Citrus Sinensis ID: 022612


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNRSTKLLRP
cEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccccccEEEEEccccccccccccccccccHHHcccccHHcccccHHHHHHHHHHHHHHHHccHHHHHHHcHHHHcccHHHHHHHcccccccccHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHccccccccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
cEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEccccHHHHEHEEEcccccccccccEEEEEccccHHHHcHHHHHHcHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHccccHHccccHHHHHHHHHHHcccccEEEEEEccccccccHHHHHHHHcccccccccEEEEEEcccccccccccccccccHHHHHHHHcccHHHHcccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
mviatpyasgfdyfyiADEVQLKADRCLRFLQETVqdlptfgighSLGSVIHLLIgsryavprtgniLMAFNnreasvaiplfspvfvpmaqsigpllsqiassptvrlGAEMTLKqlenlsppimkqvlplveqlpplymdlvkgreeftpkpeETRRLIKSYYGISRNLLikfkddsideTSTLAQVLSSDSAISSMLDMsirmlpgdhglplqqalpdvppaMADAVNRGSELIAnltigtpweTITKEVsnsfgvdsrilrADISKDIEHLVDVISSWmasnrstkllrp
mviatpyasgfdyFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGreeftpkpeetrrLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVisswmasnrstkllrp
MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKqvlplveqlpplYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNRSTKLLRP
**IATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGR**********RRLIKSYYGISRNLLIKFKD*****************************************************NRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWM***********
MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLS*********LGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVL*************IRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNR*******
MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASN********
MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNRST*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNRSTKLLRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
225425362 438 PREDICTED: uncharacterized protein LOC10 0.996 0.668 0.870 1e-149
296085574 442 unnamed protein product [Vitis vinifera] 0.996 0.662 0.870 1e-149
255543304 441 conserved hypothetical protein [Ricinus 1.0 0.666 0.853 1e-145
224072437 441 predicted protein [Populus trichocarpa] 0.989 0.659 0.845 1e-143
224057878361 predicted protein [Populus trichocarpa] 0.996 0.811 0.832 1e-142
356523813 505 PREDICTED: uncharacterized protein LOC10 1.0 0.582 0.812 1e-140
15238825 431 uncharacterized protein [Arabidopsis tha 1.0 0.682 0.799 1e-137
449446785 440 PREDICTED: uncharacterized protein LOC10 1.0 0.668 0.792 1e-137
297791887 429 hypothetical protein ARALYDRAFT_494828 [ 1.0 0.685 0.792 1e-136
116309460 457 H0502B11.12 [Oryza sativa Indica Group] 0.996 0.641 0.778 1e-133
>gi|225425362|ref|XP_002269102.1| PREDICTED: uncharacterized protein LOC100255874 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  533 bits (1374), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 255/293 (87%), Positives = 278/293 (94%)

Query: 1   MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYA 60
           +VIATPYASGFD+F+IADEVQ K DRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYA
Sbjct: 145 LVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYA 204

Query: 61  VPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLEN 120
           V R+GN+LMAFNN+EAS+AIPLFSPV VPMAQSIGPLLSQIASSPTVRLGAEMTLKQLEN
Sbjct: 205 VQRSGNVLMAFNNKEASLAIPLFSPVLVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLEN 264

Query: 121 LSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSI 180
           LSPPIMKQV+PLVEQLPPLYMDLVKGRE+F PKPEETRRLIKSYYG+SRNLLIKFKDD+I
Sbjct: 265 LSPPIMKQVIPLVEQLPPLYMDLVKGREDFAPKPEETRRLIKSYYGVSRNLLIKFKDDTI 324

Query: 181 DETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANL 240
           DETSTLAQVL+SDSAISS+LDMSIR+LPGDHGLPLQQALPDVPPAMADAVNRG E +ANL
Sbjct: 325 DETSTLAQVLASDSAISSLLDMSIRLLPGDHGLPLQQALPDVPPAMADAVNRGGEFLANL 384

Query: 241 TIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNRSTKLLR 293
           TIGTPWET+ KEV N+ GVDS+ILRA+ SKD++ LVDVI+SW+ASN   KLLR
Sbjct: 385 TIGTPWETVAKEVGNTLGVDSKILRAENSKDLDMLVDVITSWLASNTGPKLLR 437




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|296085574|emb|CBI29306.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255543304|ref|XP_002512715.1| conserved hypothetical protein [Ricinus communis] gi|223548676|gb|EEF50167.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224072437|ref|XP_002303731.1| predicted protein [Populus trichocarpa] gi|222841163|gb|EEE78710.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224057878|ref|XP_002299369.1| predicted protein [Populus trichocarpa] gi|222846627|gb|EEE84174.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356523813|ref|XP_003530529.1| PREDICTED: uncharacterized protein LOC100820080 [Glycine max] Back     alignment and taxonomy information
>gi|15238825|ref|NP_199597.1| uncharacterized protein [Arabidopsis thaliana] gi|10177922|dbj|BAB11333.1| unnamed protein product [Arabidopsis thaliana] gi|16648766|gb|AAL25574.1| AT5g47860/MCA23_20 [Arabidopsis thaliana] gi|22655374|gb|AAM98279.1| At5g47860/MCA23_20 [Arabidopsis thaliana] gi|332008198|gb|AED95581.1| uncharacterized protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449446785|ref|XP_004141151.1| PREDICTED: uncharacterized protein LOC101208391 [Cucumis sativus] Back     alignment and taxonomy information
>gi|297791887|ref|XP_002863828.1| hypothetical protein ARALYDRAFT_494828 [Arabidopsis lyrata subsp. lyrata] gi|297309663|gb|EFH40087.1| hypothetical protein ARALYDRAFT_494828 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|116309460|emb|CAH66532.1| H0502B11.12 [Oryza sativa Indica Group] gi|218194801|gb|EEC77228.1| hypothetical protein OsI_15775 [Oryza sativa Indica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query294
TAIR|locus:2160962431 AT5G47860 [Arabidopsis thalian 1.0 0.682 0.761 6.2e-117
TAIR|locus:2098199373 AT3G43540 "AT3G43540" [Arabido 0.602 0.474 0.296 2.6e-15
TAIR|locus:2160962 AT5G47860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1152 (410.6 bits), Expect = 6.2e-117, P = 6.2e-117
 Identities = 224/294 (76%), Positives = 250/294 (85%)

Query:     1 MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYA 60
             +VIATPYASGFD+F IADEVQ K DRC R LQE VQDLP+FGIGHSLGSVIHLLIGSRYA
Sbjct:   138 LVIATPYASGFDHFNIADEVQFKYDRCCRSLQEEVQDLPSFGIGHSLGSVIHLLIGSRYA 197

Query:    61 VPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLEN 120
             V R GN+ MAFNN+EAS+AIPLFSPV VPMAQS+GPLLSQ+A+SPT+RLGAEMT KQLE 
Sbjct:   198 VQRNGNVFMAFNNKEASLAIPLFSPVLVPMAQSLGPLLSQVATSPTIRLGAEMTRKQLET 257

Query:   121 LSPPIMKXXXXXXXXXXXXYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSI 180
             LSPPIMK            YMDLVKGRE+F PKPEETRRLI+SYYGISRNLLIKF+DDSI
Sbjct:   258 LSPPIMKQILPLVEQLPPLYMDLVKGREDFVPKPEETRRLIRSYYGISRNLLIKFEDDSI 317

Query:   181 DETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANL 240
             DETS LAQVL  +S+ISS LDMSIR LPGDHGLPLQQALPDVPP MA+AVNRGSE +AN+
Sbjct:   318 DETSILAQVLGVESSISSKLDMSIRTLPGDHGLPLQQALPDVPPGMAEAVNRGSEFLANI 377

Query:   241 TIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNRSTKLLRP 294
              +GTPWE++ KEV  S G+DS+ILRAD+SKD+  LVD I+SWM SN   KLLRP
Sbjct:   378 AVGTPWESMAKEVGGSLGMDSKILRADMSKDLAQLVDAITSWMISNMGPKLLRP 431




GO:0009507 "chloroplast" evidence=ISM;IDA
TAIR|locus:2098199 AT3G43540 "AT3G43540" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00006255001
SubName- Full=Chromosome chr1 scaffold_166, whole genome shotgun sequence; (442 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00026129001
SubName- Full=Chromosome chr15 scaffold_37, whole genome shotgun sequence; (273 aa)
       0.504
GSVIVG00026576001
SubName- Full=Chromosome chr12 scaffold_38, whole genome shotgun sequence; (256 aa)
       0.502
GSVIVG00026573001
SubName- Full=Chromosome chr12 scaffold_38, whole genome shotgun sequence; (245 aa)
       0.502
GSVIVG00014701001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (331 aa)
       0.502
GSVIVG00001938001
SubName- Full=Chromosome chr5 scaffold_124, whole genome shotgun sequence; (229 aa)
       0.502
GSVIVG00009465001
SubName- Full=Chromosome undetermined scaffold_235, whole genome shotgun sequence; (234 aa)
      0.501
GSVIVG00028499001
RecName- Full=Photosystem II reaction center psb28 protein; (179 aa)
       0.501
GSVIVG00018092001
SubName- Full=Chromosome chr13 scaffold_17, whole genome shotgun sequence; (239 aa)
       0.500
GSVIVG00017029001
SubName- Full=Chromosome chr11 scaffold_14, whole genome shotgun sequence; (415 aa)
       0.498
GSVIVG00013467001
SubName- Full=Chromosome undetermined scaffold_484, whole genome shotgun sequence; (332 aa)
       0.498

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
pfam07082250 pfam07082, DUF1350, Protein of unknown function (D 2e-33
>gnl|CDD|115718 pfam07082, DUF1350, Protein of unknown function (DUF1350) Back     alignment and domain information
 Score =  122 bits (308), Expect = 2e-33
 Identities = 75/223 (33%), Positives = 96/223 (43%), Gaps = 66/223 (29%)

Query: 2   VIATPYASGFDYFYIADEVQLKADRCLRFLQE----TVQDLPTFGIGHSLGSVIHLLIGS 57
           VIATP+ + FD+  IA  V  K +  L  L          LP +G+GHS+G  +HLLIGS
Sbjct: 50  VIATPFVNTFDHGAIALSVLNKFEYALERLVHRGGYPPAYLPIYGLGHSMGCKLHLLIGS 109

Query: 58  RYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQ 117
            Y V R GNILMAFNN  A                                         
Sbjct: 110 LYDVERAGNILMAFNNYPA----------------------------------------- 128

Query: 118 LENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKD 177
                    KQ +P ++              EFTP P ET  LI+  Y + RNLLIKF++
Sbjct: 129 ---------KQAIPWMDNFGT------ALSVEFTPSPTETNHLIQERYPVRRNLLIKFQN 173

Query: 178 DSIDETSTLAQVLSSDSAISSMLDM-SIRMLPGDHGLPLQQAL 219
           D ID+T+ L  +L +        DM +   LPG+H  PL Q L
Sbjct: 174 DDIDQTARLRSILRAKFG-----DMVTALKLPGNHLTPLGQDL 211


This family consists of several hypothetical proteins from both cyanobacteria and plants. Members of this family are typically around 250 residues in length. The function of this family is unknown but the species distribution indicates that the family may be involved in photosynthesis. Length = 250

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 294
PF07082250 DUF1350: Protein of unknown function (DUF1350); In 100.0
KOG1455313 consensus Lysophospholipase [Lipid transport and m 96.02
COG2267298 PldB Lysophospholipase [Lipid metabolism] 95.43
PHA02857276 monoglyceride lipase; Provisional 95.31
PRK10749330 lysophospholipase L2; Provisional 95.13
PLN02298330 hydrolase, alpha/beta fold family protein 94.99
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 94.97
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 94.69
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 94.41
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 94.26
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 94.12
PLN02385349 hydrolase; alpha/beta fold family protein 94.11
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 94.06
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 93.98
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 93.92
PRK10985324 putative hydrolase; Provisional 93.68
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 93.64
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 93.58
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 93.47
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 93.23
PLN02965255 Probable pheophorbidase 93.07
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 93.0
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 92.88
PLN02824294 hydrolase, alpha/beta fold family protein 92.71
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 92.67
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 92.66
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 92.55
PRK03204286 haloalkane dehalogenase; Provisional 92.53
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 92.36
PLN02894402 hydrolase, alpha/beta fold family protein 91.84
PRK03592295 haloalkane dehalogenase; Provisional 91.73
TIGR03611257 RutD pyrimidine utilization protein D. This protei 91.62
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 91.57
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 91.29
PRK00870302 haloalkane dehalogenase; Provisional 91.29
PLN02211273 methyl indole-3-acetate methyltransferase 91.24
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 91.13
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 91.0
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 90.75
PRK10673255 acyl-CoA esterase; Provisional 90.71
PLN02578354 hydrolase 90.54
PLN02652395 hydrolase; alpha/beta fold family protein 90.51
PLN02511388 hydrolase 90.33
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 90.33
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 90.09
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 89.88
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 89.85
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 89.4
PLN02679360 hydrolase, alpha/beta fold family protein 89.35
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 88.68
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 88.66
PRK11460232 putative hydrolase; Provisional 88.35
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 87.84
COG4757281 Predicted alpha/beta hydrolase [General function p 87.69
KOG2382315 consensus Predicted alpha/beta hydrolase [General 87.37
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 86.75
PRK00175379 metX homoserine O-acetyltransferase; Provisional 86.37
PLN02454414 triacylglycerol lipase 85.79
PRK08775343 homoserine O-acetyltransferase; Provisional 85.56
PRK10566249 esterase; Provisional 85.46
PRK11071190 esterase YqiA; Provisional 84.34
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 84.04
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 83.35
PLN02847 633 triacylglycerol lipase 83.24
PRK10349256 carboxylesterase BioH; Provisional 83.03
PLN02442283 S-formylglutathione hydrolase 82.28
PRK06765389 homoserine O-acetyltransferase; Provisional 82.27
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 81.98
KOG2029697 consensus Uncharacterized conserved protein [Funct 81.93
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 81.49
PLN02571413 triacylglycerol lipase 81.33
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 81.3
KOG2369473 consensus Lecithin:cholesterol acyltransferase (LC 80.98
PRK06489360 hypothetical protein; Provisional 80.57
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 80.07
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information
Probab=100.00  E-value=2.5e-74  Score=530.25  Aligned_cols=198  Identities=48%  Similarity=0.773  Sum_probs=183.9

Q ss_pred             CEEeecCCCCCChHHHHHHHHHHHHHHHHHHHHhh----CCCCcceeecchhHHHHHHhcccCCCCccceEEEeecCccc
Q 022612            1 MVIATPYASGFDYFYIADEVQLKADRCLRFLQETV----QDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREA   76 (294)
Q Consensus         1 ~VIATPY~~~fDH~~iA~~v~~~F~~~~~~L~~~~----~~lP~~gvGHSlG~kLhlLigs~~~~~r~gniliSFNN~~A   76 (294)
                      +||||||++||||+++|+++|++|++|++.|.++.    .++|+||||||||||||+||||+|+++|+|||+||||||+|
T Consensus        49 ~ViAtPy~~tfDH~~~A~~~~~~f~~~~~~L~~~~~~~~~~lP~~~vGHSlGcklhlLi~s~~~~~r~gniliSFNN~~a  128 (250)
T PF07082_consen   49 AVIATPYVVTFDHQAIAREVWERFERCLRALQKRGGLDPAYLPVYGVGHSLGCKLHLLIGSLFDVERAGNILISFNNFPA  128 (250)
T ss_pred             EEEEEecCCCCcHHHHHHHHHHHHHHHHHHHHHhcCCCcccCCeeeeecccchHHHHHHhhhccCcccceEEEecCChHH
Confidence            59999999999999999999999999999999854    46999999999999999999999999999999999999999


Q ss_pred             cccccCcccccchhhhhhhhhhhhhccCchhhhhhhHHHHhhhhcCchhhhhcchhhhccchhHhhhcCcccceecCHHH
Q 022612           77 SVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEE  156 (294)
Q Consensus        77 ~~aIPl~~~~~~p~~~~Lgpll~~~~~sp~~r~~a~~~~~~~~~~~~~~~~~~l~~~eql~~v~~~va~g~~EF~PsP~E  156 (294)
                      ++|||+++        +|+|.+                                                ++||+|||+|
T Consensus       129 ~~aIP~~~--------~l~~~l------------------------------------------------~~EF~PsP~E  152 (250)
T PF07082_consen  129 DEAIPLLE--------QLAPAL------------------------------------------------RLEFTPSPEE  152 (250)
T ss_pred             HhhCchHh--------hhcccc------------------------------------------------ccCccCCHHH
Confidence            99999986        333211                                                4899999999


Q ss_pred             HHHHHHHhhCcCcceeEeeCCCCCcCcHHHHHHhccccccccccccceeecCCCCccccccCCCCCChhhhhhhccchhh
Q 022612          157 TRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSEL  236 (294)
Q Consensus       157 T~~li~~~Y~v~rnLLIkF~dD~IDqT~~L~~~L~~r~~~~~~~~~~~~~LpG~HLTPlgq~~~~~p~~~~~~~~~G~~~  236 (294)
                      |+++|+++|.++|||||||++|+||||+.|+++|++|+.+.    ++.++|||||||||+|+++|         |.|++|
T Consensus       153 T~~li~~~Y~~~rnLLIkF~~D~iDqt~~L~~~L~~r~~~~----~~~~~L~G~HLTPl~q~~~~---------~~g~~f  219 (250)
T PF07082_consen  153 TRRLIRESYQVRRNLLIKFNDDDIDQTDELEQILQQRFPDM----VSIQTLPGNHLTPLGQDLKW---------QVGSSF  219 (250)
T ss_pred             HHHHHHHhcCCccceEEEecCCCccchHHHHHHHhhhcccc----ceEEeCCCCCCCcCcCCcCC---------ccCCcc
Confidence            99999999999999999999999999999999999997421    37999999999999999999         889888


Q ss_pred             hhhccCCCchHHHHHhhccCCCcchHHHHHhHHHHHHHHHHHHHHhhcc
Q 022612          237 IANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMAS  285 (294)
Q Consensus       237 ~~~~~~~tP~d~va~~~~~~~g~~~q~~r~~~~~d~~~L~~~I~~W~~~  285 (294)
                             ||+|+|           +||+|+++++|+++|+++|++||++
T Consensus       220 -------tP~da~-----------~q~~k~~~~~d~~~L~~~i~~Wl~~  250 (250)
T PF07082_consen  220 -------TPLDAV-----------GQWLKQEVLRDLRRLKREILDWLNP  250 (250)
T ss_pred             -------CchHHH-----------HHHHHHHHHHHHHHHHHHHHHHcCC
Confidence                   999999           7999999999999999999999985



Members of this family are typically around 250 residues in length. The function of this family is unknown but the species distribution indicates that the family may be involved in photosynthesis.

>KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>KOG2029 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query294
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 47.2 bits (111), Expect = 4e-06
 Identities = 43/309 (13%), Positives = 91/309 (29%), Gaps = 84/309 (27%)

Query: 19  EVQLKADRCLR-FLQETVQDLPTFGIGHSLGSVI------HLLIGSRYAVPRTGNILMAF 71
           E Q +    L  F    V +     +     S++      H++  S+ AV  T  +    
Sbjct: 13  EHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHII-MSKDAVSGTLRLFWTL 71

Query: 72  NNREASVAIPLFSPVFV--PMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQV 129
            +++  +        FV   +  +   L+S I +               E   P +M ++
Sbjct: 72  LSKQEEMV-----QKFVEEVLRINYKFLMSPIKT---------------EQRQPSMMTRM 111

Query: 130 LPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLI---------KFKDDSI 180
              +EQ   LY D     +    + +   +L ++   +     +         K      
Sbjct: 112 Y--IEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGK------ 163

Query: 181 DETSTLA-QVLSSDSAISSM------LDMSIRMLPGDHGLPLQ----------QALPDVP 223
              + +A  V  S      M      L++     P      LQ           +  D  
Sbjct: 164 ---TWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHS 220

Query: 224 PAMADAVNRGSELIANLTIGTP-----------WETITKEVSNSFGVDSRILRADISKDI 272
             +   ++     +  L    P                 +  N+F +  +IL    ++  
Sbjct: 221 SNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQ---NAKAWNAFNLSCKILL--TTRFK 275

Query: 273 EHLVDVISS 281
           + + D +S+
Sbjct: 276 Q-VTDFLSA 283


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 96.7
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 96.6
1vkh_A273 Putative serine hydrolase; structural genomics, jo 96.39
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 96.36
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.23
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 96.07
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 95.91
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 95.88
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 95.73
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 95.68
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.65
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 95.61
3h04_A275 Uncharacterized protein; protein with unknown func 95.58
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 95.49
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 95.46
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 95.46
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 95.34
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 95.24
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 95.18
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 95.17
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 95.15
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 95.14
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 95.11
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 95.07
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 95.07
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 95.05
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 95.02
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 95.02
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 95.02
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 95.01
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 94.98
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 94.98
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 94.98
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 94.97
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 94.94
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 94.93
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 94.93
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 94.92
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 94.89
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 94.89
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.87
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 94.86
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 94.85
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 94.84
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 94.82
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 94.82
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 94.8
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 94.78
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 94.78
1iup_A282 META-cleavage product hydrolase; aromatic compound 94.77
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 94.77
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 94.76
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 94.75
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 94.75
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 94.75
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 94.73
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 94.73
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 94.73
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 94.72
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 94.68
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 94.65
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 94.65
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 94.65
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 94.64
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 94.63
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 94.63
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 94.62
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 94.62
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 94.56
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 94.55
1r3d_A264 Conserved hypothetical protein VC1974; structural 94.52
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 94.51
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 94.49
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 94.47
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 94.46
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 94.45
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 94.45
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 94.45
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 94.39
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 94.38
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 94.35
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 94.34
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 94.33
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 94.3
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 94.28
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 94.24
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 94.23
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 94.23
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 94.15
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 94.14
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 94.09
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 94.08
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 94.08
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 94.05
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 94.05
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 94.04
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 94.0
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 93.98
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 93.96
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 93.92
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 93.91
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 93.83
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 93.81
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 93.79
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 93.76
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 93.75
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 93.7
3llc_A270 Putative hydrolase; structural genomics, joint cen 93.68
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 93.66
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 93.65
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 93.63
3lp5_A250 Putative cell surface hydrolase; structural genom 93.63
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 93.47
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 93.46
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 93.42
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 93.42
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 92.5
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 93.31
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 93.27
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 93.24
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 93.22
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 93.16
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 92.9
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 92.86
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 92.71
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 92.69
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 92.67
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 92.49
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 92.39
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 92.32
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 92.3
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 92.24
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 92.01
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 91.86
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 91.47
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 91.38
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 91.32
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 91.3
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 91.3
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 91.26
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 91.18
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 91.02
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 90.91
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 90.85
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 90.61
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 90.59
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 90.51
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 90.42
1kez_A300 Erythronolide synthase; polyketide synthase, modul 89.89
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 89.64
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 89.57
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 89.57
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 89.55
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 89.54
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 89.29
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 89.18
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 88.96
4fle_A202 Esterase; structural genomics, PSI-biology, northe 88.95
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 88.54
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 88.49
3bjr_A283 Putative carboxylesterase; structural genomics, jo 88.42
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 88.41
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 88.19
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 88.13
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 87.74
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 87.72
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 87.62
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 87.57
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 87.51
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 87.09
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 86.84
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 86.75
3tej_A329 Enterobactin synthase component F; nonribosomal pe 86.54
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 86.32
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 86.11
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 85.94
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 85.93
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 85.88
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 85.77
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 85.61
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 85.22
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 84.84
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 84.58
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 84.5
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 83.6
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 83.47
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 83.29
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 83.24
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 83.11
3ain_A323 303AA long hypothetical esterase; carboxylesterase 83.09
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 83.03
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 82.96
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 82.8
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 81.93
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 81.58
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 81.53
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 80.77
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 80.3
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 80.23
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
Probab=96.70  E-value=0.028  Score=45.57  Aligned_cols=40  Identities=25%  Similarity=0.368  Sum_probs=32.2

Q ss_pred             HHHhhCCCCcceeecchhHHHHHHhcccCCCCccceEEEe
Q 022612           31 LQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMA   70 (294)
Q Consensus        31 L~~~~~~lP~~gvGHSlG~kLhlLigs~~~~~r~gniliS   70 (294)
                      +.+....-|++.+|||+||.+-+....+++..-++-++++
T Consensus        88 ~~~~~~~~~~~l~G~S~Gg~~a~~~a~~~p~~v~~lvl~~  127 (286)
T 3qit_A           88 VIQELPDQPLLLVGHSMGAMLATAIASVRPKKIKELILVE  127 (286)
T ss_dssp             HHHHSCSSCEEEEEETHHHHHHHHHHHHCGGGEEEEEEES
T ss_pred             HHHhcCCCCEEEEEeCHHHHHHHHHHHhChhhccEEEEec
Confidence            3334454579999999999999999888887788888887



>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query294
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.15
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 96.75
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 95.83
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 95.3
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 94.76
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 94.7
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 94.56
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 94.41
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 94.38
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 94.26
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 94.16
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 93.94
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 93.75
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 93.72
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 93.67
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 93.59
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 93.45
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 93.41
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 93.34
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 93.26
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 93.25
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 93.04
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 92.94
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 92.84
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 92.81
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 92.76
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 92.7
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 92.59
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 92.0
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 91.78
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 91.51
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 91.42
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 91.42
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 91.19
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 91.14
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 90.99
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 90.32
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 89.01
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 88.48
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 88.32
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 87.79
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 86.09
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 85.99
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 85.03
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 84.44
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 82.86
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 82.19
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Epoxide hydrolase
domain: Bacterial epoxide hydrolase
species: Agrobacterium radiobacter [TaxId: 358]
Probab=97.15  E-value=0.00096  Score=53.31  Aligned_cols=40  Identities=10%  Similarity=0.212  Sum_probs=31.9

Q ss_pred             HHHhhCCCCcceeecchhHHHHHHhcccCCCCccceEEEe
Q 022612           31 LQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMA   70 (294)
Q Consensus        31 L~~~~~~lP~~gvGHSlG~kLhlLigs~~~~~r~gniliS   70 (294)
                      +.+..+.-+++.|||||||.+-+....+++....+.++++
T Consensus        91 ~~~~l~~~~~~lvGhS~Gg~ia~~~a~~~p~~v~~lvl~~  130 (293)
T d1ehya_          91 LLDALGIEKAYVVGHDFAAIVLHKFIRKYSDRVIKAAIFD  130 (293)
T ss_dssp             HHHHTTCCCEEEEEETHHHHHHHHHHHHTGGGEEEEEEEC
T ss_pred             hhhhcCccccccccccccccchhcccccCccccceeeeee
Confidence            4444555678999999999998888888888777877775



>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure