Citrus Sinensis ID: 022558


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-----
MEWDNIREAAQQETQTQNQNQNQRGGENDNNNVVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPLMTSGGGHKISARQRWTPTPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRARSKRKQLVSSSANTLHNGGGGGAGAGAGGADSEVETEVDSLLLHDEHKTTKPENLSSAHSTSQPQHLRNLPPTPRPRDDDDPMCFHTPADISSSQLHFLGVFSNNPRDDHLTGKMGGMPGSYNLYDHAEDYSMAG
cccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccccccEEEcccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHccccccccccccEcccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHHHHcHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccEEcccccccccccccccccccc
MEWDNIREAAQQETQTQNqnqnqrggendnnnvVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAgrlgniycdplmtsggghkisarqrwtptpvQLQILESIfdqgtgtpskQKIKEITVELSqhgqisetnVYNWFQNRRARSKRKQLVSSSantlhngggggagagaggadsevETEVDSLllhdehkttkpenlssahstsqpqhlrnlpptprprddddpmcfhtpadisssqlhflgvfsnnprddhltgkmggmpgsynlydhaedysmag
MEWDNIREAAQQEtqtqnqnqnqrggendnnnVVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPLMTSGGGHKISARQRWTPTPVQLQILESIfdqgtgtpSKQKIKEITVElsqhgqisetnvynWFQNRRARSKRKQLVSSSantlhngggggAGAGAGGADSEVETEVDSLLLHDEHKTTKpenlssahstsqpqhlrnLPPTPRPRDDDDPMCFHTPADISSSQLHFLGVFSNNPRDDHLTGKMGGMPGSYNLYDHAEDYSMAG
MEWDNIREAAqqetqtqnqnqnqrggendnnnvvngvmyvkvMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPLMTSGGGHKISARQRWTPTPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRARSKRKQLVSSSANTLHNgggggagagaggaDSEVETEVDSLLLHDEHKTTKPENLSSAHSTSQPQHLRNLpptprprddddpMCFHTPADISSSQLHFLGVFSNNPRDDHLTGKMGGMPGSYNLYDHAEDYSMAG
********************************VVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPLMTSGGGHKISARQRWTPTPVQLQILESIFDQ***********EITVELSQHGQISETNVYNWFQ***************************************************************************************************LHFLGVF*********************************
**********************************NGVMYVKVMTDEQLETLRKQIAVYATI************************************************TPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQN**************************************************************************************************************************************S***
*************************GENDNNNVVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPLMTSGGGHKISARQRWTPTPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNR**************NTLHNGGG***************TEVDSLLLHDEHK********************NLPPTPRPRDDDDPMCFHTPADISSSQLHFLGVFSNNPRDDHLTGKMGGMPGSYNLYDHAEDYSMAG
******R******************GE****NVVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPL************QRWTPTPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRARSK**********************************************************************PRP*D*DDPMCFHTPADISSSQLHFLGVFSNNPRDDHLTGKMGGMPGSYNLYDHAEDY****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEWDNIREAAQQETQTQNQNQNQRGGENDNNNVVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPLMTSGGGHKISARQRWTPTPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRARSKRKQLVSSSANTLHNGGGGGAGAGAGGADSEVETEVDSLLLHDEHKTTKPENLSSAHSTSQPQHLRNLPPTPRPRDDDDPMCFHTPADISSSQLHFLGVFSNNPRDDHLTGKMGGMPGSYNLYDHAEDYSMAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query295 2.2.26 [Sep-21-2011]
O81788268 WUSCHEL-related homeobox yes no 0.891 0.981 0.545 2e-73
Q5QMM3267 WUSCHEL-related homeobox yes no 0.515 0.569 0.674 9e-60
Q9LM84211 WUSCHEL-related homeobox no no 0.488 0.682 0.586 7e-45
Q9LM83197 Putative WUSCHEL-related no no 0.450 0.675 0.567 2e-32
Q0JKK6 533 WUSCHEL-related homeobox no no 0.261 0.144 0.430 1e-14
Q6X7J5325 WUSCHEL-related homeobox no no 0.220 0.2 0.476 1e-13
A3BKM2306 WUSCHEL-related homeobox no no 0.322 0.310 0.365 2e-13
A3B6V0 515 WUSCHEL-related homeobox no no 0.250 0.143 0.402 1e-12
Q6X7J4 378 WUSCHEL-related homeobox no no 0.210 0.164 0.451 1e-12
Q6X7K0350 WUSCHEL-related homeobox no no 0.223 0.188 0.454 2e-12
>sp|O81788|WOX13_ARATH WUSCHEL-related homeobox 13 OS=Arabidopsis thaliana GN=WOX13 PE=2 SV=1 Back     alignment and function desciption
 Score =  276 bits (705), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 163/299 (54%), Positives = 196/299 (65%), Gaps = 36/299 (12%)

Query: 1   MEWDNIREAAQQETQTQNQNQNQRGGENDNNNVVNGVMYVKVMTDEQLETLRKQIAVYAT 60
           MEWDN      Q     + + N +G + +  +   G MYVKVMTDEQ ETLRKQIA+Y T
Sbjct: 2   MEWDN------QLQPNNHHSSNLQGIDVNGGSGAGGGMYVKVMTDEQYETLRKQIAIYGT 55

Query: 61  ICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPLMTSGGGHKISARQRWTPTPVQLQILESI 120
           ICE+LVEMHK+L+A QDLA  GR+G +Y DP+M+S G HK++ARQRWTPTPVQLQILE I
Sbjct: 56  ICERLVEMHKTLTAQQDLAG-GRMGGLYADPMMSSLG-HKMTARQRWTPTPVQLQILERI 113

Query: 121 FDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRARSKRKQLVSSSANTLHNGGG 180
           FDQGTGTPSKQKIK+IT ELSQHGQI+E NVYNWFQNRRARSKRKQ    S+        
Sbjct: 114 FDQGTGTPSKQKIKDITEELSQHGQIAEQNVYNWFQNRRARSKRKQHGGGSSG------- 166

Query: 181 GGAGAGAGGADSEVETEVDSLLLHDEHKTTKPENLSSAHSTSQPQH----LRNLPPTPRP 236
                     +SEVETEV++L   +E +  +PE+L      +   +           PRP
Sbjct: 167 ------NNNGESEVETEVEAL---NEKRVVRPESLLGLPDGNSNNNGLGTTTATTTAPRP 217

Query: 237 RDDDDPMCFHTPADISSSQLHFLGVFSNNPRDDHLTGKMGGMPGSYNLYDHAEDYSMAG 295
            D    +CF +P    SS LH L V S NPRD+HL GKM G+  SYNLYDH EDY M+G
Sbjct: 218 ED----LCFQSPE--ISSDLHLLDVLS-NPRDEHLVGKM-GLAESYNLYDHVEDYGMSG 268




Transcription factor which may be involved in developmental processes.
Arabidopsis thaliana (taxid: 3702)
>sp|Q5QMM3|WOX8_ORYSJ WUSCHEL-related homeobox 8 OS=Oryza sativa subsp. japonica GN=WOX8 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM84|WOX14_ARATH WUSCHEL-related homeobox 14 OS=Arabidopsis thaliana GN=WOX14 PE=2 SV=1 Back     alignment and function description
>sp|Q9LM83|WOX10_ARATH Putative WUSCHEL-related homeobox 10 OS=Arabidopsis thaliana GN=WOX10 PE=3 SV=1 Back     alignment and function description
>sp|Q0JKK6|WOX7_ORYSJ WUSCHEL-related homeobox 7 OS=Oryza sativa subsp. japonica GN=WOX7 PE=2 SV=2 Back     alignment and function description
>sp|Q6X7J5|WOX8_ARATH WUSCHEL-related homeobox 8 OS=Arabidopsis thaliana GN=WOX8 PE=2 SV=1 Back     alignment and function description
>sp|A3BKM2|WOX13_ORYSJ WUSCHEL-related homeobox 13 OS=Oryza sativa subsp. japonica GN=WOX13 PE=2 SV=1 Back     alignment and function description
>sp|A3B6V0|WOX12_ORYSJ WUSCHEL-related homeobox 12 OS=Oryza sativa subsp. japonica GN=WOX12 PE=2 SV=2 Back     alignment and function description
>sp|Q6X7J4|WOX9_ARATH WUSCHEL-related homeobox 9 OS=Arabidopsis thaliana GN=WOX9 PE=2 SV=1 Back     alignment and function description
>sp|Q6X7K0|WOX1_ARATH WUSCHEL-related homeobox 1 OS=Arabidopsis thaliana GN=WOX1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
224081491248 predicted protein [Populus trichocarpa] 0.833 0.991 0.622 4e-84
3955021261 HB2 homeodomain protein [Populus tremula 0.833 0.942 0.619 1e-83
40233087257 homeodomain protein HB2 [Populus tomento 0.833 0.957 0.622 4e-83
255561425247 DNA binding protein, putative [Ricinus c 0.830 0.991 0.622 6e-81
297798368266 homeobox-leucine zipper protein [Arabido 0.888 0.984 0.557 2e-73
15237035268 WUSCHEL-related homeobox 13 [Arabidopsis 0.891 0.981 0.545 1e-71
225431417281 PREDICTED: WUSCHEL-related homeobox 13-l 0.789 0.829 0.593 2e-70
388517213264 unknown [Medicago truncatula] 0.732 0.818 0.540 1e-69
225431415276 PREDICTED: WUSCHEL-related homeobox 13-l 0.738 0.789 0.562 1e-69
217073748264 unknown [Medicago truncatula] 0.789 0.882 0.566 1e-69
>gi|224081491|ref|XP_002306432.1| predicted protein [Populus trichocarpa] gi|222855881|gb|EEE93428.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  317 bits (812), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 185/297 (62%), Positives = 205/297 (69%), Gaps = 51/297 (17%)

Query: 1   MEWDNIREAAQQETQTQNQNQN--QRGGENDNNNVVNGVMYVKVMTDEQLETLRKQIAVY 58
           M+WDN +E  Q   Q Q + +N       N N N    ++YVKVMTDEQLETLRKQIAVY
Sbjct: 1   MDWDNNQENHQDSHQNQRECRNGINGTNVNVNGNGGTNMLYVKVMTDEQLETLRKQIAVY 60

Query: 59  ATICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPLMTSGGGHKISARQRWTPTPVQLQILE 118
           A ICEQLVEMHK+LSA QDLA  GRLGN+YCDPLM SGG HKI+ARQRWTPTPVQLQILE
Sbjct: 61  AAICEQLVEMHKTLSAQQDLAG-GRLGNLYCDPLMASGG-HKITARQRWTPTPVQLQILE 118

Query: 119 SIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRARSKRKQLVSSSANTLHNG 178
            IFDQG GTPSKQKIKEIT ELSQHGQISETNVYNWFQNRRARSKRKQLV+SS N     
Sbjct: 119 RIFDQGNGTPSKQKIKEITSELSQHGQISETNVYNWFQNRRARSKRKQLVASSNN----- 173

Query: 179 GGGGAGAGAGGADSEVETEVDSLLLHDEHKTTKPENLSSAHSTSQPQHLRNLPPTPRPRD 238
                      A+SEVETEVDSL     ++  KPE     H+   P           PR 
Sbjct: 174 -----------AESEVETEVDSL-----NEKKKPEIF---HAQQNP-----------PRA 203

Query: 239 DDDPMCFHTPADISSSQLHFLGVFSNNPRDDHLTGKMGGMPGSYNLYDHAEDYSMAG 295
           +D  +CF +P    SS+LHFLG       DDHLTGKM G+PG+YNLYD AEDY MAG
Sbjct: 204 ED--LCFQSPE--ISSELHFLG-------DDHLTGKM-GVPGNYNLYDQAEDYGMAG 248




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|3955021|emb|CAA09367.1| HB2 homeodomain protein [Populus tremula x Populus tremuloides] Back     alignment and taxonomy information
>gi|40233087|gb|AAR83341.1| homeodomain protein HB2 [Populus tomentosa] Back     alignment and taxonomy information
>gi|255561425|ref|XP_002521723.1| DNA binding protein, putative [Ricinus communis] gi|223539114|gb|EEF40710.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297798368|ref|XP_002867068.1| homeobox-leucine zipper protein [Arabidopsis lyrata subsp. lyrata] gi|297312904|gb|EFH43327.1| homeobox-leucine zipper protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15237035|ref|NP_195280.1| WUSCHEL-related homeobox 13 [Arabidopsis thaliana] gi|61217457|sp|O81788.1|WOX13_ARATH RecName: Full=WUSCHEL-related homeobox 13 gi|3367573|emb|CAA20025.1| homeodomain - like protein [Arabidopsis thaliana] gi|7270506|emb|CAB80271.1| homeodomain-like protein [Arabidopsis thaliana] gi|15081751|gb|AAK82530.1| AT4g35550/F8D20_60 [Arabidopsis thaliana] gi|23308275|gb|AAN18107.1| At4g35550/F8D20_60 [Arabidopsis thaliana] gi|37955227|gb|AAP37142.1| WOX13 protein [Arabidopsis thaliana] gi|332661129|gb|AEE86529.1| WUSCHEL-related homeobox 13 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225431417|ref|XP_002279942.1| PREDICTED: WUSCHEL-related homeobox 13-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388517213|gb|AFK46668.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|225431415|ref|XP_002272863.1| PREDICTED: WUSCHEL-related homeobox 13-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|217073748|gb|ACJ85234.1| unknown [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query295
TAIR|locus:2127968268 WOX13 "AT4G35550" [Arabidopsis 0.637 0.701 0.567 2.7e-52
TAIR|locus:2030467211 WOX14 "AT1G20700" [Arabidopsis 0.440 0.616 0.624 9.6e-41
TAIR|locus:2030487197 WOX10 "AT1G20710" [Arabidopsis 0.420 0.629 0.608 3.9e-37
TAIR|locus:2161353325 WOX8 "AT5G45980" [Arabidopsis 0.257 0.233 0.435 8.9e-14
TAIR|locus:2057614 378 HB-3 "homeobox-3" [Arabidopsis 0.383 0.298 0.310 1.9e-13
TAIR|locus:2088550350 WOX1 "WUSCHEL related homeobox 0.223 0.188 0.454 4.3e-13
TAIR|locus:2175941268 WOX12 "AT5G17810" [Arabidopsis 0.230 0.253 0.457 6.6e-13
TAIR|locus:2166434122 WOX7 "AT5G05770" [Arabidopsis 0.240 0.581 0.422 8.2e-12
TAIR|locus:2096429297 WOX11 "AT3G03660" [Arabidopsis 0.257 0.255 0.434 1.5e-11
UNIPROTKB|Q33DK1203 WOX3 "WUSCHEL-related homeobox 0.203 0.295 0.45 1.7e-11
TAIR|locus:2127968 WOX13 "AT4G35550" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 542 (195.9 bits), Expect = 2.7e-52, P = 2.7e-52
 Identities = 117/206 (56%), Positives = 142/206 (68%)

Query:    43 MTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAGRLGNIYCDPLMTSGGGHKIS 102
             MTDEQ ETLRKQIA+Y TICE+LVEMHK+L+A QDLA  GR+G +Y DP+M+S G HK++
Sbjct:    38 MTDEQYETLRKQIAIYGTICERLVEMHKTLTAQQDLAG-GRMGGLYADPMMSSLG-HKMT 95

Query:   103 ARQRWTPTPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRARS 162
             ARQRWTPTPVQLQILE IFDQGTGTPSKQKIK+IT ELSQHGQI+E NVYNWFQNRRARS
Sbjct:    96 ARQRWTPTPVQLQILERIFDQGTGTPSKQKIKDITEELSQHGQIAEQNVYNWFQNRRARS 155

Query:   163 KRKQLVSSSANTLHNXXXXXXXXXXXXXDSEVETEVDSLLLHDEHKTTKPENLSSAHSTS 222
             KRKQ    S+   +N             +SEVETEV++L   +E +  +PE+L      +
Sbjct:   156 KRKQHGGGSSGN-NNG------------ESEVETEVEAL---NEKRVVRPESLLGLPDGN 199

Query:   223 QPQHLRNLXXXXXXXXXXXXMCFHTP 248
                +                +CF +P
Sbjct:   200 SNNNGLGTTTATTTAPRPEDLCFQSP 225


GO:0003677 "DNA binding" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
TAIR|locus:2030467 WOX14 "AT1G20700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030487 WOX10 "AT1G20710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161353 WOX8 "AT5G45980" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057614 HB-3 "homeobox-3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2088550 WOX1 "WUSCHEL related homeobox 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2175941 WOX12 "AT5G17810" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2166434 WOX7 "AT5G05770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2096429 WOX11 "AT3G03660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q33DK1 WOX3 "WUSCHEL-related homeobox 3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81788WOX13_ARATHNo assigned EC number0.54510.89150.9813yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
wox13
SubName- Full=WOX13 protein; Flags- Fragment; (248 aa)
(Populus trichocarpa)
Predicted Functional Partners:
eugene3.00002256
leucine-rich repeat transmembrane protein (625 aa)
       0.687
MYB103
hypothetical protein (110 aa)
       0.510

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
pfam0004657 pfam00046, Homeobox, Homeobox domain 2e-17
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 4e-14
smart0038957 smart00389, HOX, Homeodomain 4e-13
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 3e-05
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 74.1 bits (183), Expect = 2e-17
 Identities = 25/61 (40%), Positives = 36/61 (59%), Gaps = 5/61 (8%)

Query: 104 RQRWTPTPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRARSK 163
           R+R T TP QL+ LE  F +    PS ++ +E+  +L     ++E  V  WFQNRRA+ K
Sbjct: 2   RKRTTFTPEQLEELEKEF-EKNRYPSAEEREELAKKL----GLTERQVKVWFQNRRAKWK 56

Query: 164 R 164
           R
Sbjct: 57  R 57


Length = 57

>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 295
KOG3802398 consensus Transcription factor OCT-1, contains POU 100.0
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 99.91
PF0015775 Pou: Pou domain - N-terminal to homeobox domain; I 99.82
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.75
KOG0489261 consensus Transcription factor zerknullt and relat 99.71
KOG0488309 consensus Transcription factor BarH and related HO 99.67
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.66
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.64
KOG0843197 consensus Transcription factor EMX1 and related HO 99.64
KOG0850245 consensus Transcription factor DLX and related pro 99.63
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.61
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.6
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.6
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.58
KOG0494332 consensus Transcription factor CHX10 and related H 99.55
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.53
KOG0848317 consensus Transcription factor Caudal, contains HO 99.49
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.45
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.45
smart0035275 POU Found in Pit-Oct-Unc transcription factors. 99.45
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.45
KOG0847288 consensus Transcription factor, contains HOX domai 99.44
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.43
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.42
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.39
KOG0493342 consensus Transcription factor Engrailed, contains 99.39
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.35
COG5576156 Homeodomain-containing transcription factor [Trans 99.34
KOG0490235 consensus Transcription factor, contains HOX domai 99.16
KOG0849354 consensus Transcription factor PRD and related pro 98.92
KOG0775304 consensus Transcription factor SIX and related HOX 98.73
KOG0774334 consensus Transcription factor PBX and related HOX 98.67
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.21
KOG2252558 consensus CCAAT displacement protein and related h 98.1
KOG0490235 consensus Transcription factor, contains HOX domai 97.95
KOG1146 1406 consensus Homeobox protein [General function predi 97.57
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.92
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 95.74
KOG0773342 consensus Transcription factor MEIS1 and related H 94.89
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 89.24
PF0888037 QLQ: QLQ; InterPro: IPR014978 QLQ is named after t 84.68
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
Probab=100.00  E-value=4.6e-48  Score=368.04  Aligned_cols=151  Identities=20%  Similarity=0.232  Sum_probs=134.1

Q ss_pred             HHHHHHHHHHhhhhhhhhcCCccCCCcccccccccccCCHHHHHHHHHHHHHHHHHHHHHHHHhhhhccccchhcccCCC
Q 022558            6 IREAAQQETQTQNQNQNQRGGENDNNNVVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAAGRLG   85 (295)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~g~~~g~~~s~~~i~~l~~qi~~~~~ic~~~~~~~k~ls~~~~~~sg~~~g   85 (295)
                      ..||||||||+||||||||||||+|||+|+|+|||||||||+||||||++++|+||||+++++.|||++++...+...  
T Consensus       204 ~leELEqFAK~FKqRRIkLGfTQaDVGlALG~lyGn~FSQTTIcRFEALqLSFKNMCKLKPLL~KWLeEAes~~~~~~--  281 (398)
T KOG3802|consen  204 DLEELEQFAKTFKQRRIKLGFTQADVGLALGALYGNVFSQTTICRFEALQLSFKNMCKLKPLLEKWLEEAESRESTGS--  281 (398)
T ss_pred             CHHHHHHHHHHHHhheeccccchhHHHHHHHhhhCcccchhhhhHhHhhccCHHHHhhhHHHHHHHHHHHhcccccCC--
Confidence            368999999999999999999999999999999999999999999999999999999999999999999887432221  


Q ss_pred             CcccCCCccCCCCCCCCCCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHhhcCCCccchhhhhhhhhhHHHHHH
Q 022558           86 NIYCDPLMTSGGGHKISARQRWTPTPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRARSKRK  165 (295)
Q Consensus        86 ~~~~~p~~~s~g~~~~~rR~Rt~ft~~Ql~~LE~~F~~~n~~Ps~~~r~~LA~~L~~~~~Ls~~~V~vWFQNRRaK~Kr~  165 (295)
                        .|.+....  ...++||+||.|+...+..||++|.. |++|+.++|..||.+|    +|++.+|+|||||||+|+||.
T Consensus       282 --~~~~e~i~--a~~RkRKKRTSie~~vr~aLE~~F~~-npKPt~qEIt~iA~~L----~leKEVVRVWFCNRRQkeKR~  352 (398)
T KOG3802|consen  282 --PNSIEKIG--AQSRKRKKRTSIEVNVRGALEKHFLK-NPKPTSQEITHIAESL----QLEKEVVRVWFCNRRQKEKRI  352 (398)
T ss_pred             --CCCHHHhh--ccccccccccceeHHHHHHHHHHHHh-CCCCCHHHHHHHHHHh----ccccceEEEEeeccccccccC
Confidence              12222222  22267889999999999999999999 7999999999999999    999999999999999999998


Q ss_pred             hh
Q 022558          166 QL  167 (295)
Q Consensus       166 ~~  167 (295)
                      ..
T Consensus       353 ~~  354 (398)
T KOG3802|consen  353 TP  354 (398)
T ss_pred             CC
Confidence            76



>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>PF00157 Pou: Pou domain - N-terminal to homeobox domain; InterPro: IPR000327 POU proteins are eukaryotic transcription factors containing a bipartite DNA binding domain referred to as the POU domain Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>smart00352 POU Found in Pit-Oct-Unc transcription factors Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF08880 QLQ: QLQ; InterPro: IPR014978 QLQ is named after the conserved Gln, Leu, Gln motif Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query295
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 8e-21
1lfb_A99 Liver transcription factor (LFB1); transcription r 3e-13
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 9e-13
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-11
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 1e-11
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-09
2xsd_C164 POU domain, class 3, transcription factor 1; trans 5e-09
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 7e-09
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 9e-09
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 1e-08
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-08
1uhs_A72 HOP, homeodomain only protein; structural genomics 3e-08
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 7e-08
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 7e-08
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 7e-08
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 1e-07
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 2e-07
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-07
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 3e-07
3d1n_I151 POU domain, class 6, transcription factor 1; prote 3e-07
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 7e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 7e-07
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-06
1e3o_C160 Octamer-binding transcription factor 1; transcript 1e-06
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 2e-06
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 2e-06
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 3e-06
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 4e-06
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 4e-06
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 6e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 7e-06
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 7e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 9e-06
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 2e-05
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 2e-05
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 2e-05
3a02_A60 Homeobox protein aristaless; homeodomain, developm 4e-05
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 6e-05
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-04
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-04
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 1e-04
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 1e-04
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-04
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 4e-04
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 5e-04
3a01_A93 Homeodomain-containing protein; homeodomain, prote 6e-04
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 6e-04
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 7e-04
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 7e-04
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 7e-04
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
 Score = 83.9 bits (207), Expect = 8e-21
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 12/88 (13%)

Query: 96  GGGHKISARQRWTPTPVQLQILESIFDQGTGTPSKQKIKEIT-----------VELSQHG 144
           G         R+T     L ++ES F++    P + K +EI             +LS   
Sbjct: 1   GSSGSSGRGSRFTWRKECLAVMESYFNE-NQYPDEAKREEIANACNAVIQKPGKKLSDLE 59

Query: 145 QISETNVYNWFQNRRARSKRKQLVSSSA 172
           +++   VYNWF NRR   KR+  +++  
Sbjct: 60  RVTSLKVYNWFANRRKEIKRRANIAAIL 87


>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 100.0
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 100.0
2xsd_C164 POU domain, class 3, transcription factor 1; trans 100.0
3d1n_I151 POU domain, class 6, transcription factor 1; prote 100.0
1e3o_C160 Octamer-binding transcription factor 1; transcript 100.0
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.79
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.79
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.77
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.77
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.76
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.76
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.76
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.75
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.75
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.75
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.75
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.75
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.75
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.75
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.75
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.75
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.75
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.74
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.74
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.74
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.74
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.74
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.74
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.74
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.73
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.73
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.73
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.73
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.73
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.73
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.72
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.72
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.72
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.72
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.72
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.71
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.71
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.71
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.71
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.71
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.71
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.7
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.7
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.7
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.69
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.69
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.69
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.68
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.68
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.68
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.68
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.68
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.67
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.67
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.66
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.65
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.64
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.63
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.63
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.62
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.61
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.61
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.6
2e19_A64 Transcription factor 8; homeobox domain, structura 99.58
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.58
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.57
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.54
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.5
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.47
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.41
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.3
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.16
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.7
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 93.38
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
Probab=100.00  E-value=1.1e-39  Score=279.00  Aligned_cols=151  Identities=18%  Similarity=0.237  Sum_probs=131.7

Q ss_pred             cchhHHHHHHHHHHhhhhhhhhcCCccCCCcccccccccccCCHHHHHHHHHHHHHHHHHHHHHHHHhhhhccccchhcc
Q 022558            2 EWDNIREAAQQETQTQNQNQNQRGGENDNNNVVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAHQDLAAA   81 (295)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~g~~~g~~~s~~~i~~l~~qi~~~~~ic~~~~~~~k~ls~~~~~~sg   81 (295)
                      +=+.+.+|||+||++||||||++||||+|||+|+|.|||++||+++||+|+++.++|++||++.|.+.+|+.+.+...+.
T Consensus         4 d~~~~~~~l~~fa~~fk~~ri~lg~tq~~vg~al~~l~G~~~Sqtti~rfE~l~ls~~nm~kLkPlL~~Wl~eae~~~~~   83 (155)
T 3l1p_A            4 DMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEALQLSLKNMSKLRPLLEKWVEEADNNENL   83 (155)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCCCCHHHHHHHHTTCSCHHHHHHHHHHHHHHHHHHTTCHHH
T ss_pred             cchhhHHHHHHHHHHHHhhhheecccHHHHHHHHHhhcCcccccccccccccccCChhhHhhcchHHHHHhhhhhcccCc
Confidence            44678899999999999999999999999999999999999999999999999999999999999999999877643322


Q ss_pred             cCCCCcccCCCccCCCCCCCCCCCCCCCCHHHHHHHHHHHhhcCCCCCHHHHHHHHHHHhhcCCCccchhhhhhhhhhHH
Q 022558           82 GRLGNIYCDPLMTSGGGHKISARQRWTPTPVQLQILESIFDQGTGTPSKQKIKEITVELSQHGQISETNVYNWFQNRRAR  161 (295)
Q Consensus        82 ~~~g~~~~~p~~~s~g~~~~~rR~Rt~ft~~Ql~~LE~~F~~~n~~Ps~~~r~~LA~~L~~~~~Ls~~~V~vWFQNRRaK  161 (295)
                      ...    +.+..    ..+++||+|+.|+..|+..||..|.. ++||+..+|.+||..|    +|++++|+|||||||+|
T Consensus        84 ~~~----~~~~~----~~~~~rr~Rt~ft~~Q~~~Le~~F~~-~~yps~~~r~~LA~~l----~L~~~qV~vWFqNRR~k  150 (155)
T 3l1p_A           84 QEI----SKSET----LVQARKRKRTSIENRVRWSLETMFLK-SPKPSLQQITHIANQL----GLEKDVVRVWFSNRRQK  150 (155)
T ss_dssp             HHS----SCC-------CCCSCCCCCCCCHHHHHHHHTTTTT-CSCCCHHHHHHHHHHT----TCCHHHHHHHHHHHHHH
T ss_pred             ccc----ccccc----cccCCCCCCcccCHHHHHHHHHHHcc-CCCCCHHHHHHHHHHc----CCChhheeecccccccc
Confidence            211    11111    11356788999999999999999999 7999999999999999    99999999999999999


Q ss_pred             HHHH
Q 022558          162 SKRK  165 (295)
Q Consensus       162 ~Kr~  165 (295)
                      +||.
T Consensus       151 ~Kr~  154 (155)
T 3l1p_A          151 GKRS  154 (155)
T ss_dssp             HHC-
T ss_pred             ccCC
Confidence            9974



>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 295
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 7e-14
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 3e-13
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-12
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 3e-12
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 1e-11
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-11
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-11
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 2e-11
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 2e-11
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-11
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 4e-11
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 5e-11
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 7e-11
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-10
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 3e-10
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-10
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 5e-10
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 5e-10
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 8e-10
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-09
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-09
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-09
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-09
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-09
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 5e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 5e-09
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 4e-08
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 5e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-07
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 5e-07
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 6e-07
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 2e-05
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox-containing protein 1, HMBOX1 (Flj21616)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 63.5 bits (154), Expect = 7e-14
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 12/78 (15%)

Query: 104 RQRWTPTPVQLQILESIFDQGTGTPSKQKIKEI-----------TVELSQHGQISETNVY 152
             R+T     L ++ES F++    P + K +EI             +LS   +++   VY
Sbjct: 2   GSRFTWRKECLAVMESYFNE-NQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVY 60

Query: 153 NWFQNRRARSKRKQLVSS 170
           NWF NRR   KR+  +++
Sbjct: 61  NWFANRRKEIKRRANIAA 78


>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query295
d1e3oc275 Oct-1 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1au7a272 Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.87
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.79
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.79
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.79
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.79
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.79
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.78
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.78
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.78
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.77
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.77
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.77
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.76
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.76
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.76
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.75
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.74
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.72
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.72
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.71
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.7
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.69
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.69
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.65
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.63
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.62
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.61
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.6
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.59
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.55
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.51
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.49
>d1e3oc2 a.35.1.1 (C:1-75) Oct-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: lambda repressor-like DNA-binding domains
superfamily: lambda repressor-like DNA-binding domains
family: POU-specific domain
domain: Oct-1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88  E-value=1.3e-24  Score=159.75  Aligned_cols=70  Identities=13%  Similarity=0.110  Sum_probs=67.4

Q ss_pred             HHHHHHHHHHhhhhhhhhcCCccCCCcccccccccccCCHHHHHHHHHHHHHHHHHHHHHHHHhhhhccc
Q 022558            6 IREAAQQETQTQNQNQNQRGGENDNNNVVNGVMYVKVMTDEQLETLRKQIAVYATICEQLVEMHKSLSAH   75 (295)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~g~~~g~~~s~~~i~~l~~qi~~~~~ic~~~~~~~k~ls~~   75 (295)
                      .-+|||+||+.||||||++||||+|||.|+|++||++|||++||||++++++|++||+..|.+.+|+.++
T Consensus         5 ~l~Ele~Fa~~fk~rRi~LG~TQ~dVG~al~~l~g~~~SQttIcRFE~l~LS~kn~~kLkP~L~~WL~ea   74 (75)
T d1e3oc2           5 DLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRFEALNLSFKNMSKLKPLLEKWLNDA   74 (75)
T ss_dssp             CHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCCCCHHHHHHHHHTCSCHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHhccccHHHHHHHHHHHcCcchhHHHHHHHHHhccCHHHHHHHHHHHHHHHHhc
Confidence            4589999999999999999999999999999999999999999999999999999999999999999764



>d1au7a2 a.35.1.1 (A:5-76) Pit-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure