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q43725|CYSKM_ARATH Cysteine synthase, mitochondrial OS=Arabidopsis thaliana GN=OASC PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|P32260|CYSKP_SPIOL Cysteine synthase, chloroplastic/chromoplastic OS=Spinacia oleracea GN=CYSK PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|P47999|CYSKP_ARATH Cysteine synthase, chloroplastic/chromoplastic OS=Arabidopsis thaliana GN=OASB PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q00834|CYSK_SPIOL Cysteine synthase OS=Spinacia oleracea PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P38076|CYSK_WHEAT Cysteine synthase OS=Triticum aestivum GN=CYS1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9XEA8|CYSK2_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9XEA6|CYSK1_ORYSJ Cysteine synthase OS=Oryza sativa subsp. japonica GN=RCS1 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 295 | ||||||
| 356571800 | 381 | PREDICTED: probable cysteine synthase, c | 0.745 | 0.577 | 0.775 | 1e-91 | |
| 356571802 | 371 | PREDICTED: probable cysteine synthase, c | 0.745 | 0.592 | 0.775 | 1e-91 | |
| 297833036 | 405 | hypothetical protein ARALYDRAFT_896375 [ | 0.938 | 0.683 | 0.643 | 1e-91 | |
| 359480989 | 390 | PREDICTED: probable cysteine synthase, c | 0.688 | 0.520 | 0.812 | 2e-90 | |
| 15228596 | 404 | cysteine synthase A [Arabidopsis thalian | 0.938 | 0.685 | 0.642 | 2e-89 | |
| 356506194 | 372 | PREDICTED: probable cysteine synthase, c | 0.684 | 0.543 | 0.831 | 4e-89 | |
| 357508933 | 368 | Cysteine synthase [Medicago truncatula] | 0.745 | 0.597 | 0.758 | 9e-89 | |
| 307136136 | 369 | cysteine synthase [Cucumis melo subsp. m | 0.674 | 0.539 | 0.809 | 4e-86 | |
| 449437666 | 369 | PREDICTED: probable cysteine synthase, c | 0.674 | 0.539 | 0.798 | 7e-85 | |
| 357125575 | 380 | PREDICTED: probable cysteine synthase, c | 0.715 | 0.555 | 0.758 | 2e-83 |
| >gi|356571800|ref|XP_003554060.1| PREDICTED: probable cysteine synthase, chloroplastic-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 342 bits (877), Expect = 1e-91, Method: Compositional matrix adjust.
Identities = 176/227 (77%), Positives = 196/227 (86%), Gaps = 7/227 (3%)
Query: 64 AAASSSSSSLYATSTREIEKEEGNDFHGVNIAEDVTQLIGRTPMVYLNKVTEGCVGNVAA 123
AA + SS+ STR+ F VNIAEDVTQLIG TPMVYLNKVTEGCV N+AA
Sbjct: 45 AAKAKVSSAPLVYSTRQ-------GFDTVNIAEDVTQLIGNTPMVYLNKVTEGCVANIAA 97
Query: 124 KLESMEPCRSVKDRIGYSMITDAEESGDITPGKTVLVEPTTGNTGLGIAFVAAVKGYKLI 183
KLESMEPCRSVKDRIGYSM++DAEE G I+PGKT+LVEPTTGNTGLGIAFVAA KGYKLI
Sbjct: 98 KLESMEPCRSVKDRIGYSMLSDAEEIGAISPGKTILVEPTTGNTGLGIAFVAATKGYKLI 157
Query: 184 VTMPASTNLERRILLRAFGAEIILTDPEKGLRGALDKAEEIVLNTPNAYMFQQFDNMANL 243
VTMPAS N+ERRILLRAFGAE++LTD EKGL+GA+DKAEEIV NTPNAYMF+QFDNM N
Sbjct: 158 VTMPASINVERRILLRAFGAEVVLTDAEKGLKGAVDKAEEIVRNTPNAYMFRQFDNMTNT 217
Query: 244 KIHFDSTGPEIWEDTLGCVDIFVAAIGTGGTITGTGRFLKMMNKEIK 290
KIHF++TGPEIWEDT+G VD+ VA IGTGGT+TGTGR+LKMMNK IK
Sbjct: 218 KIHFETTGPEIWEDTMGNVDVLVAGIGTGGTVTGTGRYLKMMNKNIK 264
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356571802|ref|XP_003554061.1| PREDICTED: probable cysteine synthase, chloroplastic-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297833036|ref|XP_002884400.1| hypothetical protein ARALYDRAFT_896375 [Arabidopsis lyrata subsp. lyrata] gi|297330240|gb|EFH60659.1| hypothetical protein ARALYDRAFT_896375 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|359480989|ref|XP_002271966.2| PREDICTED: probable cysteine synthase, chloroplastic-like [Vitis vinifera] gi|296085861|emb|CBI31185.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|15228596|ref|NP_187013.1| cysteine synthase A [Arabidopsis thaliana] gi|11131558|sp|O22682.1|CYSK4_ARATH RecName: Full=Probable cysteine synthase, chloroplastic; Short=CSase; AltName: Full=CS26; AltName: Full=O-acetylserine (thiol)-lyase; Short=OAS-TL; AltName: Full=O-acetylserine sulfhydrylase; Flags: Precursor gi|6091759|gb|AAF03469.1|AC009327_8 O-acetylserine (thiol) lyase [Arabidopsis thaliana] gi|2281780|dbj|BAA21628.1| O-acetylserine (thiol) lyase [Arabidopsis thaliana] gi|20466215|gb|AAM20425.1| O-acetylserine (thiol) lyase [Arabidopsis thaliana] gi|25084065|gb|AAN72166.1| O-acetylserine (thiol) lyase [Arabidopsis thaliana] gi|332640444|gb|AEE73965.1| cysteine synthase A [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356506194|ref|XP_003521872.1| PREDICTED: probable cysteine synthase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357508933|ref|XP_003624755.1| Cysteine synthase [Medicago truncatula] gi|355499770|gb|AES80973.1| Cysteine synthase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|307136136|gb|ADN33981.1| cysteine synthase [Cucumis melo subsp. melo] | Back alignment and taxonomy information |
|---|
| >gi|449437666|ref|XP_004136612.1| PREDICTED: probable cysteine synthase, chloroplastic-like [Cucumis sativus] gi|449523732|ref|XP_004168877.1| PREDICTED: probable cysteine synthase, chloroplastic-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|357125575|ref|XP_003564468.1| PREDICTED: probable cysteine synthase, chloroplastic-like isoform 1 [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 295 | ||||||
| TAIR|locus:2096454 | 404 | CS26 "cysteine synthase 26" [A | 0.925 | 0.675 | 0.598 | 9.7e-80 | |
| TAIR|locus:2080417 | 433 | OASC "O-acetylserine (thiol) l | 0.691 | 0.471 | 0.645 | 7.7e-71 | |
| TAIR|locus:2043964 | 392 | OASB "O-acetylserine (thiol) l | 0.705 | 0.530 | 0.652 | 1.1e-69 | |
| TAIR|locus:2130419 | 322 | OASA1 "O-acetylserine (thiol) | 0.667 | 0.611 | 0.624 | 1.1e-64 | |
| UNIPROTKB|Q1KLZ2 | 376 | CAS1 "L-3-cyanoalanine synthas | 0.688 | 0.539 | 0.546 | 1.9e-58 | |
| TAIR|locus:2114804 | 324 | CYSD1 "cysteine synthase D1" [ | 0.671 | 0.611 | 0.560 | 1.9e-58 | |
| UNIPROTKB|Q76MX2 | 351 | PCAS-1 "Bifunctional L-3-cyano | 0.677 | 0.569 | 0.55 | 2.5e-58 | |
| TAIR|locus:2143814 | 323 | CYSD2 "cysteine synthase D2" [ | 0.681 | 0.622 | 0.562 | 4e-58 | |
| UNIPROTKB|Q43153 | 368 | CYSC "Bifunctional L-3-cyanoal | 0.684 | 0.548 | 0.534 | 1.4e-57 | |
| UNIPROTKB|Q1KLZ1 | 375 | CAS2 "L-3-cyanoalanine synthas | 0.688 | 0.541 | 0.541 | 2.8e-57 |
| TAIR|locus:2096454 CS26 "cysteine synthase 26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 801 (287.0 bits), Expect = 9.7e-80, P = 9.7e-80
Identities = 170/284 (59%), Positives = 195/284 (68%)
Query: 18 PPHPLNIASQKRHRFARFKTSSLS---SINGALATRRRILPIVXXXXXXXXXXXXXXXXX 74
P PL + K HRF+ K S S + +LA R + V
Sbjct: 12 PQSPLGRITSKLHRFSTAKLSLFSFHHDSSSSLAVRTPVSSFVVGAISGKSSTGTKSKSK 71
Query: 75 XXX--------TREIEKEEGNDFHGVNIAEDVTQLIGRTPMVYLNKVTEGCVGNVAAKLE 126
T E++ + VNIAEDVTQLIG TPMVYLN+VT+GC+ ++AAKLE
Sbjct: 72 TKRKPPPPPPVTTVAEEQHIAESETVNIAEDVTQLIGSTPMVYLNRVTDGCLADIAAKLE 131
Query: 127 SMEPCRSVKDRIGYSMITDAEESGDITPGKTVLVEPTTGNTGLGIAFVAAVKGYKLIVTM 186
SMEPCRSVKDRIG SMI +AE SG ITP KTVLVEPTTGNTGLGIAFVAA KGYKLIVTM
Sbjct: 132 SMEPCRSVKDRIGLSMINEAENSGAITPRKTVLVEPTTGNTGLGIAFVAAAKGYKLIVTM 191
Query: 187 PASTNLERRILLRAFGAEIILTDPEKGLRGALDKAEEIVLNTPNAYMFQQFDNMANLKIH 246
PAS N+ERR+LLRA GAEI+LT+PEKGL+GA+DKA+EIVL T NAYMFQQFDN AN KIH
Sbjct: 192 PASINIERRMLLRALGAEIVLTNPEKGLKGAVDKAKEIVLKTKNAYMFQQFDNTANTKIH 251
Query: 247 FDSTGPEIWEDTLGCVDIFVAAXXXXXXXXXXXRFLKMMNKEIK 290
F++TGPEIWEDT+G VDIFVA FLKMMNK+IK
Sbjct: 252 FETTGPEIWEDTMGNVDIFVAGIGTGGTVTGTGGFLKMMNKDIK 295
|
|
| TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043964 OASB "O-acetylserine (thiol) lyase B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q76MX2 PCAS-1 "Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial" [Solanum tuberosum (taxid:4113)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q43153 CYSC "Bifunctional L-3-cyanoalanine synthase/cysteine synthase, mitochondrial" [Spinacia oleracea (taxid:3562)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1KLZ1 CAS2 "L-3-cyanoalanine synthase 2, mitochondrial" [Malus x domestica (taxid:3750)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| O32978 | CYSK_MYCLE | 2, ., 5, ., 1, ., 4, 7 | 0.5520 | 0.6474 | 0.6161 | yes | no |
| O22682 | CYSK4_ARATH | 2, ., 5, ., 1, ., 4, 7 | 0.6423 | 0.9389 | 0.6856 | yes | no |
| Q7DDL5 | CYSK_NEIMB | 2, ., 5, ., 1, ., 4, 7 | 0.535 | 0.6711 | 0.6387 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
|||
 | scaffold_300345.1 | annotation not avaliable (405 aa) | |||||||||
(Arabidopsis lyrata) | |||||||||||
 | fgenesh2_kg.1__4616__AT1G55920.1 | • | • | • | • | 0.515 | |||||
 | fgenesh2_kg.8__1583__AT5G56760.1 | • | • | • | • | 0.495 | |||||
 | scaffold_600403.1 | • | • | • | 0.477 | ||||||
 | fgenesh2_kg.5__2142__AT3G57050.2 | • | • | • | 0.474 | ||||||
 | scaffold_802953.1 | • | 0.414 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 295 | |||
| PLN02565 | 322 | PLN02565, PLN02565, cysteine synthase | 1e-107 | |
| PLN03013 | 429 | PLN03013, PLN03013, cysteine synthase | 2e-99 | |
| PLN02556 | 368 | PLN02556, PLN02556, cysteine synthase/L-3-cyanoala | 6e-98 | |
| TIGR01136 | 299 | TIGR01136, cysKM, cysteine synthase | 1e-95 | |
| PLN00011 | 323 | PLN00011, PLN00011, cysteine synthase | 7e-93 | |
| TIGR01139 | 298 | TIGR01139, cysK, cysteine synthase A | 4e-91 | |
| cd01561 | 291 | cd01561, CBS_like, CBS_like: This subgroup include | 3e-89 | |
| COG0031 | 300 | COG0031, CysK, Cysteine synthase [Amino acid trans | 1e-88 | |
| PRK10717 | 330 | PRK10717, PRK10717, cysteine synthase A; Provision | 2e-74 | |
| PRK11761 | 296 | PRK11761, cysM, cysteine synthase B; Provisional | 2e-65 | |
| TIGR01137 | 454 | TIGR01137, cysta_beta, cystathionine beta-synthase | 2e-62 | |
| TIGR01138 | 290 | TIGR01138, cysM, cysteine synthase B | 6e-61 | |
| cd00640 | 244 | cd00640, Trp-synth-beta_II, Tryptophan synthase be | 4e-58 | |
| TIGR03945 | 304 | TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio | 6e-45 | |
| pfam00291 | 295 | pfam00291, PALP, Pyridoxal-phosphate dependent enz | 3e-42 | |
| PLN02356 | 423 | PLN02356, PLN02356, phosphateglycerate kinase | 2e-28 | |
| COG1171 | 347 | COG1171, IlvA, Threonine dehydratase [Amino acid t | 2e-14 | |
| TIGR01127 | 380 | TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, m | 2e-10 | |
| cd01563 | 324 | cd01563, Thr-synth_1, Threonine synthase is a pyri | 4e-10 | |
| PRK08638 | 333 | PRK08638, PRK08638, threonine dehydratase; Validat | 2e-09 | |
| cd01562 | 304 | cd01562, Thr-dehyd, Threonine dehydratase: The fir | 2e-09 | |
| COG0498 | 411 | COG0498, ThrC, Threonine synthase [Amino acid tran | 3e-08 | |
| PRK06382 | 406 | PRK06382, PRK06382, threonine dehydratase; Provisi | 2e-07 | |
| TIGR02079 | 409 | TIGR02079, THD1, threonine dehydratase | 5e-06 | |
| PRK06721 | 352 | PRK06721, PRK06721, threonine synthase; Reviewed | 1e-05 | |
| TIGR01124 | 499 | TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, b | 2e-05 | |
| PRK08526 | 403 | PRK08526, PRK08526, threonine dehydratase; Provisi | 2e-05 | |
| TIGR03528 | 396 | TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammoni | 3e-05 | |
| PRK06381 | 319 | PRK06381, PRK06381, threonine synthase; Validated | 3e-05 | |
| PRK08198 | 404 | PRK08198, PRK08198, threonine dehydratase; Provisi | 9e-05 | |
| TIGR00260 | 328 | TIGR00260, thrC, threonine synthase | 1e-04 | |
| PRK08639 | 420 | PRK08639, PRK08639, threonine dehydratase; Validat | 1e-04 | |
| TIGR01747 | 376 | TIGR01747, diampropi_NH3ly, diaminopropionate ammo | 3e-04 | |
| PRK06260 | 397 | PRK06260, PRK06260, threonine synthase; Validated | 3e-04 | |
| PRK05638 | 442 | PRK05638, PRK05638, threonine synthase; Validated | 3e-04 | |
| PRK08329 | 347 | PRK08329, PRK08329, threonine synthase; Validated | 5e-04 | |
| COG0604 | 326 | COG0604, Qor, NADPH:quinone reductase and related | 0.001 | |
| PRK08206 | 399 | PRK08206, PRK08206, diaminopropionate ammonia-lyas | 0.001 | |
| PRK08246 | 310 | PRK08246, PRK08246, threonine dehydratase; Provisi | 0.001 | |
| PRK08197 | 394 | PRK08197, PRK08197, threonine synthase; Validated | 0.002 | |
| PRK06608 | 338 | PRK06608, PRK06608, threonine dehydratase; Provisi | 0.002 | |
| PRK06815 | 317 | PRK06815, PRK06815, hypothetical protein; Provisio | 0.002 | |
| TIGR02991 | 317 | TIGR02991, ectoine_eutB, ectoine utilization prote | 0.002 | |
| PRK12483 | 521 | PRK12483, PRK12483, threonine dehydratase; Reviewe | 0.004 |
| >gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase | Back alignment and domain information |
|---|
Score = 314 bits (805), Expect = e-107
Identities = 136/197 (69%), Positives = 169/197 (85%)
Query: 94 IAEDVTQLIGRTPMVYLNKVTEGCVGNVAAKLESMEPCRSVKDRIGYSMITDAEESGDIT 153
IA+DVT+LIG+TP+VYLN V +GCV +AAKLE MEPC SVKDRIGYSMITDAEE G I
Sbjct: 5 IAKDVTELIGKTPLVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIGYSMITDAEEKGLIK 64
Query: 154 PGKTVLVEPTTGNTGLGIAFVAAVKGYKLIVTMPASTNLERRILLRAFGAEIILTDPEKG 213
PG++VL+EPT+GNTG+G+AF+AA KGYKLI+TMPAS +LERRI+L AFGAE++LTDP KG
Sbjct: 65 PGESVLIEPTSGNTGIGLAFMAAAKGYKLIITMPASMSLERRIILLAFGAELVLTDPAKG 124
Query: 214 LRGALDKAEEIVLNTPNAYMFQQFDNMANLKIHFDSTGPEIWEDTLGCVDIFVAAIGTGG 273
++GA+ KAEEI+ TPN+Y+ QQF+N AN KIH+++TGPEIW+ T G VD FV+ IGTGG
Sbjct: 125 MKGAVQKAEEILAKTPNSYILQQFENPANPKIHYETTGPEIWKGTGGKVDAFVSGIGTGG 184
Query: 274 TITGTGRFLKMMNKEIK 290
TITG G++LK N +IK
Sbjct: 185 TITGAGKYLKEQNPDIK 201
|
Length = 322 |
| >gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A | Back alignment and domain information |
|---|
| >gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase | Back alignment and domain information |
|---|
| >gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B | Back alignment and domain information |
|---|
| >gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions | Back alignment and domain information |
|---|
| >gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA | Back alignment and domain information |
|---|
| >gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase | Back alignment and domain information |
|---|
| >gnl|CDD|224092 COG1171, IlvA, Threonine dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|130197 TIGR01127, ilvA_1Cterm, threonine ammonia-lyase, medium form | Back alignment and domain information |
|---|
| >gnl|CDD|107206 cd01563, Thr-synth_1, Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate | Back alignment and domain information |
|---|
| >gnl|CDD|236317 PRK08638, PRK08638, threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|107205 cd01562, Thr-dehyd, Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen | Back alignment and domain information |
|---|
| >gnl|CDD|223572 COG0498, ThrC, Threonine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|180550 PRK06382, PRK06382, threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233712 TIGR02079, THD1, threonine dehydratase | Back alignment and domain information |
|---|
| >gnl|CDD|136018 PRK06721, PRK06721, threonine synthase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|130194 TIGR01124, ilvA_2Cterm, threonine ammonia-lyase, biosynthetic, long form | Back alignment and domain information |
|---|
| >gnl|CDD|181457 PRK08526, PRK08526, threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234245 TIGR03528, 2_3_DAP_am_ly, diaminopropionate ammonia-lyase | Back alignment and domain information |
|---|
| >gnl|CDD|235789 PRK06381, PRK06381, threonine synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236182 PRK08198, PRK08198, threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232896 TIGR00260, thrC, threonine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|236318 PRK08639, PRK08639, threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130808 TIGR01747, diampropi_NH3ly, diaminopropionate ammonia-lyase family | Back alignment and domain information |
|---|
| >gnl|CDD|235757 PRK06260, PRK06260, threonine synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235539 PRK05638, PRK05638, threonine synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236244 PRK08329, PRK08329, threonine synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236186 PRK08206, PRK08206, diaminopropionate ammonia-lyase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181319 PRK08246, PRK08246, threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181283 PRK08197, PRK08197, threonine synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235842 PRK06608, PRK06608, threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180709 PRK06815, PRK06815, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132036 TIGR02991, ectoine_eutB, ectoine utilization protein EutB | Back alignment and domain information |
|---|
| >gnl|CDD|237111 PRK12483, PRK12483, threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 295 | |||
| COG0031 | 300 | CysK Cysteine synthase [Amino acid transport and m | 100.0 | |
| PLN03013 | 429 | cysteine synthase | 100.0 | |
| PLN02556 | 368 | cysteine synthase/L-3-cyanoalanine synthase | 100.0 | |
| PLN02565 | 322 | cysteine synthase | 100.0 | |
| PRK11761 | 296 | cysM cysteine synthase B; Provisional | 100.0 | |
| KOG1252 | 362 | consensus Cystathionine beta-synthase and related | 100.0 | |
| PLN00011 | 323 | cysteine synthase | 100.0 | |
| TIGR01138 | 290 | cysM cysteine synthase B. Alternate name: O-acetyl | 100.0 | |
| TIGR01136 | 299 | cysKM cysteine synthases. This model discriminates | 100.0 | |
| PRK10717 | 330 | cysteine synthase A; Provisional | 100.0 | |
| TIGR01139 | 298 | cysK cysteine synthase A. This model distinguishes | 100.0 | |
| COG1171 | 347 | IlvA Threonine dehydratase [Amino acid transport a | 100.0 | |
| PRK07476 | 322 | eutB threonine dehydratase; Provisional | 100.0 | |
| PLN02970 | 328 | serine racemase | 100.0 | |
| PLN02356 | 423 | phosphateglycerate kinase | 100.0 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 100.0 | |
| cd01561 | 291 | CBS_like CBS_like: This subgroup includes Cystathi | 100.0 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 100.0 | |
| PRK08526 | 403 | threonine dehydratase; Provisional | 100.0 | |
| TIGR02991 | 317 | ectoine_eutB ectoine utilization protein EutB. Mem | 100.0 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 100.0 | |
| PRK08638 | 333 | threonine dehydratase; Validated | 100.0 | |
| PRK06110 | 322 | hypothetical protein; Provisional | 100.0 | |
| cd06447 | 404 | D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph | 100.0 | |
| PRK12483 | 521 | threonine dehydratase; Reviewed | 100.0 | |
| PRK07048 | 321 | serine/threonine dehydratase; Validated | 100.0 | |
| PRK06608 | 338 | threonine dehydratase; Provisional | 100.0 | |
| PLN02550 | 591 | threonine dehydratase | 100.0 | |
| cd01562 | 304 | Thr-dehyd Threonine dehydratase: The first step in | 100.0 | |
| PRK06352 | 351 | threonine synthase; Validated | 100.0 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 100.0 | |
| PRK06381 | 319 | threonine synthase; Validated | 100.0 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 100.0 | |
| cd06448 | 316 | L-Ser-dehyd Serine dehydratase is a pyridoxal phos | 100.0 | |
| PRK08639 | 420 | threonine dehydratase; Validated | 100.0 | |
| TIGR02079 | 409 | THD1 threonine dehydratase. This model represents | 100.0 | |
| TIGR01124 | 499 | ilvA_2Cterm threonine ammonia-lyase, biosynthetic, | 100.0 | |
| PRK02991 | 441 | D-serine dehydratase; Provisional | 100.0 | |
| TIGR02035 | 431 | D_Ser_am_lyase D-serine ammonia-lyase. This family | 100.0 | |
| PRK06815 | 317 | hypothetical protein; Provisional | 100.0 | |
| KOG1250 | 457 | consensus Threonine/serine dehydratases [Amino aci | 100.0 | |
| cd01563 | 324 | Thr-synth_1 Threonine synthase is a pyridoxal phos | 100.0 | |
| PRK09224 | 504 | threonine dehydratase; Reviewed | 100.0 | |
| PRK08246 | 310 | threonine dehydratase; Provisional | 100.0 | |
| PRK07409 | 353 | threonine synthase; Validated | 100.0 | |
| PRK08197 | 394 | threonine synthase; Validated | 100.0 | |
| PRK08813 | 349 | threonine dehydratase; Provisional | 100.0 | |
| cd00640 | 244 | Trp-synth-beta_II Tryptophan synthase beta superfa | 100.0 | |
| PRK07591 | 421 | threonine synthase; Validated | 100.0 | |
| PRK06721 | 352 | threonine synthase; Reviewed | 100.0 | |
| PRK12391 | 427 | tryptophan synthase subunit beta; Reviewed | 100.0 | |
| PRK05638 | 442 | threonine synthase; Validated | 100.0 | |
| PRK06260 | 397 | threonine synthase; Validated | 100.0 | |
| TIGR01415 | 419 | trpB_rel pyridoxal-phosphate dependent TrpB-like e | 100.0 | |
| PRK06450 | 338 | threonine synthase; Validated | 100.0 | |
| PRK08206 | 399 | diaminopropionate ammonia-lyase; Provisional | 100.0 | |
| PLN02569 | 484 | threonine synthase | 100.0 | |
| PRK08329 | 347 | threonine synthase; Validated | 100.0 | |
| KOG1481 | 391 | consensus Cysteine synthase [Amino acid transport | 100.0 | |
| TIGR01747 | 376 | diampropi_NH3ly diaminopropionate ammonia-lyase fa | 100.0 | |
| TIGR01275 | 311 | ACC_deam_rel pyridoxal phosphate-dependent enzymes | 100.0 | |
| TIGR00260 | 328 | thrC threonine synthase. Involved in threonine bio | 100.0 | |
| TIGR03528 | 396 | 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem | 100.0 | |
| TIGR00263 | 385 | trpB tryptophan synthase, beta subunit. Tryptophan | 100.0 | |
| PRK03910 | 331 | D-cysteine desulfhydrase; Validated | 100.0 | |
| PRK13028 | 402 | tryptophan synthase subunit beta; Provisional | 100.0 | |
| PRK04346 | 397 | tryptophan synthase subunit beta; Validated | 100.0 | |
| cd06446 | 365 | Trp-synth_B Tryptophan synthase-beta: Trptophan sy | 100.0 | |
| PRK13802 | 695 | bifunctional indole-3-glycerol phosphate synthase/ | 100.0 | |
| PF00291 | 306 | PALP: Pyridoxal-phosphate dependent enzyme; InterP | 100.0 | |
| PRK14045 | 329 | 1-aminocyclopropane-1-carboxylate deaminase; Provi | 100.0 | |
| PLN02618 | 410 | tryptophan synthase, beta chain | 100.0 | |
| PRK12390 | 337 | 1-aminocyclopropane-1-carboxylate deaminase; Provi | 100.0 | |
| KOG1251 | 323 | consensus Serine racemase [Signal transduction mec | 100.0 | |
| cd06449 | 307 | ACCD Aminocyclopropane-1-carboxylate deaminase (AC | 100.0 | |
| TIGR01274 | 337 | ACC_deam 1-aminocyclopropane-1-carboxylate deamina | 100.0 | |
| PRK13803 | 610 | bifunctional phosphoribosylanthranilate isomerase/ | 100.0 | |
| TIGR03844 | 398 | cysteate_syn cysteate synthase. Members of this fa | 100.0 | |
| COG0498 | 411 | ThrC Threonine synthase [Amino acid transport and | 99.97 | |
| COG0133 | 396 | TrpB Tryptophan synthase beta chain [Amino acid tr | 99.95 | |
| COG2515 | 323 | Acd 1-aminocyclopropane-1-carboxylate deaminase [A | 99.95 | |
| COG1350 | 432 | Predicted alternative tryptophan synthase beta-sub | 99.95 | |
| KOG1395 | 477 | consensus Tryptophan synthase beta chain [Amino ac | 99.94 | |
| PRK09225 | 462 | threonine synthase; Validated | 99.88 | |
| cd01560 | 460 | Thr-synth_2 Threonine synthase catalyzes the final | 99.87 | |
| COG3048 | 443 | DsdA D-serine dehydratase [Amino acid transport an | 99.66 | |
| PF00107 | 130 | ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: | 93.47 | |
| PF03808 | 172 | Glyco_tran_WecB: Glycosyl transferase WecB/TagA/Cp | 91.46 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 91.06 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 90.67 | |
| PRK15408 | 336 | autoinducer 2-binding protein lsrB; Provisional | 90.5 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 90.23 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 89.81 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 89.11 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 89.06 | |
| cd08287 | 345 | FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik | 89.04 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 88.95 | |
| TIGR02819 | 393 | fdhA_non_GSH formaldehyde dehydrogenase, glutathio | 88.85 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co | 88.69 | |
| PF00764 | 388 | Arginosuc_synth: Arginosuccinate synthase; InterPr | 88.68 | |
| cd06533 | 171 | Glyco_transf_WecG_TagA The glycosyltransferase Wec | 88.0 | |
| cd08277 | 365 | liver_alcohol_DH_like Liver alcohol dehydrogenase. | 87.94 | |
| TIGR02818 | 368 | adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr | 87.85 | |
| cd08285 | 351 | NADP_ADH NADP(H)-dependent alcohol dehydrogenases. | 87.47 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 87.4 | |
| PLN02740 | 381 | Alcohol dehydrogenase-like | 87.32 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 86.93 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 86.22 | |
| TIGR00670 | 301 | asp_carb_tr aspartate carbamoyltransferase. Ornith | 85.61 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 85.18 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 85.14 | |
| cd08274 | 350 | MDR9 Medium chain dehydrogenases/reductase (MDR)/z | 85.09 | |
| PRK10669 | 558 | putative cation:proton antiport protein; Provision | 85.02 | |
| PRK03659 | 601 | glutathione-regulated potassium-efflux system prot | 84.92 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 84.66 | |
| PRK03562 | 621 | glutathione-regulated potassium-efflux system prot | 84.54 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 84.53 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 84.44 | |
| cd08301 | 369 | alcohol_DH_plants Plant alcohol dehydrogenase. NAD | 84.09 | |
| cd08256 | 350 | Zn_ADH2 Alcohol dehydrogenases of the MDR family. | 83.91 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 83.8 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 83.72 | |
| COG2130 | 340 | Putative NADP-dependent oxidoreductases [General f | 83.53 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 83.23 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 83.12 | |
| cd08297 | 341 | CAD3 Cinnamyl alcohol dehydrogenases (CAD). These | 83.08 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 83.08 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 83.01 | |
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 82.87 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 82.87 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 82.78 | |
| PF07279 | 218 | DUF1442: Protein of unknown function (DUF1442); In | 82.73 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 82.72 | |
| TIGR00696 | 177 | wecB_tagA_cpsF bacterial polymer biosynthesis prot | 82.7 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 82.53 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 82.53 | |
| cd08233 | 351 | butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog | 82.29 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 82.12 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 82.1 | |
| cd08296 | 333 | CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci | 81.95 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 81.86 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 81.78 | |
| cd08231 | 361 | MDR_TM0436_like Hypothetical enzyme TM0436 resembl | 81.77 | |
| cd06324 | 305 | PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-b | 81.5 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 81.41 | |
| TIGR02822 | 329 | adh_fam_2 zinc-binding alcohol dehydrogenase famil | 81.39 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 81.22 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 81.02 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 80.68 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 80.67 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 80.59 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 80.39 |
| >COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.2e-51 Score=373.28 Aligned_cols=199 Identities=50% Similarity=0.813 Sum_probs=189.8
Q ss_pred hhhhcccCCCCceeccccccCCCCeEEEEeCCCCCCCchHHHHHHHHHHHHHHcCCCCCCCeEEEEeCCCccHHHHHHHH
Q 022547 96 EDVTQLIGRTPMVYLNKVTEGCVGNVAAKLESMEPCRSVKDRIGYSMITDAEESGDITPGKTVLVEPTTGNTGLGIAFVA 175 (295)
Q Consensus 96 ~~i~~~~~~TPLv~l~~l~~~~g~~I~~K~E~~nptGS~K~R~a~~~l~~a~~~g~~~~g~~~vv~aSsGN~g~AlA~aa 175 (295)
+.+.+.+++|||++++++....+++||+|+|++||+||.|||.|.+||.+|+++|.|+||+ +|||+||||+|++||++|
T Consensus 3 ~~~~~~iG~TPlvrL~~~~~~~~~~i~~KlE~~NP~gSvKDR~A~~mI~~Ae~~G~l~pG~-tIVE~TSGNTGI~LA~va 81 (300)
T COG0031 3 ESILDLIGNTPLVRLNRLSPGTGVEIYAKLESFNPGGSVKDRIALYMIEDAEKRGLLKPGG-TIVEATSGNTGIALAMVA 81 (300)
T ss_pred cchHHHhCCCCcEeecccCCCCCceEEEEhhhcCCCCchhHHHHHHHHHHHHHcCCCCCCC-EEEEcCCChHHHHHHHHH
Confidence 3577889999999999999888899999999999999999999999999999999999995 699999999999999999
Q ss_pred HHcCCeEEEEECCCCCHHHHHHHHhCCCEEEEeCCCCC-hHHHHHHHHHHHHcCCC-eEEecCCCChHHHHHHHHHHHHH
Q 022547 176 AVKGYKLIVTMPASTNLERRILLRAFGAEIILTDPEKG-LRGALDKAEEIVLNTPN-AYMFQQFDNMANLKIHFDSTGPE 253 (295)
Q Consensus 176 ~~~Gi~~~ivvp~~~~~~~~~~l~~~GA~Vv~v~~~~~-~~~a~~~a~~~a~~~~~-~~~~~~~~n~~~~~~Gy~t~~~E 253 (295)
+.+|+++++|||++++.+|+++|++|||+|+.++...+ +..+++++.+++++.++ .++.+||+|++||.+||.|++.|
T Consensus 82 a~~Gy~~iivmP~~~S~er~~~l~a~GAevi~t~~~~g~~~~a~~~a~el~~~~p~~~~~~~Qf~NpaN~~aH~~tT~~E 161 (300)
T COG0031 82 AAKGYRLIIVMPETMSQERRKLLRALGAEVILTPGAPGNMKGAIERAKELAAEIPGYAVWLNQFENPANPEAHYETTGPE 161 (300)
T ss_pred HHcCCcEEEEeCCCCCHHHHHHHHHcCCEEEEcCCCCCchHHHHHHHHHHHHhCCCceEchhhcCCCccHHHHHhhhHHH
Confidence 99999999999999999999999999999999998444 89999999999999888 77888999999999999999999
Q ss_pred HHHhhCCCCCEEEEcCCchHHHHHHHHHHHhcCCCCEEEEeC
Q 022547 254 IWEDTLGCVDIFVAAIGTGGTITGTGRFLKMMNKEIKARILL 295 (295)
Q Consensus 254 I~~Ql~~~~d~vv~pvGtGgt~aGi~~~lk~~~~~vkVigV~ 295 (295)
|++|+++.+|+||+++|||||++|++++||+.+|+++||+||
T Consensus 162 I~~~~~g~~d~fVagvGTGGTitGvar~Lk~~~p~i~iv~vd 203 (300)
T COG0031 162 IWQQTDGKVDAFVAGVGTGGTITGVARYLKERNPNVRIVAVD 203 (300)
T ss_pred HHHHhCCCCCEEEEeCCcchhHHHHHHHHHhhCCCcEEEEEC
Confidence 999998889999999999999999999999999999999997
|
|
| >PLN03013 cysteine synthase | Back alignment and domain information |
|---|
| >PLN02556 cysteine synthase/L-3-cyanoalanine synthase | Back alignment and domain information |
|---|
| >PLN02565 cysteine synthase | Back alignment and domain information |
|---|
| >PRK11761 cysM cysteine synthase B; Provisional | Back alignment and domain information |
|---|
| >KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00011 cysteine synthase | Back alignment and domain information |
|---|
| >TIGR01138 cysM cysteine synthase B | Back alignment and domain information |
|---|
| >TIGR01136 cysKM cysteine synthases | Back alignment and domain information |
|---|
| >PRK10717 cysteine synthase A; Provisional | Back alignment and domain information |
|---|
| >TIGR01139 cysK cysteine synthase A | Back alignment and domain information |
|---|
| >COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07476 eutB threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02970 serine racemase | Back alignment and domain information |
|---|
| >PLN02356 phosphateglycerate kinase | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >PRK08526 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02991 ectoine_eutB ectoine utilization protein EutB | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08638 threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK06110 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia | Back alignment and domain information |
|---|
| >PRK12483 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PRK07048 serine/threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK06608 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02550 threonine dehydratase | Back alignment and domain information |
|---|
| >cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen | Back alignment and domain information |
|---|
| >PRK06352 threonine synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK06381 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia | Back alignment and domain information |
|---|
| >PRK08639 threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >TIGR02079 THD1 threonine dehydratase | Back alignment and domain information |
|---|
| >TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form | Back alignment and domain information |
|---|
| >PRK02991 D-serine dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase | Back alignment and domain information |
|---|
| >PRK06815 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate | Back alignment and domain information |
|---|
| >PRK09224 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PRK08246 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07409 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK08197 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK08813 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions | Back alignment and domain information |
|---|
| >PRK07591 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK06721 threonine synthase; Reviewed | Back alignment and domain information |
|---|
| >PRK12391 tryptophan synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK05638 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK06260 threonine synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme | Back alignment and domain information |
|---|
| >PRK06450 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK08206 diaminopropionate ammonia-lyase; Provisional | Back alignment and domain information |
|---|
| >PLN02569 threonine synthase | Back alignment and domain information |
|---|
| >PRK08329 threonine synthase; Validated | Back alignment and domain information |
|---|
| >KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family | Back alignment and domain information |
|---|
| >TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family | Back alignment and domain information |
|---|
| >TIGR00260 thrC threonine synthase | Back alignment and domain information |
|---|
| >TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase | Back alignment and domain information |
|---|
| >TIGR00263 trpB tryptophan synthase, beta subunit | Back alignment and domain information |
|---|
| >PRK03910 D-cysteine desulfhydrase; Validated | Back alignment and domain information |
|---|
| >PRK13028 tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK04346 tryptophan synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions | Back alignment and domain information |
|---|
| >PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) | Back alignment and domain information |
|---|
| >PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional | Back alignment and domain information |
|---|
| >PLN02618 tryptophan synthase, beta chain | Back alignment and domain information |
|---|
| >PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional | Back alignment and domain information |
|---|
| >KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia | Back alignment and domain information |
|---|
| >TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase | Back alignment and domain information |
|---|
| >PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR03844 cysteate_syn cysteate synthase | Back alignment and domain information |
|---|
| >COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09225 threonine synthase; Validated | Back alignment and domain information |
|---|
| >cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis | Back alignment and domain information |
|---|
| >COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 | Back alignment and domain information |
|---|
| >PF03808 Glyco_tran_WecB: Glycosyl transferase WecB/TagA/CpsF family; InterPro: IPR004629 The WecG member of this superfamily, believed to be UDP-N-acetyl-D-mannosaminuronic acid transferase, plays a role in Enterobacterial common antigen (eca) synthesis in Escherichia coli | Back alignment and domain information |
|---|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >PRK15408 autoinducer 2-binding protein lsrB; Provisional | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >PRK10309 galactitol-1-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent | Back alignment and domain information |
|---|
| >TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PF00764 Arginosuc_synth: Arginosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 | Back alignment and domain information |
|---|
| >cd06533 Glyco_transf_WecG_TagA The glycosyltransferase WecG/TagA superfamily contains Escherichia coli WecG, Bacillus subtilis TagA and related proteins | Back alignment and domain information |
|---|
| >cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >PLN02740 Alcohol dehydrogenase-like | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR00670 asp_carb_tr aspartate carbamoyltransferase | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PRK10669 putative cation:proton antiport protein; Provisional | Back alignment and domain information |
|---|
| >PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08301 alcohol_DH_plants Plant alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF07279 DUF1442: Protein of unknown function (DUF1442); InterPro: IPR009902 This family consists of several hypothetical Arabidopsis thaliana proteins of around 225 residues in length | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00696 wecB_tagA_cpsF bacterial polymer biosynthesis proteins, WecB/TagA/CpsF family | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) | Back alignment and domain information |
|---|
| >cd06324 PBP1_ABC_sugar_binding_like_13 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 295 | ||||
| 4aec_A | 430 | Crystal Structure Of The Arabidopsis Thaliana O-Ace | 9e-79 | ||
| 1z7w_A | 322 | Crystal Structure Of O-Acetylserine Sulfhydrylase F | 2e-71 | ||
| 2isq_A | 320 | Crystal Structure Of O-Acetylserine Sulfhydrylase F | 2e-71 | ||
| 1z7y_A | 322 | Crystal Structure Of The Arabidopsis Thaliana O-Ace | 1e-70 | ||
| 3vbe_A | 344 | Crystal Structure Of Beta-Cyanoalanine Synthase In | 3e-67 | ||
| 3vc3_A | 344 | Crystal Structure Of Beta-Cyanoalanine Synthase K95 | 1e-66 | ||
| 2q3d_A | 313 | 2.2 A Resolution Crystal Structure Of O-acetylserin | 8e-48 | ||
| 2q3b_A | 313 | 1.8 A Resolution Crystal Structure Of O-Acetylserin | 4e-47 | ||
| 3rr2_A | 314 | Structure Of A Cysteine Synthase (O-Acetylserine Su | 9e-47 | ||
| 4i1y_A | 314 | The Structure Of Cysteine Synthase From Mycobacteri | 3e-46 | ||
| 1oas_A | 322 | O-Acetylserine Sulfhydrylase From Salmonella Typhim | 4e-46 | ||
| 1d6s_A | 322 | Crystal Structure Of The K41a Mutant Of O-Acetylser | 2e-45 | ||
| 4air_A | 354 | Leishmania Major Cysteine Synthase Length = 354 | 1e-44 | ||
| 3t4p_A | 334 | Crystal Structure Of O-Acetyl Serine Sulfhydrylase | 6e-44 | ||
| 2egu_A | 308 | Crystal Structure Of O-Acetylserine Sulfhydrase Fro | 6e-40 | ||
| 1ve1_A | 304 | Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh | 2e-39 | ||
| 1y7l_A | 316 | O-Acetylserine Sulfhydrylase Complex Length = 316 | 1e-36 | ||
| 2bhs_A | 303 | Crystal Structure Of Cysteine Synthase B Length = 3 | 2e-35 | ||
| 2v03_A | 303 | High Resolution Structure And Catalysis Of An O- Ac | 1e-34 | ||
| 2bht_A | 303 | Crystal Structure Of O-Acetylserine Sulfhydrylase B | 2e-34 | ||
| 2jc3_A | 303 | Structure Of O-acetylserine Sulfhydrylase B From Sa | 7e-34 | ||
| 3pc2_A | 527 | Full Length Structure Of Cystathionine Beta-Synthas | 2e-30 | ||
| 3bm5_A | 338 | Crystal Structure Of O-Acetyl-Serine Sulfhydrylase | 9e-30 | ||
| 3dwg_A | 325 | Crystal Structure Of A Sulfur Carrier Protein Compl | 1e-29 | ||
| 2pqm_A | 343 | Crystal Structure Of Cysteine Synthase (Oass) From | 1e-29 | ||
| 3dwi_A | 323 | Crystal Structure Of Mycobacterium Tuberculosis Cys | 2e-29 | ||
| 3fca_A | 291 | Genetic Incorporation Of A Metal-Ion Chelating Amin | 2e-29 | ||
| 1o58_A | 303 | Crystal Structure Of O-Acetylserine Sulfhydrylase ( | 3e-29 | ||
| 3dki_A | 326 | 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobac | 5e-29 | ||
| 1m54_A | 363 | Cystathionine-Beta Synthase: Reduced Vicinal Thiols | 1e-28 | ||
| 1jbq_A | 435 | Structure Of Human Cystathionine Beta-Synthase: A U | 2e-28 | ||
| 1tdj_A | 514 | Threonine Deaminase (Biosynthetic) From E. Coli Len | 7e-05 | ||
| 1wkv_A | 389 | Crystal Structure Of O-Phosphoserine Sulfhydrylase | 4e-04 |
| >pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 | Back alignment and structure |
|
| >pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 | Back alignment and structure |
| >pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 | Back alignment and structure |
| >pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 | Back alignment and structure |
| >pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 | Back alignment and structure |
| >pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 | Back alignment and structure |
| >pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 | Back alignment and structure |
| >pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 | Back alignment and structure |
| >pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 | Back alignment and structure |
| >pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 | Back alignment and structure |
| >pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 | Back alignment and structure |
| >pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 | Back alignment and structure |
| >pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 | Back alignment and structure |
| >pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 | Back alignment and structure |
| >pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 | Back alignment and structure |
| >pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 | Back alignment and structure |
| >pdb|1Y7L|A Chain A, O-Acetylserine Sulfhydrylase Complex Length = 316 | Back alignment and structure |
| >pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 | Back alignment and structure |
| >pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 | Back alignment and structure |
| >pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 | Back alignment and structure |
| >pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 | Back alignment and structure |
| >pdb|3PC2|A Chain A, Full Length Structure Of Cystathionine Beta-Synthase From Drosophila Length = 527 | Back alignment and structure |
| >pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 | Back alignment and structure |
| >pdb|3DWG|A Chain A, Crystal Structure Of A Sulfur Carrier Protein Complex Found In The Cysteine Biosynthetic Pathway Of Mycobacterium Tuberculosis Length = 325 | Back alignment and structure |
| >pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 | Back alignment and structure |
| >pdb|3DWI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cysm, The Cysteine Synthase B Length = 323 | Back alignment and structure |
| >pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 | Back alignment and structure |
| >pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 | Back alignment and structure |
| >pdb|3DKI|A Chain A, 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobacterium Tuberculosis An O-Phosphoserine Dependent Cysteine Synthase Length = 326 | Back alignment and structure |
| >pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 | Back alignment and structure |
| >pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 | Back alignment and structure |
| >pdb|1TDJ|A Chain A, Threonine Deaminase (Biosynthetic) From E. Coli Length = 514 | Back alignment and structure |
| >pdb|1WKV|A Chain A, Crystal Structure Of O-Phosphoserine Sulfhydrylase Length = 389 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 | Back alignment and structure |
|---|
Score = 384 bits (987), Expect = e-133
Identities = 152/276 (55%), Positives = 194/276 (70%), Gaps = 8/276 (2%)
Query: 16 LLPPHPLNIASQKRHRFARFKTSSLSSINGALATRRRILPIVASAKAGAAASSSSSSLYA 75
LL P + +S RF S S + A + S G+ S
Sbjct: 43 LLNPLTSSSSSSTLRRFRCSPEISSLSFSSASDFSLAMKRQSRSFADGSERDPSVVCEAV 102
Query: 76 TSTREIEKEEGNDFHGVNIAEDVTQLIGRTPMVYLNKVTEGCVGNVAAKLESMEPCRSVK 135
+ G+NIA++V+QLIG+TPMVYLN + +GCV N+AAKLE MEPC SVK
Sbjct: 103 KRETGPD--------GLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVK 154
Query: 136 DRIGYSMITDAEESGDITPGKTVLVEPTTGNTGLGIAFVAAVKGYKLIVTMPASTNLERR 195
DRIGYSM+TDAE+ G I+PGK+VLVEPT+GNTG+G+AF+AA +GY+LI+TMPAS ++ERR
Sbjct: 155 DRIGYSMVTDAEQKGFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERR 214
Query: 196 ILLRAFGAEIILTDPEKGLRGALDKAEEIVLNTPNAYMFQQFDNMANLKIHFDSTGPEIW 255
+LL+AFGAE++LTDP KG+ GA+ KAEEI+ NTP+AYM QQFDN AN KIH+++TGPEIW
Sbjct: 215 VLLKAFGAELVLTDPAKGMTGAVQKAEEILKNTPDAYMLQQFDNPANPKIHYETTGPEIW 274
Query: 256 EDTLGCVDIFVAAIGTGGTITGTGRFLKMMNKEIKA 291
+DT G VDIFVA IGTGGTITG GRF+K N + +
Sbjct: 275 DDTKGKVDIFVAGIGTGGTITGVGRFIKEKNPKTQV 310
|
| >1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 | Back alignment and structure |
|---|
| >3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 | Back alignment and structure |
|---|
| >2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 | Back alignment and structure |
|---|
| >1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 | Back alignment and structure |
|---|
| >1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 | Back alignment and structure |
|---|
| >2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 | Back alignment and structure |
|---|
| >2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 | Back alignment and structure |
|---|
| >2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 | Back alignment and structure |
|---|
| >1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 | Back alignment and structure |
|---|
| >3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 | Back alignment and structure |
|---|
| >1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 | Back alignment and structure |
|---|
| >1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 | Back alignment and structure |
|---|
| >2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} Length = 352 | Back alignment and structure |
|---|
| >2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} Length = 360 | Back alignment and structure |
|---|
| >1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* Length = 486 | Back alignment and structure |
|---|
| >1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* Length = 372 | Back alignment and structure |
|---|
| >2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A Length = 351 | Back alignment and structure |
|---|
| >4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* Length = 398 | Back alignment and structure |
|---|
| >1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* Length = 323 | Back alignment and structure |
|---|
| >3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A Length = 442 | Back alignment and structure |
|---|
| >3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} PDB: 3l6r_A* 3hmk_A* 3l6c_A* Length = 346 | Back alignment and structure |
|---|
| >3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} Length = 366 | Back alignment and structure |
|---|
| >1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 Length = 514 | Back alignment and structure |
|---|
| >1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 Length = 311 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 295 | |||
| 4aec_A | 430 | Cysteine synthase, mitochondrial; lyase, cysteine | 100.0 | |
| 3vc3_A | 344 | Beta-cyanoalnine synthase; beta-cyanoalanine synth | 100.0 | |
| 3tbh_A | 334 | O-acetyl serine sulfhydrylase; cysteine synthase, | 100.0 | |
| 1z7w_A | 322 | Cysteine synthase; transferase; HET: PLP; 2.20A {A | 100.0 | |
| 3dwg_A | 325 | Cysteine synthase B; sulfur carrier protein comple | 100.0 | |
| 2v03_A | 303 | Cysteine synthase B; pyridoxal phosphate, cysteine | 100.0 | |
| 1y7l_A | 316 | O-acetylserine sulfhydrylase, O-acetylserine (thio | 100.0 | |
| 2q3b_A | 313 | Cysteine synthase A; pyridoxal-5'-phosphate, sulph | 100.0 | |
| 2pqm_A | 343 | Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 | 100.0 | |
| 1ve1_A | 304 | O-acetylserine sulfhydrylase; PLP, transferase, ri | 100.0 | |
| 2egu_A | 308 | Cysteine synthase; O-acetylserine sulfhydrase, str | 100.0 | |
| 1jbq_A | 435 | B, cystathionine beta-synthase, serine sulfhydrase | 100.0 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 100.0 | |
| 3l6b_A | 346 | Serine racemase; pyridoxal phosphate, PLP, isomera | 100.0 | |
| 4h27_A | 364 | L-serine dehydratase/L-threonine deaminase; PLP de | 100.0 | |
| 1o58_A | 303 | O-acetylserine sulfhydrylase; TM0665, structural g | 100.0 | |
| 1p5j_A | 372 | L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo | 100.0 | |
| 2rkb_A | 318 | Serine dehydratase-like; PLP bound enzyme, enzyme | 100.0 | |
| 2gn0_A | 342 | Threonine dehydratase catabolic; TDCB, biodegradat | 100.0 | |
| 1ve5_A | 311 | Threonine deaminase; riken structural genomics/Pro | 100.0 | |
| 1v71_A | 323 | Serine racemase, hypothetical protein C320.14 in c | 100.0 | |
| 2d1f_A | 360 | Threonine synthase; amino acid synthesis, pyridoxa | 100.0 | |
| 3aey_A | 351 | Threonine synthase; PLP, pyridoxal phosphate, lyas | 100.0 | |
| 1j0a_A | 325 | 1-aminocyclopropane-1-carboxylate deaminase; PLP d | 100.0 | |
| 2zsj_A | 352 | Threonine synthase; PLP dependent enzyme, lyase; H | 100.0 | |
| 3iau_A | 366 | Threonine deaminase; pyridoxal phosphate, amino-ac | 100.0 | |
| 1tdj_A | 514 | Biosynthetic threonine deaminase; allostery, coope | 100.0 | |
| 4d9b_A | 342 | D-cysteine desulfhydrase; fold type II PLP-depende | 100.0 | |
| 1f2d_A | 341 | 1-aminocyclopropane-1-carboxylate deaminase; carbo | 100.0 | |
| 3ss7_X | 442 | D-serine dehydratase; type II fold, ALFA,beta-elim | 100.0 | |
| 4d9i_A | 398 | Diaminopropionate ammonia-lyase; fold type II PLP- | 100.0 | |
| 1wkv_A | 389 | Cysteine synthase; homodimer, open alpha/beta fold | 100.0 | |
| 1tzj_A | 338 | ACC deaminase, 1-aminocyclopropane-1-carboxylate d | 100.0 | |
| 1v8z_A | 388 | Tryptophan synthase beta chain 1; beta+alpha, rike | 100.0 | |
| 1qop_B | 396 | Tryptophan synthase beta chain; lyase, carbon-oxyg | 100.0 | |
| 1x1q_A | 418 | Tryptophan synthase beta chain; structural genomic | 100.0 | |
| 1e5x_A | 486 | Threonine synthase; threonine biosynthesis, PLP en | 100.0 | |
| 2o2e_A | 422 | Tryptophan synthase beta chain; amino-acid biosynt | 100.0 | |
| 1vb3_A | 428 | Threonine synthase; PLP-dependent enzyme, lyase; H | 100.0 | |
| 1kl7_A | 514 | Threonine synthase; threonine synthesis, pyridoxal | 99.96 | |
| 4f4f_A | 468 | Threonine synthase; structural genomics, niaid, na | 99.96 | |
| 3v7n_A | 487 | Threonine synthase; ssgcid, structural genomics, s | 99.95 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 95.44 | |
| 1vp8_A | 201 | Hypothetical protein AF0103; putative pyruvate kin | 94.13 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 93.79 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 93.59 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 93.58 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 93.45 | |
| 4a0s_A | 447 | Octenoyl-COA reductase/carboxylase; oxidoreductase | 93.44 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 93.43 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 92.92 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 92.66 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 92.32 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 92.18 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 92.1 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 92.08 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 91.9 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 91.88 | |
| 3huu_A | 305 | Transcription regulator like protein; PSI-II, NYSG | 91.86 | |
| 1kol_A | 398 | Formaldehyde dehydrogenase; oxidoreductase; HET: N | 91.77 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 91.59 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 91.29 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 91.14 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 91.13 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 91.1 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 91.06 | |
| 4a2c_A | 346 | Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc | 90.98 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 90.93 | |
| 3iup_A | 379 | Putative NADPH:quinone oxidoreductase; YP_296108.1 | 90.92 | |
| 3qk7_A | 294 | Transcriptional regulators; structural genomics, N | 90.79 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 90.67 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 90.62 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 90.53 | |
| 3l9w_A | 413 | Glutathione-regulated potassium-efflux system Pro | 90.53 | |
| 1h2b_A | 359 | Alcohol dehydrogenase; oxidoreductase, archaea, hy | 90.39 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 90.33 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 90.14 | |
| 1vj0_A | 380 | Alcohol dehydrogenase, zinc-containing; TM0436, st | 90.07 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 90.03 | |
| 3k4h_A | 292 | Putative transcriptional regulator; structural gen | 89.99 | |
| 3krt_A | 456 | Crotonyl COA reductase; structural genomics, prote | 89.81 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 89.59 | |
| 2zb4_A | 357 | Prostaglandin reductase 2; rossmann fold, alternat | 89.54 | |
| 1gu7_A | 364 | Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s | 89.47 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 89.37 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 89.2 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 89.14 | |
| 2j3h_A | 345 | NADP-dependent oxidoreductase P1; double bond redu | 88.81 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 88.8 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 88.68 | |
| 1e3j_A | 352 | NADP(H)-dependent ketose reductase; oxidoreductase | 88.57 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 88.48 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 88.47 | |
| 3h5t_A | 366 | Transcriptional regulator, LACI family; DNA-depend | 88.34 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 88.18 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 88.17 | |
| 1t57_A | 206 | Conserved protein MTH1675; structural genomics, FM | 88.12 | |
| 3ip1_A | 404 | Alcohol dehydrogenase, zinc-containing; structural | 88.08 | |
| 2dph_A | 398 | Formaldehyde dismutase; dismutation of aldehydes, | 88.04 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 88.02 | |
| 4eez_A | 348 | Alcohol dehydrogenase 1; site-saturation mutagenes | 87.59 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 87.2 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 86.62 | |
| 3k9c_A | 289 | Transcriptional regulator, LACI family protein; PS | 86.5 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 86.1 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 85.9 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 85.83 | |
| 3h75_A | 350 | Periplasmic sugar-binding domain protein; protein | 85.79 | |
| 1pl8_A | 356 | Human sorbitol dehydrogenase; NAD, oxidoreductase; | 85.77 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 85.46 | |
| 3hcw_A | 295 | Maltose operon transcriptional repressor; RNA-bind | 85.45 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 85.38 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 85.27 | |
| 1xa0_A | 328 | Putative NADPH dependent oxidoreductases; structur | 85.15 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 85.04 | |
| 3jv7_A | 345 | ADH-A; dehydrogenase, nucleotide binding, rossmann | 84.82 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 84.82 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 84.8 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 84.69 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 84.31 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 84.31 | |
| 1tt7_A | 330 | YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st | 84.29 | |
| 2b5w_A | 357 | Glucose dehydrogenase; nucleotide binding motif, o | 84.21 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 84.09 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 83.98 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 83.86 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 83.86 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 83.84 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 83.83 | |
| 3o74_A | 272 | Fructose transport system repressor FRUR; dual tra | 83.82 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 83.76 | |
| 3tpf_A | 307 | Otcase, ornithine carbamoyltransferase; structural | 83.67 | |
| 3egc_A | 291 | Putative ribose operon repressor; structural genom | 83.6 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 83.59 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 83.49 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 83.42 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 83.29 | |
| 3kke_A | 303 | LACI family transcriptional regulator; structural | 83.13 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 83.08 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 83.02 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 82.93 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 82.91 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 82.89 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 82.79 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 82.79 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 82.75 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 82.7 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 82.64 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 82.55 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 82.38 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 82.34 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 82.14 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 82.09 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 82.04 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 81.98 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 81.96 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 81.93 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 81.68 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 81.67 | |
| 3l49_A | 291 | ABC sugar (ribose) transporter, periplasmic substr | 81.62 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 81.6 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 81.45 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 81.35 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 81.32 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 81.24 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 81.15 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 81.0 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 80.99 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 80.98 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 80.9 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 80.8 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 80.8 | |
| 4dvj_A | 363 | Putative zinc-dependent alcohol dehydrogenase Pro; | 80.59 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 80.59 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 80.58 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 80.56 | |
| 2rgy_A | 290 | Transcriptional regulator, LACI family; 11011J, NY | 80.38 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 80.37 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 80.3 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 80.28 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 80.27 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 80.24 |
| >4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
Probab=100.00 E-value=3.1e-50 Score=389.05 Aligned_cols=221 Identities=64% Similarity=1.055 Sum_probs=199.2
Q ss_pred CCcccccchhHhhhhhcCCCcccchhhhhhcccCCCCceeccccccCCCCeEEEEeCCCCCCCchHHHHHHHHHHHHHHc
Q 022547 70 SSSLYATSTREIEKEEGNDFHGVNIAEDVTQLIGRTPMVYLNKVTEGCVGNVAAKLESMEPCRSVKDRIGYSMITDAEES 149 (295)
Q Consensus 70 ~~p~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~TPLv~l~~l~~~~g~~I~~K~E~~nptGS~K~R~a~~~l~~a~~~ 149 (295)
.+|.|..... ....++.+++++++.+++++|||+++++|++.+|++||+|+|++||+||||+|++.+++.+++++
T Consensus 94 ~~~~~~~~~~-----~~~~~~~~~~~~~i~~~ig~TPLv~l~~Ls~~~g~~I~lK~E~lnptGSfKdRgA~~~i~~A~~~ 168 (430)
T 4aec_A 94 DPSVVCEAVK-----RETGPDGLNIADNVSQLIGKTPMVYLNSIAKGCVANIAAKLEIMEPCCSVKDRIGYSMVTDAEQK 168 (430)
T ss_dssp --------CC-----CCCTTSSCSCBSSGGGGSSCCCEEECCGGGTTCSSEEEEEEGGGSTTSBTTHHHHHHHHHHHHHT
T ss_pred CChhHhhhcC-----ccccccccchhhhhhccCCCCCeEEChhhhhhcCCeEEEEECCCCCCCCHHHHHHHHHHHHHHHc
Confidence 3677776443 22356677888999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCCCeEEEEeCCCccHHHHHHHHHHcCCeEEEEECCCCCHHHHHHHHhCCCEEEEeCCCCChHHHHHHHHHHHHcCC
Q 022547 150 GDITPGKTVLVEPTTGNTGLGIAFVAAVKGYKLIVTMPASTNLERRILLRAFGAEIILTDPEKGLRGALDKAEEIVLNTP 229 (295)
Q Consensus 150 g~~~~g~~~vv~aSsGN~g~AlA~aa~~~Gi~~~ivvp~~~~~~~~~~l~~~GA~Vv~v~~~~~~~~a~~~a~~~a~~~~ 229 (295)
|.+++|.++||++|+||||+|+|++|+.+|++|+||||++++..|++.++.+||+|+.++...+|+++++.+.+++++.+
T Consensus 169 G~l~~g~~~VV~aSsGNhG~AlA~aAa~~Gl~~~IvmP~~~s~~k~~~~r~~GAeVv~v~~~~~~~~a~~~a~el~~~~~ 248 (430)
T 4aec_A 169 GFISPGKSVLVEPTSGNTGIGLAFIAASRGYRLILTMPASMSMERRVLLKAFGAELVLTDPAKGMTGAVQKAEEILKNTP 248 (430)
T ss_dssp TSCCTTTCEEEEECSSHHHHHHHHHHHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHST
T ss_pred CCCCCCCcEEEEECCCHHHHHHHHHHHHhCCEEEEEEcCCCCHHHHHHHHHCCCEEEEECCCCChHHHHHHHHHHHHhcC
Confidence 99999888899999999999999999999999999999999999999999999999999865568999999999998877
Q ss_pred CeEEecCCCChHHHHHHHHHHHHHHHHhhCCCCCEEEEcCCchHHHHHHHHHHHhcCCCCEEEEeC
Q 022547 230 NAYMFQQFDNMANLKIHFDSTGPEIWEDTLGCVDIFVAAIGTGGTITGTGRFLKMMNKEIKARILL 295 (295)
Q Consensus 230 ~~~~~~~~~n~~~~~~Gy~t~~~EI~~Ql~~~~d~vv~pvGtGgt~aGi~~~lk~~~~~vkVigV~ 295 (295)
++||++||+|+.++..||.|++.||++|+++.+|+||+|+|+||+++|++.++|+.+|+++||||+
T Consensus 249 ~~~~i~~~~np~~~~aG~~T~a~EI~eQl~~~~D~vVvpvG~GGtlaGi~~~lk~~~p~~kVigVe 314 (430)
T 4aec_A 249 DAYMLQQFDNPANPKIHYETTGPEIWDDTKGKVDIFVAGIGTGGTITGVGRFIKEKNPKTQVIGVE 314 (430)
T ss_dssp TEEECCTTTCTHHHHHHHHTHHHHHHHHTTSCEEEEEEECSSSHHHHHHHHHHHHHCTTSEEEEEE
T ss_pred CcEEecCCCCccHHHHHHHHHHHHHHHHcCCCCCEEEEeCCccHHHHHHHHHHHHhCCCCEEEEEE
Confidence 899999999999987899999999999997789999999999999999999999999999999984
|
| >3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* | Back alignment and structure |
|---|
| >3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* | Back alignment and structure |
|---|
| >1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* | Back alignment and structure |
|---|
| >3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* | Back alignment and structure |
|---|
| >2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* | Back alignment and structure |
|---|
| >1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* | Back alignment and structure |
|---|
| >2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A | Back alignment and structure |
|---|
| >2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* | Back alignment and structure |
|---|
| >1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* | Back alignment and structure |
|---|
| >2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* | Back alignment and structure |
|---|
| >4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* | Back alignment and structure |
|---|
| >1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* | Back alignment and structure |
|---|
| >1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* | Back alignment and structure |
|---|
| >2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 | Back alignment and structure |
|---|
| >1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* | Back alignment and structure |
|---|
| >2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A | Back alignment and structure |
|---|
| >1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* | Back alignment and structure |
|---|
| >2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} | Back alignment and structure |
|---|
| >1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 | Back alignment and structure |
|---|
| >4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* | Back alignment and structure |
|---|
| >1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* | Back alignment and structure |
|---|
| >3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A | Back alignment and structure |
|---|
| >4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* | Back alignment and structure |
|---|
| >1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 | Back alignment and structure |
|---|
| >1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* | Back alignment and structure |
|---|
| >1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* | Back alignment and structure |
|---|
| >1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... | Back alignment and structure |
|---|
| >1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* | Back alignment and structure |
|---|
| >2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A | Back alignment and structure |
|---|
| >1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 | Back alignment and structure |
|---|
| >1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 | Back alignment and structure |
|---|
| >4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} | Back alignment and structure |
|---|
| >3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >1vp8_A Hypothetical protein AF0103; putative pyruvate kinase, structural genomics, joint center structural genomics, JCSG; HET: MSE FMN; 1.30A {Archaeoglobus fulgidus} SCOP: c.49.1.2 | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* | Back alignment and structure |
|---|
| >1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} | Back alignment and structure |
|---|
| >3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* | Back alignment and structure |
|---|
| >1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >1t57_A Conserved protein MTH1675; structural genomics, FMN; HET: FMN; 2.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.49.1.2 | Back alignment and structure |
|---|
| >3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* | Back alignment and structure |
|---|
| >2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 295 | ||||
| d1z7wa1 | 320 | c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C | 5e-51 | |
| d1jbqa_ | 355 | c.79.1.1 (A:) Cystathionine beta-synthase {Human ( | 4e-41 | |
| d1y7la1 | 310 | c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C | 1e-40 | |
| d1fcja_ | 302 | c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei | 3e-38 | |
| d1ve1a1 | 302 | c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C | 4e-38 | |
| d1o58a_ | 293 | c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei | 1e-36 | |
| d2bhsa1 | 292 | c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C | 1e-34 | |
| d1wkva1 | 382 | c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C | 7e-26 | |
| d1v71a1 | 318 | c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S | 7e-26 | |
| d1tdja1 | 331 | c.79.1.1 (A:5-335) Threonine deaminase {Escherichi | 8e-26 | |
| d1e5xa_ | 477 | c.79.1.1 (A:) Threonine synthase {Mouse-ear cress | 3e-20 | |
| d1ve5a1 | 310 | c.79.1.1 (A:2-311) Threonine deaminase {Thermus th | 3e-17 | |
| d1tyza_ | 338 | c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de | 5e-17 | |
| d1p5ja_ | 319 | c.79.1.1 (A:) L-serine dehydratase {Human (Homo sa | 3e-16 | |
| d1j0aa_ | 325 | c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de | 1e-15 | |
| d1f2da_ | 341 | c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de | 7e-15 | |
| d1v8za1 | 386 | c.79.1.1 (A:1-386) Tryptophan synthase, beta-subun | 1e-13 | |
| d1v7ca_ | 351 | c.79.1.1 (A:) Threonine synthase {Thermus thermoph | 9e-13 | |
| d1qopb_ | 390 | c.79.1.1 (B:) Tryptophan synthase, beta-subunit {S | 2e-11 | |
| d1xgka_ | 350 | c.2.1.2 (A:) Negative transcriptional regulator Nm | 0.003 |
| >d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes family: Tryptophan synthase beta subunit-like PLP-dependent enzymes domain: O-acetylserine sulfhydrylase (Cysteine synthase) species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 168 bits (426), Expect = 5e-51
Identities = 133/197 (67%), Positives = 164/197 (83%)
Query: 94 IAEDVTQLIGRTPMVYLNKVTEGCVGNVAAKLESMEPCRSVKDRIGYSMITDAEESGDIT 153
IA+DVT+LIG TP+VYLN V EGCVG VAAKLE MEPC SVKDRIG+SMI+DAE+ G I
Sbjct: 3 IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK 62
Query: 154 PGKTVLVEPTTGNTGLGIAFVAAVKGYKLIVTMPASTNLERRILLRAFGAEIILTDPEKG 213
PG++VL+EPT+GNTG+G+AF AA KGYKLI+TMPAS + ERRI+L AFG E++LTDP KG
Sbjct: 63 PGESVLIEPTSGNTGVGLAFTAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKG 122
Query: 214 LRGALDKAEEIVLNTPNAYMFQQFDNMANLKIHFDSTGPEIWEDTLGCVDIFVAAIGTGG 273
++GA+ KAEEI+ TPN YM QQF+N AN KIH+++TGPEIW+ T G +D FV+ IGTGG
Sbjct: 123 MKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPEIWKGTGGKIDGFVSGIGTGG 182
Query: 274 TITGTGRFLKMMNKEIK 290
TITG G++LK N +K
Sbjct: 183 TITGAGKYLKEQNANVK 199
|
| >d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 | Back information, alignment and structure |
|---|
| >d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 | Back information, alignment and structure |
|---|
| >d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 | Back information, alignment and structure |
|---|
| >d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 | Back information, alignment and structure |
|---|
| >d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 | Back information, alignment and structure |
|---|
| >d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 | Back information, alignment and structure |
|---|
| >d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 | Back information, alignment and structure |
|---|
| >d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 | Back information, alignment and structure |
|---|
| >d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 477 | Back information, alignment and structure |
|---|
| >d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 | Back information, alignment and structure |
|---|
| >d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 | Back information, alignment and structure |
|---|
| >d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 319 | Back information, alignment and structure |
|---|
| >d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 | Back information, alignment and structure |
|---|
| >d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 | Back information, alignment and structure |
|---|
| >d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 386 | Back information, alignment and structure |
|---|
| >d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Length = 351 | Back information, alignment and structure |
|---|
| >d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Length = 390 | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Length = 350 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 295 | |||
| d1z7wa1 | 320 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 100.0 | |
| d2bhsa1 | 292 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 100.0 | |
| d1ve1a1 | 302 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 100.0 | |
| d1jbqa_ | 355 | Cystathionine beta-synthase {Human (Homo sapiens) | 100.0 | |
| d1o58a_ | 293 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 100.0 | |
| d1v71a1 | 318 | Hypothetical protein C320.14 (SPCC320.14, SPCC330. | 100.0 | |
| d1p5ja_ | 319 | L-serine dehydratase {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1tdja1 | 331 | Threonine deaminase {Escherichia coli [TaxId: 562] | 100.0 | |
| d1wkva1 | 382 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 100.0 | |
| d1y7la1 | 310 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 100.0 | |
| d1ve5a1 | 310 | Threonine deaminase {Thermus thermophilus [TaxId: | 100.0 | |
| d1fcja_ | 302 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 100.0 | |
| d1v7ca_ | 351 | Threonine synthase {Thermus thermophilus [TaxId: 2 | 100.0 | |
| d1e5xa_ | 477 | Threonine synthase {Mouse-ear cress (Arabidopsis t | 100.0 | |
| d1v8za1 | 386 | Tryptophan synthase, beta-subunit {Archaeon Pyroco | 100.0 | |
| d1qopb_ | 390 | Tryptophan synthase, beta-subunit {Salmonella typh | 100.0 | |
| d1j0aa_ | 325 | 1-aminocyclopropane-1-carboxylate deaminase {Archa | 99.98 | |
| d1tyza_ | 338 | 1-aminocyclopropane-1-carboxylate deaminase {Pseud | 99.97 | |
| d1f2da_ | 341 | 1-aminocyclopropane-1-carboxylate deaminase {Yeast | 99.96 | |
| d1vb3a1 | 428 | Threonine synthase {Escherichia coli [TaxId: 562]} | 99.7 | |
| d1kl7a_ | 511 | Threonine synthase {Baker's yeast (Saccharomyces c | 98.92 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 96.75 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 96.5 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 96.46 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 96.4 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 96.08 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 95.73 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 95.64 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 95.53 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 95.49 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 95.44 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 95.41 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 95.06 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 94.94 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 94.93 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 94.7 | |
| d1vp8a_ | 190 | Hypothetical protein AF0103 {Archaeoglobus fulgidu | 94.59 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 94.38 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 93.94 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 93.93 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 93.81 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 93.42 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 93.33 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 93.2 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 92.69 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 92.28 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 92.13 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 92.07 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 92.06 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 91.42 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 90.95 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 90.85 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 90.69 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 90.48 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 90.25 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 90.19 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 89.07 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 88.93 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 88.83 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 88.38 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 88.29 | |
| d1t57a_ | 186 | Hypothetical protein MTH1675 {Methanobacterium the | 87.85 | |
| d1jx6a_ | 338 | Quorum-sensing signal (autoinducer-2) binding prot | 87.75 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 87.59 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 87.59 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 87.54 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 87.52 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 87.11 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 86.9 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 86.71 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 86.53 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 86.51 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 86.5 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 86.22 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 86.2 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 86.06 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 85.87 | |
| d1guda_ | 288 | D-allose-binding protein {Escherichia coli [TaxId: | 85.81 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 85.71 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 85.32 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 85.07 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 84.82 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 84.77 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 84.22 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 84.03 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 82.86 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 82.81 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 82.79 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 82.6 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 82.09 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 80.17 |
| >d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes family: Tryptophan synthase beta subunit-like PLP-dependent enzymes domain: O-acetylserine sulfhydrylase (Cysteine synthase) species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=100.00 E-value=3.2e-47 Score=353.34 Aligned_cols=202 Identities=66% Similarity=1.076 Sum_probs=185.8
Q ss_pred hhhhhhcccCCCCceeccccccCCCCeEEEEeCCCCCCCchHHHHHHHHHHHHHHcCCCCCCCeEEEEeCCCccHHHHHH
Q 022547 94 IAEDVTQLIGRTPMVYLNKVTEGCVGNVAAKLESMEPCRSVKDRIGYSMITDAEESGDITPGKTVLVEPTTGNTGLGIAF 173 (295)
Q Consensus 94 ~~~~i~~~~~~TPLv~l~~l~~~~g~~I~~K~E~~nptGS~K~R~a~~~l~~a~~~g~~~~g~~~vv~aSsGN~g~AlA~ 173 (295)
+.++|...+|+|||+++++|++.+|++||+|+|++|||||||||+|.++|.+|+++|.++++...||++|+||||.|+|+
T Consensus 3 i~~~i~~~iG~TPLv~~~~l~~~~g~~i~~K~E~~nptGSfKdRgA~~~i~~a~~~g~~~~~~~~vv~aSsGN~g~a~A~ 82 (320)
T d1z7wa1 3 IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIKPGESVLIEPTSGNTGVGLAF 82 (320)
T ss_dssp CCSSGGGGSSCCCEEECCGGGTTCSSEEEEEEGGGSTTSBTHHHHHHHHHHHHHHTTSCCTTTCEEEEECSSHHHHHHHH
T ss_pred hhhhhhhhcCCCCeEECCCcccccCCEEEEEeCCCCCccCcHHHHHHHHHHHHHHcCCCCCCCceEEeeCCchHHHHHHH
Confidence 44578899999999999999999999999999999999999999999999999999988887788999999999999999
Q ss_pred HHHHcCCeEEEEECCCCCHHHHHHHHhCCCEEEEeCCCCChHHHHHHHHHHHHcCCCeEEecCCCChHHHHHHHHHHHHH
Q 022547 174 VAAVKGYKLIVTMPASTNLERRILLRAFGAEIILTDPEKGLRGALDKAEEIVLNTPNAYMFQQFDNMANLKIHFDSTGPE 253 (295)
Q Consensus 174 aa~~~Gi~~~ivvp~~~~~~~~~~l~~~GA~Vv~v~~~~~~~~a~~~a~~~a~~~~~~~~~~~~~n~~~~~~Gy~t~~~E 253 (295)
+|+.+|++|+||||+.++..|+++++.+||+|+.++...+..+....+.+...+.++++++++|+|+.|+..||.|++.|
T Consensus 83 ~a~~~g~~~~iv~p~~~~~~k~~~i~~~Ga~vi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~g~~t~~~E 162 (320)
T d1z7wa1 83 TAAAKGYKLIITMPASMSTERRIILLAFGVELVLTDPAKGMKGAIAKAEEILAKTPNGYMLQQFENPANPKIHYETTGPE 162 (320)
T ss_dssp HHHHHTCEEEEEEETTSCHHHHHHHHHTTCEEEEECGGGHHHHHHHHHHHHHHHCTTEEECCTTTCTHHHHHHHHTHHHH
T ss_pred HHHhhccceEEeehhhhhhhhhhhhhccCcceEEeeccccccccchhHHHHHHhCCCceecccccccchHHHhhhhHHHH
Confidence 99999999999999999999999999999999999865444445555555555667999999999999998899999999
Q ss_pred HHHhhCCCCCEEEEcCCchHHHHHHHHHHHhcCCCCEEEEeC
Q 022547 254 IWEDTLGCVDIFVAAIGTGGTITGTGRFLKMMNKEIKARILL 295 (295)
Q Consensus 254 I~~Ql~~~~d~vv~pvGtGgt~aGi~~~lk~~~~~vkVigV~ 295 (295)
|++|+.+.+|+||+|+|+||+++|++.+|+..+|++++|+|+
T Consensus 163 I~~q~~~~~D~vv~~vGgGg~~~Gi~~~~k~~~~~~~~igve 204 (320)
T d1z7wa1 163 IWKGTGGKIDGFVSGIGTGGTITGAGKYLKEQNANVKLYGVE 204 (320)
T ss_dssp HHHHTTTCCCEEEEECSSSHHHHHHHHHHHHHCTTCEEEEEE
T ss_pred HHHhccCCCCEEEeCCCCCcccchhhhhhhhhhcceeeeccc
Confidence 999997789999999999999999999999999999999984
|
| >d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} | Back information, alignment and structure |
|---|
| >d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1vp8a_ c.49.1.2 (A:) Hypothetical protein AF0103 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1t57a_ c.49.1.2 (A:) Hypothetical protein MTH1675 {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1guda_ c.93.1.1 (A:) D-allose-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|