Citrus Sinensis ID: 022552


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MAFTATPLFSSTASSSSTALHRSKFLDSDFAAPFSHDSFHLINFSRRFYEQGICLSRKKNILFASVNGTNAVSPTPLKSDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCLRYYLRRPETDIDSY
cccHHHHHHHHHHHHHHHHHccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEccccccEEEEEEEEcccccHHHHHHHHHHHccccEEEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccccccccccccccEEEEEccccccEEEEEEEccccHHHHHHHHHHHHccEEEEEEEEEccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHcccccccccc
cccEccHHHHHHHccccHHEccccccccccccccccccHHHccccHHHccccccHHHccccEEEccccHHcccccccccccccccccccEEEEccccccccEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEEEccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHccccccccccccEEEEEcEEEEEEccccccEEEEEEccccccHHHHHHHHHHHcccEEEEEEEEccccEEEEEEEEEcccccccHHHHHHHHHHHHHHHcccccccccc
maftatplfsstasssstalhrskfldsdfaapfshdsfhliNFSRRFYEQGICLSRKKNILFAsvngtnavsptplksdqdadyipmphvlidqdsnsdatIVQLSFGDRLGALIDTMNALKDLGLDvakgtvntegsvkQTKFFITRldtgrkvedpdLLERIRLTIINNLlkyhpesseqlamgeafgikapekkldvDIATHihvkedgpkrslLYIETADRPGLLVEIMKIIADvnvdvesaeidteglvakdkfhvsyggaalnSSLSQVLVNCLRYYlrrpetdidsy
maftatplfsstasssstaLHRSKFLDSDFAAPFSHDSFHLINFSRRFYEQGICLSRKKNILFASVNGTNAVSPTPLKSDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAkgtvntegsvkqtkffitrldtgrkvedpdllERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHihvkedgpkrsllYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGaalnsslsQVLVNCLRYYlrrpetdidsy
MaftatplfsstasssstalHRSKFLDSDFAAPFSHDSFHLINFSRRFYEQGICLSRKKNILFASVNGTNAVSPTPLKSDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCLRYYLRRPETDIDSY
************************FLDSDFAAPFSHDSFHLINFSRRFYEQGICLSRKKNILFASVNGTNA************DYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHP*****LAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCLRYYLR*********
*AFTATPLFSSTASSSSTALHRSKFLDSDFAAPFSHDSFHLINF*********CLSRKKNILFASVN********************MPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLAMG*****KAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGA********VLVNCLRY************
********************HRSKFLDSDFAAPFSHDSFHLINFSRRFYEQGICLSRKKNILFASVNGTNAVSPTPLKSDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCLRYYLRRPETDIDSY
*************SSSSTALHRSKFLDSDFAAPFSHDSFHLINFSRRFYEQGICLSRKKNILFASVNG*NAV************YIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCLRYYLRRP*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAFTATPLFSSTASSSSTALHRSKFLDSDFAAPFSHDSFHLINFSRRFYEQGICLSRKKNILFASVNGTNAVSPTPLKSDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCLRYYLRRPETDIDSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
Q0J709283 Unknown protein DS12 from no no 0.735 0.766 0.594 1e-72
P83643283 Unknown protein DS12 from N/A no 0.735 0.766 0.594 1e-72
Q7NTY6856 [Protein-PII] uridylyltra yes no 0.213 0.073 0.442 4e-05
Q9AC53940 [Protein-PII] uridylyltra yes no 0.522 0.163 0.288 4e-05
B8GWX0940 [Protein-PII] uridylyltra yes no 0.522 0.163 0.288 4e-05
Q3J5H6930 [Protein-PII] uridylyltra yes no 0.549 0.174 0.271 0.0002
Q5FPT6949 [Protein-PII] uridylyltra yes no 0.301 0.093 0.307 0.0005
>sp|Q0J709|UP12_ORYSJ Unknown protein DS12 from 2D-PAGE of leaf, chloroplastic OS=Oryza sativa subsp. japonica GN=Os08g0242700 PE=2 SV=2 Back     alignment and function desciption
 Score =  273 bits (697), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 168/217 (77%)

Query: 79  SDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEG 138
           S  + D +P P V+IDQDS+ DATIV+++ GDRLG L+DTMNALK+LGL+V K +V  + 
Sbjct: 67  SSSNTDTVPTPKVIIDQDSDPDATIVEITLGDRLGDLLDTMNALKNLGLNVVKASVCLDS 126

Query: 139 SVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKK 198
           + K  K  IT+L TGRK+ +P+LLE +RLTIINN+++YHPE+S QLA+G  FG + P + 
Sbjct: 127 TGKHIKLAITKLSTGRKIGEPELLEAVRLTIINNMIQYHPEASSQLALGATFGPEPPTEL 186

Query: 199 LDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKD 258
           +DVDIATHI + +DGP RSLL +ETADRPGLLV+++KII D+N+ V+S E DTEGL+AK 
Sbjct: 187 VDVDIATHIDIYDDGPDRSLLVVETADRPGLLVDLVKIIDDINITVQSGEFDTEGLLAKA 246

Query: 259 KFHVSYGGAALNSSLSQVLVNCLRYYLRRPETDIDSY 295
           KFHVSY G  L  +L QVL N LRY+LRRP T+  SY
Sbjct: 247 KFHVSYRGKPLIKALQQVLANSLRYFLRRPTTEEGSY 283





Oryza sativa subsp. japonica (taxid: 39947)
>sp|P83643|UP12_ORYSI Unknown protein DS12 from 2D-PAGE of leaf, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_027381 PE=1 SV=2 Back     alignment and function description
>sp|Q7NTY6|GLND_CHRVO [Protein-PII] uridylyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q9AC53|GLND_CAUCR [Protein-PII] uridylyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|B8GWX0|GLND_CAUCN [Protein-PII] uridylyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q3J5H6|GLND_RHOS4 [Protein-PII] uridylyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=glnD PE=3 SV=1 Back     alignment and function description
>sp|Q5FPT6|GLND_GLUOX [Protein-PII] uridylyltransferase OS=Gluconobacter oxydans (strain 621H) GN=glnD PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
449446279287 PREDICTED: unknown protein DS12 from 2D- 0.959 0.986 0.720 1e-115
449494163283 PREDICTED: unknown protein DS12 from 2D- 0.945 0.985 0.713 1e-114
388495334282 unknown [Lotus japonicus] 0.942 0.985 0.719 1e-111
224110178217 predicted protein [Populus trichocarpa] 0.735 1.0 0.917 1e-110
224097618218 predicted protein [Populus trichocarpa] 0.738 1.0 0.899 1e-110
356575488282 PREDICTED: unknown protein DS12 from 2D- 0.850 0.890 0.796 1e-110
356536361283 PREDICTED: unknown protein DS12 from 2D- 0.850 0.886 0.792 1e-109
15238305301 ACT domain-containing protein [Arabidops 0.986 0.966 0.702 1e-108
21592963301 unknown [Arabidopsis thaliana] 0.986 0.966 0.695 1e-107
255560331214 amino acid binding protein, putative [Ri 0.722 0.995 0.897 1e-107
>gi|449446279|ref|XP_004140899.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  422 bits (1085), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 214/297 (72%), Positives = 247/297 (83%), Gaps = 14/297 (4%)

Query: 1   MAFTATPLFSSTASSSSTALHRSKFLDSDFAAPFSHDSFHLINFSRRFYEQGICLS--RK 58
           M  +++   +S+ +S S    RS+F + +F A   H          R +  G  L+   K
Sbjct: 3   MPTSSSTFIASSYTSPSPFPCRSRFFEPEFVAHVPH----------RCFGGGARLAFLLK 52

Query: 59  KNILFASVNGTNAVSPTPLKSDQDADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDT 118
            NIL AS NG NAVSP  L  DQD+  +PMP VLIDQDS+S+ATIV++SFGDRLGALIDT
Sbjct: 53  WNILSASTNGLNAVSPASLMFDQDS--VPMPIVLIDQDSDSNATIVEVSFGDRLGALIDT 110

Query: 119 MNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHP 178
           M ALKDLGLDVAKGTV+TEGSVKQTKF++TRLD+GRKVEDPDLLE IRLTIINNLLKYHP
Sbjct: 111 MRALKDLGLDVAKGTVSTEGSVKQTKFYLTRLDSGRKVEDPDLLESIRLTIINNLLKYHP 170

Query: 179 ESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIA 238
           ESS+QLAMGEAFGI+ PEKKLDVDIATH+HVK DGPKRSLLY+ETADRPGLL+E++K++A
Sbjct: 171 ESSQQLAMGEAFGIQPPEKKLDVDIATHVHVKADGPKRSLLYLETADRPGLLLEVIKMLA 230

Query: 239 DVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCLRYYLRRPETDIDSY 295
           D+N+DVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQV+VNCLRYYLRRPETDIDSY
Sbjct: 231 DINIDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVVVNCLRYYLRRPETDIDSY 287




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449494163|ref|XP_004159466.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388495334|gb|AFK35733.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|224110178|ref|XP_002315438.1| predicted protein [Populus trichocarpa] gi|222864478|gb|EEF01609.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224097618|ref|XP_002311013.1| predicted protein [Populus trichocarpa] gi|222850833|gb|EEE88380.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356575488|ref|XP_003555872.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|356536361|ref|XP_003536707.1| PREDICTED: unknown protein DS12 from 2D-PAGE of leaf, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|15238305|ref|NP_196094.1| ACT domain-containing protein [Arabidopsis thaliana] gi|7413536|emb|CAB86016.1| putative protein [Arabidopsis thaliana] gi|9758449|dbj|BAB08978.1| unnamed protein product [Arabidopsis thaliana] gi|18252933|gb|AAL62393.1| putative protein [Arabidopsis thaliana] gi|21389645|gb|AAM48021.1| putative protein [Arabidopsis thaliana] gi|332003394|gb|AED90777.1| ACT domain-containing protein [Arabidopsis thaliana] gi|347949480|gb|AEP31953.1| ACT domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21592963|gb|AAM64912.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|255560331|ref|XP_002521182.1| amino acid binding protein, putative [Ricinus communis] gi|223539629|gb|EEF41213.1| amino acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
TAIR|locus:2175458301 ACR12 "ACT domain repeats 12" 0.847 0.830 0.767 2.2e-98
TAIR|locus:2015616290 ACR11 "ACT domain repeats 11" 0.735 0.748 0.649 8.6e-72
TAIR|locus:2044289 456 ACR5 "ACT domain repeat 5" [Ar 0.271 0.175 0.296 5.7e-09
TAIR|locus:2033223 455 ACR4 "ACT domain repeat 4" [Ar 0.271 0.175 0.308 5.3e-08
TAIR|locus:2132609 449 ACR7 "ACT domain repeat 7" [Ar 0.274 0.180 0.268 2.2e-07
TAIR|locus:2078678 433 ACR6 "ACT domain repeat 6" [Ar 0.281 0.191 0.285 7.5e-07
TAIR|locus:2034630 441 ACR8 "AT1G12420" [Arabidopsis 0.271 0.181 0.333 2.1e-06
TAIR|locus:2152094 477 ACR1 "ACT domain repeat 1" [Ar 0.281 0.174 0.273 4.2e-06
TAIR|locus:2025317 453 ACR3 "ACT domain repeat 3" [Ar 0.376 0.245 0.243 1.2e-05
TIGR_CMR|SPO_0397908 SPO_0397 "protein-P-II uridyly 0.555 0.180 0.285 0.00013
TAIR|locus:2175458 ACR12 "ACT domain repeats 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 977 (349.0 bits), Expect = 2.2e-98, P = 2.2e-98
 Identities = 195/254 (76%), Positives = 224/254 (88%)

Query:    46 RRFYEQGIC--LSRK-KNILFASVNGTN-AVSPTPLKSDQDADYIPMPHVLIDQDSNSDA 101
             RR +  G+   L++  KN ++AS+N  + A +P+  KS+ D D +PMP V+IDQD++ +A
Sbjct:    48 RRKFVGGVMSLLTKSIKNRVYASINSIDSAATPSYPKSEDDDDVVPMPMVMIDQDADPEA 107

Query:   102 TIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDL 161
             TIVQLSFG+RLGALIDTM ALKDLGLDV KGTV+TEGS+KQTKF IT+ DTGRKVEDPDL
Sbjct:   108 TIVQLSFGNRLGALIDTMRALKDLGLDVIKGTVSTEGSIKQTKFSITKRDTGRKVEDPDL 167

Query:   162 LERIRLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYI 221
             LE+IRLTIINNLLKYHPE SEQLAMGE FGIKAPEKK+DVDIATHIHVKEDGPKRSLL I
Sbjct:   168 LEQIRLTIINNLLKYHPECSEQLAMGETFGIKAPEKKIDVDIATHIHVKEDGPKRSLLVI 227

Query:   222 ETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVSYGGAALNSSLSQVLVNCL 281
             ETADRPGL+VE++K++ADVN+DVESAEIDTEGLVAKDKFHVSY G ALN SLSQVLVNCL
Sbjct:   228 ETADRPGLVVEMIKVMADVNIDVESAEIDTEGLVAKDKFHVSYQGQALNRSLSQVLVNCL 287

Query:   282 RYYLRRPETDIDSY 295
             RY+LRRPETDIDSY
Sbjct:   288 RYFLRRPETDIDSY 301




GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0016597 "amino acid binding" evidence=IEA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0019408 "dolichol biosynthetic process" evidence=RCA
TAIR|locus:2015616 ACR11 "ACT domain repeats 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2044289 ACR5 "ACT domain repeat 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033223 ACR4 "ACT domain repeat 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132609 ACR7 "ACT domain repeat 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2078678 ACR6 "ACT domain repeat 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2034630 ACR8 "AT1G12420" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152094 ACR1 "ACT domain repeat 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025317 ACR3 "ACT domain repeat 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0397 SPO_0397 "protein-P-II uridylyltransferase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.X.3434.1
hypothetical protein (217 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
TIGR01693850 TIGR01693, UTase_glnD, [Protein-PII] uridylyltrans 9e-08
cd0489970 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domain 2e-07
cd0487370 cd04873, ACT_UUR-ACR-like, ACT domains of the bact 9e-07
PRK05092931 PRK05092, PRK05092, PII uridylyl-transferase; Prov 1e-06
COG2844867 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltran 1e-05
PRK05092931 PRK05092, PRK05092, PII uridylyl-transferase; Prov 2e-04
PRK03059856 PRK03059, PRK03059, PII uridylyl-transferase; Prov 2e-04
PRK03381774 PRK03381, PRK03381, PII uridylyl-transferase; Prov 3e-04
cd0492672 cd04926, ACT_ACR_4, C-terminal ACT domain, of a no 3e-04
cd0487671 cd04876, ACT_RelA-SpoT, ACT domain found C-termina 7e-04
PRK03381774 PRK03381, PRK03381, PII uridylyl-transferase; Prov 0.001
pfam1329177 pfam13291, ACT_4, ACT domain 0.002
PRK00275895 PRK00275, glnD, PII uridylyl-transferase; Provisio 0.003
pfam0184266 pfam01842, ACT, ACT domain 0.003
cd0211660 cd02116, ACT, ACT domains are commonly involved in 0.004
>gnl|CDD|233534 TIGR01693, UTase_glnD, [Protein-PII] uridylyltransferase Back     alignment and domain information
 Score = 52.8 bits (127), Expect = 9e-08
 Identities = 46/200 (23%), Positives = 74/200 (37%), Gaps = 11/200 (5%)

Query: 82  DADYIPMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNT-EGSV 140
            A     P  LID    S  T V +   D+ G       AL  L L V    VNT +  V
Sbjct: 649 RALSSGGPLALIDGTRPSGGTEVFIYAPDQPGLFAKVAGALAMLSLSVHDAQVNTTKDGV 708

Query: 141 KQTKFFITRLDTGRKVEDPDLLERIRLT--IINNLLKYHPESSEQLAMGEAFGIKAPEKK 198
               F +  L       +    E ++    ++  L K     +          ++     
Sbjct: 709 ALDTFVVQDLFGSPPAAERVFQELLQGLVDVLAGLAKDPD--TISARRARRRRLQHFAVP 766

Query: 199 LDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKD 258
             V I           K +++ +   DRPGLL  + + + ++ + ++SA+I T G  A+D
Sbjct: 767 PRVTILNTA-----SRKATIMEVRALDRPGLLARVGRTLEELGLSIQSAKITTFGEKAED 821

Query: 259 KFHVS-YGGAALNSSLSQVL 277
            F+V+   G  L     Q L
Sbjct: 822 VFYVTDLFGLKLTDEEEQRL 841


This model describes GlnD, the uridylyltransferase/uridylyl-removing enzyme for the nitrogen regulatory protein PII. Not all homologs of PII share the property of uridylyltransferase modification on the characteristic Tyr residue (see Prosite pattern PS00496 and document PDOC00439), but the modification site is preserved in the PII homolog of all species with a member of this family [Central intermediary metabolism, Nitrogen metabolism, Regulatory functions, Protein interactions]. Length = 850

>gnl|CDD|153171 cd04899, ACT_ACR-UUR-like_2, C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>gnl|CDD|153145 cd04873, ACT_UUR-ACR-like, ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|225400 COG2844, GlnD, UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|235342 PRK05092, PRK05092, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|235101 PRK03059, PRK03059, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|153198 cd04926, ACT_ACR_4, C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>gnl|CDD|153148 cd04876, ACT_RelA-SpoT, ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>gnl|CDD|235123 PRK03381, PRK03381, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|222030 pfam13291, ACT_4, ACT domain Back     alignment and domain information
>gnl|CDD|234709 PRK00275, glnD, PII uridylyl-transferase; Provisional Back     alignment and domain information
>gnl|CDD|190133 pfam01842, ACT, ACT domain Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
PRK05007884 PII uridylyl-transferase; Provisional 100.0
PRK01759854 glnD PII uridylyl-transferase; Provisional 100.0
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.97
PRK00275895 glnD PII uridylyl-transferase; Provisional 99.97
PRK04374869 PII uridylyl-transferase; Provisional 99.96
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 99.96
PRK05092931 PII uridylyl-transferase; Provisional 99.96
PRK03059856 PII uridylyl-transferase; Provisional 99.96
PRK03381774 PII uridylyl-transferase; Provisional 99.95
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.87
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.83
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 99.83
cd0489775 ACT_ACR_3 ACT domain-containing protein which is c 99.71
cd0489572 ACT_ACR_1 ACT domain-containing protein which is c 99.68
PRK11589190 gcvR glycine cleavage system transcriptional repre 99.65
PRK00275895 glnD PII uridylyl-transferase; Provisional 99.64
PRK01759854 glnD PII uridylyl-transferase; Provisional 99.63
PRK05007884 PII uridylyl-transferase; Provisional 99.62
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 99.62
cd0492574 ACT_ACR_2 ACT domain-containing protein which is c 99.61
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 99.61
cd0489675 ACT_ACR-like_3 ACT domain-containing protein which 99.6
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 99.6
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, 99.58
PRK04374869 PII uridylyl-transferase; Provisional 99.56
PRK03059856 PII uridylyl-transferase; Provisional 99.55
cd0492776 ACT_ACR-like_2 Second ACT domain, of a novel type 99.55
PRK05092931 PII uridylyl-transferase; Provisional 99.54
TIGR01693850 UTase_glnD [Protein-PII] uridylyltransferase. This 99.51
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [P 99.45
PRK03381774 PII uridylyl-transferase; Provisional 99.41
PRK00227693 glnD PII uridylyl-transferase; Provisional 99.38
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 99.36
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 99.33
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 99.32
COG2716176 GcvR Glycine cleavage system regulatory protein [A 99.31
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type o 99.29
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the b 99.27
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 99.04
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial sign 99.0
cd0492868 ACT_TyrKc Uncharacterized, N-terminal ACT domain o 98.87
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 98.68
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.5
PF0184266 ACT: ACT domain; InterPro: IPR002912 The ACT domai 98.48
PF1374076 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A. 98.46
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 98.44
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 98.39
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 98.36
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphose 98.33
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 98.07
PRK0019490 hypothetical protein; Validated 98.01
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 98.01
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 98.01
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahy 97.99
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine C 97.98
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet un 97.96
cd0489377 ACT_GcvR_1 ACT domains that comprise the Glycine C 97.94
PRK0019490 hypothetical protein; Validated 97.93
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.9
COG4747142 ACT domain-containing protein [General function pr 97.79
PF1329180 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A. 97.69
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 97.62
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-te 97.61
PRK11589 190 gcvR glycine cleavage system transcriptional repre 97.58
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 97.52
PRK13010289 purU formyltetrahydrofolate deformylase; Reviewed 97.48
PRK06027 286 purU formyltetrahydrofolate deformylase; Reviewed 97.45
COG383090 ACT domain-containing protein [Signal transduction 97.41
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 97.41
cd0489469 ACT_ACR-like_1 ACT domain-containing protein which 97.36
TIGR00655280 PurU formyltetrahydrofolate deformylase. This mode 97.36
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 97.35
PRK13011 286 formyltetrahydrofolate deformylase; Reviewed 97.33
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 97.3
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegra 97.25
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 97.24
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 97.23
COG383090 ACT domain-containing protein [Signal transduction 97.21
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 97.21
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 97.18
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 97.17
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 97.17
PRK13011286 formyltetrahydrofolate deformylase; Reviewed 97.16
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 97.14
TIGR00655 280 PurU formyltetrahydrofolate deformylase. This mode 97.14
cd0487774 ACT_TyrR N-terminal ACT domain of the TyrR protein 97.11
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 96.98
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.98
COG0788287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 96.96
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 96.95
CHL00100174 ilvH acetohydroxyacid synthase small subunit 96.94
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-termin 96.93
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 96.92
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 96.89
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 96.89
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 96.88
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 96.87
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monof 96.83
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia 96.8
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 96.77
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 96.73
cd0489877 ACT_ACR-like_4 ACT domain-containing protein which 96.72
PRK0673776 acetolactate synthase 1 regulatory subunit; Valida 96.72
PRK0817896 acetolactate synthase 1 regulatory subunit; Review 96.71
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 96.7
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel prot 96.64
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 96.61
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofuncti 96.58
PRK08577136 hypothetical protein; Provisional 96.55
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 96.55
COG0788 287 PurU Formyltetrahydrofolate hydrolase [Nucleotide 96.54
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 96.54
PRK1356284 acetolactate synthase 1 regulatory subunit; Provis 96.52
cd0211660 ACT ACT domains are commonly involved in specifica 96.52
TIGR00119157 acolac_sm acetolactate synthase, small subunit. ac 96.46
CHL00100174 ilvH acetohydroxyacid synthase small subunit 96.45
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet unchar 96.44
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; R 96.41
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 96.4
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 96.39
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 96.33
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 96.33
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 96.3
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunction 96.3
PRK08577136 hypothetical protein; Provisional 96.3
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-te 96.25
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine 96.25
PRK04435147 hypothetical protein; Provisional 96.23
PRK07334403 threonine dehydratase; Provisional 96.03
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the R 96.01
cd0211660 ACT ACT domains are commonly involved in specifica 95.99
PRK1115276 ilvM acetolactate synthase 2 regulatory subunit; P 95.9
PRK07334403 threonine dehydratase; Provisional 95.84
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain o 95.81
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehy 95.81
PRK04435147 hypothetical protein; Provisional 95.67
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel prot 95.67
PRK00227693 glnD PII uridylyl-transferase; Provisional 95.63
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 95.63
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 95.56
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-depende 95.43
TIGR00656401 asp_kin_monofn aspartate kinase, monofunctional cl 95.33
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 95.19
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus sub 95.18
PF1371063 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B. 95.09
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D- 95.05
PRK06635404 aspartate kinase; Reviewed 95.0
PRK11899279 prephenate dehydratase; Provisional 94.92
COG2716176 GcvR Glycine cleavage system regulatory protein [A 94.77
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 94.71
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-d 94.67
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 94.6
PRK10872743 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; 94.52
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3', 94.52
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent a 94.44
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 94.32
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 94.11
TIGR00691683 spoT_relA (p)ppGpp synthetase, RelA/SpoT family. ( 94.07
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 94.01
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 93.81
COG0077279 PheA Prephenate dehydratase [Amino acid transport 93.79
PRK06291465 aspartate kinase; Provisional 93.46
PF1384065 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 93.38
PRK08210403 aspartate kinase I; Reviewed 93.32
COG1707218 ACT domain-containing protein [General function pr 93.28
cd0488568 ACT_ThrD-I Tandem C-terminal ACT domains of threon 93.03
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 93.0
PRK07431587 aspartate kinase; Provisional 92.84
PRK10622386 pheA bifunctional chorismate mutase/prephenate deh 92.36
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphos 92.29
cd0487184 ACT_PSP_2 ACT domains found N-terminal of phosphos 92.21
PRK08818370 prephenate dehydrogenase; Provisional 92.16
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 92.06
PRK09034454 aspartate kinase; Reviewed 91.85
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, 91.77
COG1707 218 ACT domain-containing protein [General function pr 91.59
COG4747142 ACT domain-containing protein [General function pr 91.46
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent a 91.36
TIGR00657441 asp_kinases aspartate kinase. The Lys-sensitive en 91.3
PRK08198404 threonine dehydratase; Provisional 91.09
PF1384065 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2 91.09
PRK06382406 threonine dehydratase; Provisional 91.07
PRK06382406 threonine dehydratase; Provisional 90.89
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases 90.78
cd0489877 ACT_ACR-like_4 ACT domain-containing protein which 90.5
cd0493575 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AK 90.49
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 90.45
TIGR00719208 sda_beta L-serine dehydratase, iron-sulfur-depende 90.4
PRK11898283 prephenate dehydratase; Provisional 90.31
PRK06349426 homoserine dehydrogenase; Provisional 90.25
PRK06545359 prephenate dehydrogenase; Validated 90.07
PRK09224504 threonine dehydratase; Reviewed 89.79
PRK07431587 aspartate kinase; Provisional 89.74
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 89.66
TIGR01270 464 Trp_5_monoox tryptophan 5-monooxygenase, tetrameri 89.64
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 89.08
PLN02317382 arogenate dehydratase 88.93
PRK09181475 aspartate kinase; Validated 88.72
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 88.56
cd0493275 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal 88.36
TIGR01268 436 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetra 88.2
PRK06545359 prephenate dehydrogenase; Validated 88.2
PLN02551521 aspartokinase 88.04
cd0492266 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctiona 87.69
COG0527447 LysC Aspartokinases [Amino acid transport and meta 87.66
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent ar 87.34
PRK12483521 threonine dehydratase; Reviewed 87.13
cd0493473 ACT_AK-Hom3_1 CT domains located C-terminal to the 86.77
COG0077279 PheA Prephenate dehydratase [Amino acid transport 86.66
PLN02550591 threonine dehydratase 86.35
cd0490685 ACT_ThrD-I_1 First of two tandem C-terminal ACT do 85.77
TIGR01127380 ilvA_1Cterm threonine dehydratase, medium form. A 85.61
PRK11899279 prephenate dehydratase; Provisional 84.94
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 84.11
PRK06349426 homoserine dehydrogenase; Provisional 83.0
cd0493764 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimela 82.68
PRK09084448 aspartate kinase III; Validated 82.67
COG0440163 IlvH Acetolactate synthase, small (regulatory) sub 82.0
cd0491966 ACT_AK-Hom3_2 ACT domains located C-terminal to th 81.41
cd0491275 ACT_AKiii-LysC-EC-like_1 ACT domains located C-ter 81.29
COG2150167 Predicted regulator of amino acid metabolism, cont 80.42
cd0486860 ACT_AK-like ACT domains C-terminal to the catalyti 80.36
KOG2663309 consensus Acetolactate synthase, small subunit [Am 80.34
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.8e-32  Score=287.16  Aligned_cols=191  Identities=24%  Similarity=0.290  Sum_probs=167.2

Q ss_pred             CCcEEEEeecCCCCeEEEEEEeCCCccHHHHHHHHHHHCCceEEEEEEEEcCCeE-EEEEEEeecCCCCCCCChHHHHHH
Q 022552           87 PMPHVLIDQDSNSDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVK-QTKFFITRLDTGRKVEDPDLLERI  165 (295)
Q Consensus        87 ~~p~V~i~~~~~~~~t~V~V~~~DrpGLl~~I~~vL~~~glnI~~A~I~T~~~~~-~D~F~V~~~~~g~~~~d~~~le~L  165 (295)
                      .+|.|.+++..+.++++|+|+++||||||++||++|+.+|+||++|+|+|+++|. +|+|+|++. +|.++ +++++++|
T Consensus       687 ~~p~V~i~~~~~~~~t~V~V~a~DrpGLfa~Ia~~La~~~L~I~~A~I~T~~dg~alD~F~V~d~-~g~~~-~~~~~~~I  764 (884)
T PRK05007        687 DKPLVLLSKQATRGGTEIFIWSPDRPYLFAAVCAELDRRNLSVHDAQIFTSRDGMAMDTFIVLEP-DGSPL-SQDRHQVI  764 (884)
T ss_pred             CCCeEEEEecCCCCeEEEEEEecCCcCHHHHHHHHHHHCCCEEEEEEEEEcCCCeEEEEEEEECC-CCCCC-CHHHHHHH
Confidence            4788999999999999999999999999999999999999999999999999965 799999997 78877 46799999


Q ss_pred             HHHHHHhhcccCCCchhHhhhccccCccCCcccccccccceEEecCCCC-ceEEEEEEeCCCcchHHHHHHHHHhCCceE
Q 022552          166 RLTIINNLLKYHPESSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGP-KRSLLYIETADRPGLLVEIMKIIADVNVDV  244 (295)
Q Consensus       166 ~~~L~~~L~~~~~~~~~~La~~~~~~~~~~~r~~~~~~~~~V~i~~~~~-~~t~IeV~a~DRPGLL~dIt~~L~~~gI~I  244 (295)
                      +..|.++|.+.... .. .    .+  +.+++...+.++++|.|+|+.+ ++|+|+|.|.|||||||+|+++|.++|++|
T Consensus       765 ~~~L~~aL~~~~~~-~~-~----~~--~~~~~~~~~~~~~~V~~d~~~s~~~TvlEV~a~DRpGLL~~I~~~l~~~~l~I  836 (884)
T PRK05007        765 RKALEQALTQSSPQ-PP-K----PR--RLPAKLRHFNVPTEVSFLPTHTDRRSYMELIALDQPGLLARVGKIFADLGISL  836 (884)
T ss_pred             HHHHHHHHcCCCCC-cc-c----cc--ccccccCCCCCCCEEEEccCCCCCeEEEEEEeCCchHHHHHHHHHHHHCCcEE
Confidence            99999999763211 11 1    11  1234556778899999998875 499999999999999999999999999999


Q ss_pred             EEEEEEecCCeeeeEEEEEe-CCCCCChHHHHHHHHHHHHHcCC
Q 022552          245 ESAEIDTEGLVAKDKFHVSY-GGAALNSSLSQVLVNCLRYYLRR  287 (295)
Q Consensus       245 ~~A~I~T~g~~a~D~F~V~~-~G~~l~~~~~~~L~~~L~~~L~~  287 (295)
                      ++|||+|.|++|+|+|||++ +|.+++++++++|+++|+++|..
T Consensus       837 ~~AkI~T~gera~DvFyV~~~~g~~l~~~~~~~l~~~L~~~l~~  880 (884)
T PRK05007        837 HGARITTIGERVEDLFILATADRRALNEELQQELRQRLTEALNP  880 (884)
T ss_pred             EEEEEeccCceEEEEEEEEcCCCCcCCHHHHHHHHHHHHHHHhh
Confidence            99999999999999999998 89999966899999999999854



>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04897 ACT_ACR_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04895 ACT_ACR_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK00275 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK01759 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK05007 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04896 ACT_ACR-like_3 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04900 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, includes the first of two C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>PRK04374 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK03059 PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04927 ACT_ACR-like_2 Second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK05092 PII uridylyl-transferase; Provisional Back     alignment and domain information
>TIGR01693 UTase_glnD [Protein-PII] uridylyltransferase Back     alignment and domain information
>COG2844 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK03381 PII uridylyl-transferase; Provisional Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>cd04928 ACT_TyrKc Uncharacterized, N-terminal ACT domain of an Arabidopsis/Oryza predicted tyrosine kinase and other related ACT domains Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PF01842 ACT: ACT domain; InterPro: IPR002912 The ACT domain is found in a variety of contexts and is proposed to be a conserved regulatory binding fold Back     alignment and domain information
>PF13740 ACT_6: ACT domain; PDB: 1ZPV_A 3P96_A 1U8S_A Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>cd04893 ACT_GcvR_1 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PF13291 ACT_4: ACT domain; PDB: 2KO1_B 3IBW_A Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>PRK11589 gcvR glycine cleavage system transcriptional repressor; Provisional Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd04894 ACT_ACR-like_1 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>PRK13011 formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase Back     alignment and domain information
>cd04877 ACT_TyrR N-terminal ACT domain of the TyrR protein Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>cd04889 ACT_PDH-BS-like C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) enzyme that catalyzes the formation of 4-hydroxyphenylpyruvate from prephenate Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>COG0788 PurU Formyltetrahydrofolate hydrolase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional Back     alignment and domain information
>PRK07334 threonine dehydratase; Provisional Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK00227 glnD PII uridylyl-transferase; Provisional Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit Back     alignment and domain information
>TIGR00656 asp_kin_monofn aspartate kinase, monofunctional class Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>PF13710 ACT_5: ACT domain; PDB: 2FGC_A 2PC6_A 2F1F_B Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>COG2716 GcvR Glycine cleavage system regulatory protein [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK10872 relA (p)ppGpp synthetase I/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>TIGR00691 spoT_relA (p)ppGpp synthetase, RelA/SpoT family Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04885 ACT_ThrD-I Tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>cd04871 ACT_PSP_2 ACT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>TIGR00657 asp_kinases aspartate kinase Back     alignment and domain information
>PRK08198 threonine dehydratase; Provisional Back     alignment and domain information
>PF13840 ACT_7: ACT domain ; PDB: 3S1T_A 1ZHV_A 3AB4_K 3AB2_O 2DTJ_A 3AAW_A 2RE1_B 3MAH_A 1ZVP_D Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>PRK06382 threonine dehydratase; Provisional Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>cd04898 ACT_ACR-like_4 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>cd04935 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII (LysC)-like aspartokinase/meso-diaminopimelate decarboxylase (DAPDC) bacterial protein Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>TIGR00719 sda_beta L-serine dehydratase, iron-sulfur-dependent, beta subunit Back     alignment and domain information
>PRK11898 prephenate dehydratase; Provisional Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PRK09224 threonine dehydratase; Reviewed Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>TIGR01270 Trp_5_monoox tryptophan 5-monooxygenase, tetrameric Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02317 arogenate dehydratase Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>cd04932 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>TIGR01268 Phe4hydrox_tetr phenylalanine-4-hydroxylase, tetrameric form Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>PLN02551 aspartokinase Back     alignment and domain information
>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>PRK12483 threonine dehydratase; Reviewed Back     alignment and domain information
>cd04934 ACT_AK-Hom3_1 CT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae, and other related ACT domains Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02550 threonine dehydratase Back     alignment and domain information
>cd04906 ACT_ThrD-I_1 First of two tandem C-terminal ACT domains of threonine dehydratase I (ThrD-I; L-threonine hydrolyase) Back     alignment and domain information
>TIGR01127 ilvA_1Cterm threonine dehydratase, medium form Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 Back     alignment and domain information
>cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] Back     alignment and domain information
>cd04868 ACT_AK-like ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>KOG2663 consensus Acetolactate synthase, small subunit [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 1e-05
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Length = 88 Back     alignment and structure
 Score = 41.9 bits (99), Expect = 1e-05
 Identities = 5/45 (11%), Positives = 20/45 (44%)

Query: 219 LYIETADRPGLLVEIMKIIADVNVDVESAEIDTEGLVAKDKFHVS 263
           + I   D+ G+  +I  +I+  + ++ +  ++ +  +      + 
Sbjct: 8   IRIVGEDKNGMTNQITGVISKFDTNIRTIVLNAKDGIFTCNLMIF 52


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
2nyi_A195 Unknown protein; protein structure initiative, PSI 99.8
1u8s_A192 Glycine cleavage system transcriptional repressor, 99.76
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 98.95
2f06_A144 Conserved hypothetical protein; structural genomic 98.47
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 98.19
2nyi_A195 Unknown protein; protein structure initiative, PSI 98.17
1zpv_A91 ACT domain protein; structural genomics, PSI, prot 98.08
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 98.06
1u8s_A 192 Glycine cleavage system transcriptional repressor, 98.02
2ko1_A88 CTR148A, GTP pyrophosphokinase; homodimer, alpha+b 97.8
2re1_A167 Aspartokinase, alpha and beta subunits; structural 97.6
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 97.48
3o1l_A302 Formyltetrahydrofolate deformylase; structural gen 97.4
3obi_A288 Formyltetrahydrofolate deformylase; structural gen 97.3
3n0v_A286 Formyltetrahydrofolate deformylase; formyl transfe 97.27
3lou_A292 Formyltetrahydrofolate deformylase; structural gen 97.26
3lou_A 292 Formyltetrahydrofolate deformylase; structural gen 97.22
3n0v_A 286 Formyltetrahydrofolate deformylase; formyl transfe 97.19
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 97.17
3nrb_A287 Formyltetrahydrofolate deformylase; N-terminal ACT 97.14
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 97.12
3o1l_A 302 Formyltetrahydrofolate deformylase; structural gen 97.06
3nrb_A 287 Formyltetrahydrofolate deformylase; N-terminal ACT 97.05
2pc6_A165 Probable acetolactate synthase isozyme III (small; 97.03
2jhe_A 190 Transcription regulator TYRR; aromatic hydrocarbon 96.94
3obi_A 288 Formyltetrahydrofolate deformylase; structural gen 96.89
2f1f_A164 Acetolactate synthase isozyme III small subunit; f 96.82
3p96_A 415 Phosphoserine phosphatase SERB; ssgcid, structural 96.67
2pc6_A165 Probable acetolactate synthase isozyme III (small; 96.44
3s1t_A181 Aspartokinase; ACT domain, threonine binding, regu 96.39
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 96.26
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 96.15
1y7p_A 223 Hypothetical protein AF1403; structural genomics, 95.94
4go7_X200 Aspartokinase; transferase; 2.00A {Mycobacterium t 95.89
2fgc_A193 Acetolactate synthase, small subunit; regulatory s 95.4
3ab4_A421 Aspartokinase; aspartate kinase, concerted inhibit 95.05
1y7p_A223 Hypothetical protein AF1403; structural genomics, 94.97
2f06_A144 Conserved hypothetical protein; structural genomic 94.73
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 94.43
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 93.98
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition 93.51
3mwb_A313 Prephenate dehydratase; L-Phe, PSI, MCSG, structur 93.49
2qmw_A267 PDT, prephenate dehydratase; APC85812, prephenate 93.12
3luy_A329 Probable chorismate mutase; structural genomics, A 92.72
3c1m_A473 Probable aspartokinase; allosteric inhibition, thr 92.31
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 92.19
3l76_A600 Aspartokinase; allostery, ACT domains, kinase tran 91.91
3l76_A600 Aspartokinase; allostery, ACT domains, kinase tran 91.79
3tvi_A446 Aspartokinase; structural genomics, ACT domains, r 89.51
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 89.11
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 87.56
1phz_A 429 Protein (phenylalanine hydroxylase); aromatic amin 86.74
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 86.44
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 86.13
2qmx_A283 Prephenate dehydratase; APC86053, L-Phe inhibition 84.41
2re1_A167 Aspartokinase, alpha and beta subunits; structural 83.86
2dt9_A167 Aspartokinase; protein-ligand complex, regulatory 83.55
2dtj_A178 Aspartokinase; protein-ligand complex, regulatory 82.51
2cdq_A510 Aspartokinase; aspartate kinase, amino acid metabo 81.08
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
Probab=99.80  E-value=7.9e-19  Score=153.65  Aligned_cols=156  Identities=14%  Similarity=0.183  Sum_probs=113.9

Q ss_pred             CeEEEEEEeCCCccHHHHHHHHHHHCCceEEEEEEEEcCCeEEEEEEEeecCCCCCCCChHHHHHHHHHHHHhhcccCCC
Q 022552          100 DATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIINNLLKYHPE  179 (295)
Q Consensus       100 ~~t~V~V~~~DrpGLl~~I~~vL~~~glnI~~A~I~T~~~~~~D~F~V~~~~~g~~~~d~~~le~L~~~L~~~L~~~~~~  179 (295)
                      ..++|+|+|+|||||++.|+++|+++|+||++|++++..+++.-.|.+...  +.  ....+++.|+..|...+.+... 
T Consensus         4 ~~~~ltv~~~DrpGiva~vs~~La~~g~NI~da~q~~~~~~f~m~~~v~~~--~~--~~~~~~~~l~~~L~~~~~~~~~-   78 (195)
T 2nyi_A            4 QSFVVSVAGSDRVGIVHDFSWALKNISANVESSRMACLGGDFAMIVLVSLN--AK--DGKLIQSALESALPGFQISTRR-   78 (195)
T ss_dssp             EEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEES--SS--SSHHHHHHHHHHSTTCEEEEEE-
T ss_pred             eEEEEEEEeCCCCcHHHHHHHHHHHCCCCEEEEEeEEECCeEEEEEEEEec--Cc--cchhHHHHHHHHHHHHHHhcCC-
Confidence            357899999999999999999999999999999999999988557777653  21  2234567777776654322100 


Q ss_pred             chhHhhhccccCccCCcccccccccceEEecCCCCceEEEEEEeCCCcchHHHHHHHHHhCCceEEEEEEEecC--Ceee
Q 022552          180 SSEQLAMGEAFGIKAPEKKLDVDIATHIHVKEDGPKRSLLYIETADRPGLLVEIMKIIADVNVDVESAEIDTEG--LVAK  257 (295)
Q Consensus       180 ~~~~La~~~~~~~~~~~r~~~~~~~~~V~i~~~~~~~t~IeV~a~DRPGLL~dIt~~L~~~gI~I~~A~I~T~g--~~a~  257 (295)
                       .           .. .+  .   .+    .......++|+|.|+|||||+++|+++|+++|+||..++..|.+  +++.
T Consensus        79 -~-----------~~-~~--~---~~----~~~~~~~~iltv~g~DrpGiva~Vt~~La~~g~nI~~~~~~t~~~~~~~~  136 (195)
T 2nyi_A           79 -A-----------SS-VA--E---RH----VSPDTREYELYVEGPDSEGIVEAVTAVLAKKGANIVELETETLPAPFAGF  136 (195)
T ss_dssp             -C-----------CC-C-------------CCTTEEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEEECSSTTC
T ss_pred             -e-----------EE-EE--e---CC----cCCCCcEEEEEEEeCCCcCHHHHHHHHHHHcCCCEEEceeeecccccCCC
Confidence             0           00 01  0   01    12223589999999999999999999999999999999999998  7889


Q ss_pred             eEEEEEe-CCCCCChHHHHHHHHHHHHH
Q 022552          258 DKFHVSY-GGAALNSSLSQVLVNCLRYY  284 (295)
Q Consensus       258 D~F~V~~-~G~~l~~~~~~~L~~~L~~~  284 (295)
                      +.|+++- .+.+ .+.. ++|++.|...
T Consensus       137 ~~F~m~~~~~~~-~~~~-~~l~~~l~~~  162 (195)
T 2nyi_A          137 TLFRMGSRVAFP-FPLY-QEVVTALSRV  162 (195)
T ss_dssp             EEEEEEEEEEEE-GGGH-HHHHHHHHHH
T ss_pred             CeEEEEEEEEcC-CCcc-HHHHHHHHHH
Confidence            9999975 3322 1224 6677766644



>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>2nyi_A Unknown protein; protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, structural genomics; 1.80A {Galdieria sulphuraria} Back     alignment and structure
>1zpv_A ACT domain protein; structural genomics, PSI, protein structure INIT midwest center for structural genomics, MCSG, unknown funct; 1.90A {Streptococcus pneumoniae} SCOP: d.58.18.7 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>1u8s_A Glycine cleavage system transcriptional repressor, putative; structural genomics, protein structure initiative (PSI), domain swapping; 2.45A {Vibrio cholerae} SCOP: d.58.18.5 d.58.18.5 Back     alignment and structure
>2ko1_A CTR148A, GTP pyrophosphokinase; homodimer, alpha+beta, transferase, structural genomics, PSI-2, protein structure initiative; NMR {Chlorobaculum tepidum} PDB: 3ibw_A Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3lou_A Formyltetrahydrofolate deformylase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative hydrolase; HET: MSE; 1.90A {Burkholderia mallei} Back     alignment and structure
>3n0v_A Formyltetrahydrofolate deformylase; formyl transferase, ACT domain, structural genomics, joint C structural genomics, JCSG; HET: MSE; 2.25A {Pseudomonas putida} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>3obi_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE; 1.95A {Rhodopseudomonas palustris} Back     alignment and structure
>2f1f_A Acetolactate synthase isozyme III small subunit; ferredoxin fold, ACT domain, transferase; HET: P33 1PE; 1.75A {Escherichia coli} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2pc6_A Probable acetolactate synthase isozyme III (small; regulatory subunit, structural genomi protein structure initiative; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3s1t_A Aspartokinase; ACT domain, threonine binding, regulatory domain of aspartok transferase; 1.63A {Mycobacterium tuberculosis} Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>4go7_X Aspartokinase; transferase; 2.00A {Mycobacterium tuberculosis} PDB: 4go5_X Back     alignment and structure
>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomi protein structure initiative; 2.30A {Thermotoga maritima} SCOP: d.58.18.6 d.58.18.6 Back     alignment and structure
>3ab4_A Aspartokinase; aspartate kinase, concerted inhibition, alternative initiati amino-acid biosynthesis, ATP-binding; HET: LYS; 2.47A {Corynebacterium glutamicum} PDB: 3aaw_A* 3ab2_A Back     alignment and structure
>1y7p_A Hypothetical protein AF1403; structural genomics, protein structure initiative, PSI, alpha-beta-alpha sandwich; HET: RIP; 1.90A {Archaeoglobus fulgidus} SCOP: c.23.1.7 d.58.18.12 Back     alignment and structure
>2f06_A Conserved hypothetical protein; structural genomics hypothetical protein, PSI, protein struc initiative; HET: MSE HIS; 2.10A {Bacteroides thetaiotaomicron} SCOP: d.58.18.11 d.58.18.11 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Back     alignment and structure
>3mwb_A Prephenate dehydratase; L-Phe, PSI, MCSG, structural genomics, midwest center for ST genomics, protein structure initiative, lyase; HET: MSE PHE; 2.00A {Arthrobacter aurescens} Back     alignment and structure
>2qmw_A PDT, prephenate dehydratase; APC85812, prephenate dehydratase (PDT), staphylococcus aureu aureus MU50, structural genomics, PSI-2; 2.30A {Staphylococcus aureus subsp} SCOP: c.94.1.1 d.58.18.3 Back     alignment and structure
>3luy_A Probable chorismate mutase; structural genomics, APC38059, 3-phenylp PSI-2, protein structure initiative; HET: PPY; 2.00A {Bifidobacterium adolescentis} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>3l76_A Aspartokinase; allostery, ACT domains, kinase transferase; HET: LYS; 2.54A {Synechocystis} Back     alignment and structure
>3tvi_A Aspartokinase; structural genomics, ACT domains, regulatory domains, kinase transferase, PSI-2, protein structure initiative; HET: LYS; 3.00A {Clostridium acetobutylicum} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1phz_A Protein (phenylalanine hydroxylase); aromatic amino acid hydroxylase, phosphorylation, intrasteric regulation, allosteric regulation; 2.20A {Rattus norvegicus} SCOP: d.58.18.3 d.178.1.1 PDB: 2phm_A Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>2qmx_A Prephenate dehydratase; APC86053, L-Phe inhibition, PDT, CHL tepidum TLS, structural genomics, PSI-2, protein structure initiative; HET: PHE; 2.30A {Chlorobium tepidum tls} Back     alignment and structure
>2re1_A Aspartokinase, alpha and beta subunits; structural genomics, protein structure initiative, midwest center for structural genomics; 2.75A {Neisseria meningitidis MC58} Back     alignment and structure
>2dt9_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; 2.15A {Thermus thermophilus} PDB: 2zho_A Back     alignment and structure
>2dtj_A Aspartokinase; protein-ligand complex, regulatory subunit, transferase; HET: CIT; 1.58A {Corynebacterium glutamicum} PDB: 3aaw_B* 3ab2_B 3ab4_B* Back     alignment and structure
>2cdq_A Aspartokinase; aspartate kinase, amino acid metabolism, ACT domain, alloste S-adenosylmethionine, lysine, allosteric effector, plant; HET: TAR SAM LYS; 2.85A {Arabidopsis thaliana} SCOP: c.73.1.3 d.58.18.10 d.58.18.10 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 295
d1y7pa277 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N 0.001
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 77 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: AF1403 N-terminal domain-like
domain: Hypothetical protein AF1403, N-terminal domain
species: Archaeon Archaeoglobus fulgidus [TaxId: 2234]
 Score = 34.7 bits (80), Expect = 0.001
 Identities = 8/33 (24%), Positives = 17/33 (51%)

Query: 219 LYIETADRPGLLVEIMKIIADVNVDVESAEIDT 251
           L I   ++ G+L ++  IIA+   ++  A+   
Sbjct: 4   LRIIAENKIGVLRDLTTIIAEEGGNITFAQTFL 36


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 98.76
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 98.53
d1u8sa186 putative transcriptional repressor VC2159 {Vibrio 98.45
d1zpva183 UPF0237 protein SP0238 {Streptococcus pneumoniae [ 98.31
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 98.18
d1u8sa293 putative transcriptional repressor VC2159 {Vibrio 98.05
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 97.82
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 97.64
d2f06a171 Hypothetical protein BT0572 {Bacteroides thetaiota 97.62
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 97.48
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 97.48
d1y7pa277 Hypothetical protein AF1403, N-terminal domain {Ar 97.37
d2f06a270 Hypothetical protein BT0572 {Bacteroides thetaiota 97.27
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 97.23
d1ygya378 Phosphoglycerate dehydrogenase, regulatory (C-term 97.21
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 97.08
d2fgca278 Acetolactate synthase small subunit, IlvH {Thermot 97.07
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 96.99
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 96.96
d2f1fa176 Acetolactate synthase small subunit, IlvH {Escheri 96.96
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 96.9
d2pc6a277 Acetolactate synthase small subunit, IlvH {Nitroso 96.84
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 96.76
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 96.37
d2qmwa280 Prephenate dehydratase C-terminal domain {Staphylo 93.19
d1phza197 Phenylalanine hydroxylase N-terminal domain {Rat ( 92.51
d2cdqa291 Aspartokinase {Thale cress (Arabidopsis thaliana) 88.14
d2hmfa3100 Aspartokinase {Methanococcus jannaschii [TaxId: 21 84.54
d2hmfa267 Aspartokinase {Methanococcus jannaschii [TaxId: 21 84.51
d2hmfa3100 Aspartokinase {Methanococcus jannaschii [TaxId: 21 82.71
d2cdqa291 Aspartokinase {Thale cress (Arabidopsis thaliana) 81.98
d2hmfa267 Aspartokinase {Methanococcus jannaschii [TaxId: 21 81.69
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: ACT-like
family: Glycine cleavage system transcriptional repressor
domain: putative transcriptional repressor VC2159
species: Vibrio cholerae [TaxId: 666]
Probab=98.76  E-value=3.9e-08  Score=72.95  Aligned_cols=65  Identities=14%  Similarity=0.210  Sum_probs=54.7

Q ss_pred             CCeEEEEEEeCCCccHHHHHHHHHHHCCceEEEEEEEEcCCeEEEEEEEeecCCCCCCCChHHHHHHHHHHHH
Q 022552           99 SDATIVQLSFGDRLGALIDTMNALKDLGLDVAKGTVNTEGSVKQTKFFITRLDTGRKVEDPDLLERIRLTIIN  171 (295)
Q Consensus        99 ~~~t~V~V~~~DrpGLl~~I~~vL~~~glnI~~A~I~T~~~~~~D~F~V~~~~~g~~~~d~~~le~L~~~L~~  171 (295)
                      ..+++|+|.|+||||++++++++|+++|+||.+++..+.++.+.-.+.|.-    .    +..+++|+..|..
T Consensus         3 ~~~~vitv~G~DrpGiva~vt~~l~~~g~NI~d~~~~~~~~~~~~~~~v~~----~----~~~~~~l~~~L~~   67 (86)
T d1u8sa1           3 TQHLVITAVGTDRPGICNEVVRLVTQAGCNIIDSRIAMFGKEFTLLMLISG----S----PSNITRVETTLPL   67 (86)
T ss_dssp             CEEEEEEEEEECCTTHHHHHHHHHHHTTCEEEEEEEEEETTEEEEEEEEEE----C----HHHHHHHHHHHHH
T ss_pred             ccEEEEEEEeCCCChHHHHHHHHHHHCCCeEEEeEeEEECCeeEEEEEEEc----C----cccHHHHHHHHHH
Confidence            457899999999999999999999999999999999999998865565543    1    3567788887776



>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa1 d.58.18.5 (A:2-87) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zpva1 d.58.18.7 (A:1-83) UPF0237 protein SP0238 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1u8sa2 d.58.18.5 (A:88-180) putative transcriptional repressor VC2159 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2f06a1 d.58.18.11 (A:71-141) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1y7pa2 d.58.18.12 (A:2-78) Hypothetical protein AF1403, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f06a2 d.58.18.11 (A:1-70) Hypothetical protein BT0572 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya3 d.58.18.1 (A:452-529) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fgca2 d.58.18.6 (A:27-104) Acetolactate synthase small subunit, IlvH {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f1fa1 d.58.18.6 (A:2-77) Acetolactate synthase small subunit, IlvH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d2pc6a2 d.58.18.6 (A:1-77) Acetolactate synthase small subunit, IlvH {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2qmwa2 d.58.18.3 (A:185-264) Prephenate dehydratase C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1phza1 d.58.18.3 (A:19-115) Phenylalanine hydroxylase N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hmfa3 d.58.18.10 (A:304-403) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cdqa2 d.58.18.10 (A:329-419) Aspartokinase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmfa2 d.58.18.10 (A:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure