Citrus Sinensis ID: 022612
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 294 | ||||||
| 225425362 | 438 | PREDICTED: uncharacterized protein LOC10 | 0.996 | 0.668 | 0.870 | 1e-149 | |
| 296085574 | 442 | unnamed protein product [Vitis vinifera] | 0.996 | 0.662 | 0.870 | 1e-149 | |
| 255543304 | 441 | conserved hypothetical protein [Ricinus | 1.0 | 0.666 | 0.853 | 1e-145 | |
| 224072437 | 441 | predicted protein [Populus trichocarpa] | 0.989 | 0.659 | 0.845 | 1e-143 | |
| 224057878 | 361 | predicted protein [Populus trichocarpa] | 0.996 | 0.811 | 0.832 | 1e-142 | |
| 356523813 | 505 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.582 | 0.812 | 1e-140 | |
| 15238825 | 431 | uncharacterized protein [Arabidopsis tha | 1.0 | 0.682 | 0.799 | 1e-137 | |
| 449446785 | 440 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.668 | 0.792 | 1e-137 | |
| 297791887 | 429 | hypothetical protein ARALYDRAFT_494828 [ | 1.0 | 0.685 | 0.792 | 1e-136 | |
| 116309460 | 457 | H0502B11.12 [Oryza sativa Indica Group] | 0.996 | 0.641 | 0.778 | 1e-133 |
| >gi|225425362|ref|XP_002269102.1| PREDICTED: uncharacterized protein LOC100255874 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 533 bits (1374), Expect = e-149, Method: Compositional matrix adjust.
Identities = 255/293 (87%), Positives = 278/293 (94%)
Query: 1 MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYA 60
+VIATPYASGFD+F+IADEVQ K DRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYA
Sbjct: 145 LVIATPYASGFDHFFIADEVQFKFDRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYA 204
Query: 61 VPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLEN 120
V R+GN+LMAFNN+EAS+AIPLFSPV VPMAQSIGPLLSQIASSPTVRLGAEMTLKQLEN
Sbjct: 205 VQRSGNVLMAFNNKEASLAIPLFSPVLVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLEN 264
Query: 121 LSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSI 180
LSPPIMKQV+PLVEQLPPLYMDLVKGRE+F PKPEETRRLIKSYYG+SRNLLIKFKDD+I
Sbjct: 265 LSPPIMKQVIPLVEQLPPLYMDLVKGREDFAPKPEETRRLIKSYYGVSRNLLIKFKDDTI 324
Query: 181 DETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANL 240
DETSTLAQVL+SDSAISS+LDMSIR+LPGDHGLPLQQALPDVPPAMADAVNRG E +ANL
Sbjct: 325 DETSTLAQVLASDSAISSLLDMSIRLLPGDHGLPLQQALPDVPPAMADAVNRGGEFLANL 384
Query: 241 TIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNRSTKLLR 293
TIGTPWET+ KEV N+ GVDS+ILRA+ SKD++ LVDVI+SW+ASN KLLR
Sbjct: 385 TIGTPWETVAKEVGNTLGVDSKILRAENSKDLDMLVDVITSWLASNTGPKLLR 437
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|296085574|emb|CBI29306.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255543304|ref|XP_002512715.1| conserved hypothetical protein [Ricinus communis] gi|223548676|gb|EEF50167.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224072437|ref|XP_002303731.1| predicted protein [Populus trichocarpa] gi|222841163|gb|EEE78710.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224057878|ref|XP_002299369.1| predicted protein [Populus trichocarpa] gi|222846627|gb|EEE84174.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356523813|ref|XP_003530529.1| PREDICTED: uncharacterized protein LOC100820080 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|15238825|ref|NP_199597.1| uncharacterized protein [Arabidopsis thaliana] gi|10177922|dbj|BAB11333.1| unnamed protein product [Arabidopsis thaliana] gi|16648766|gb|AAL25574.1| AT5g47860/MCA23_20 [Arabidopsis thaliana] gi|22655374|gb|AAM98279.1| At5g47860/MCA23_20 [Arabidopsis thaliana] gi|332008198|gb|AED95581.1| uncharacterized protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449446785|ref|XP_004141151.1| PREDICTED: uncharacterized protein LOC101208391 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297791887|ref|XP_002863828.1| hypothetical protein ARALYDRAFT_494828 [Arabidopsis lyrata subsp. lyrata] gi|297309663|gb|EFH40087.1| hypothetical protein ARALYDRAFT_494828 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|116309460|emb|CAH66532.1| H0502B11.12 [Oryza sativa Indica Group] gi|218194801|gb|EEC77228.1| hypothetical protein OsI_15775 [Oryza sativa Indica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 294 | ||||||
| TAIR|locus:2160962 | 431 | AT5G47860 [Arabidopsis thalian | 1.0 | 0.682 | 0.761 | 6.2e-117 | |
| TAIR|locus:2098199 | 373 | AT3G43540 "AT3G43540" [Arabido | 0.602 | 0.474 | 0.296 | 2.6e-15 |
| TAIR|locus:2160962 AT5G47860 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1152 (410.6 bits), Expect = 6.2e-117, P = 6.2e-117
Identities = 224/294 (76%), Positives = 250/294 (85%)
Query: 1 MVIATPYASGFDYFYIADEVQLKADRCLRFLQETVQDLPTFGIGHSLGSVIHLLIGSRYA 60
+VIATPYASGFD+F IADEVQ K DRC R LQE VQDLP+FGIGHSLGSVIHLLIGSRYA
Sbjct: 138 LVIATPYASGFDHFNIADEVQFKYDRCCRSLQEEVQDLPSFGIGHSLGSVIHLLIGSRYA 197
Query: 61 VPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLEN 120
V R GN+ MAFNN+EAS+AIPLFSPV VPMAQS+GPLLSQ+A+SPT+RLGAEMT KQLE
Sbjct: 198 VQRNGNVFMAFNNKEASLAIPLFSPVLVPMAQSLGPLLSQVATSPTIRLGAEMTRKQLET 257
Query: 121 LSPPIMKXXXXXXXXXXXXYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKDDSI 180
LSPPIMK YMDLVKGRE+F PKPEETRRLI+SYYGISRNLLIKF+DDSI
Sbjct: 258 LSPPIMKQILPLVEQLPPLYMDLVKGREDFVPKPEETRRLIRSYYGISRNLLIKFEDDSI 317
Query: 181 DETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSELIANL 240
DETS LAQVL +S+ISS LDMSIR LPGDHGLPLQQALPDVPP MA+AVNRGSE +AN+
Sbjct: 318 DETSILAQVLGVESSISSKLDMSIRTLPGDHGLPLQQALPDVPPGMAEAVNRGSEFLANI 377
Query: 241 TIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMASNRSTKLLRP 294
+GTPWE++ KEV S G+DS+ILRAD+SKD+ LVD I+SWM SN KLLRP
Sbjct: 378 AVGTPWESMAKEVGGSLGMDSKILRADMSKDLAQLVDAITSWMISNMGPKLLRP 431
|
|
| TAIR|locus:2098199 AT3G43540 "AT3G43540" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00006255001 | SubName- Full=Chromosome chr1 scaffold_166, whole genome shotgun sequence; (442 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00026129001 | • | 0.504 | |||||||||
| GSVIVG00026576001 | • | 0.502 | |||||||||
| GSVIVG00026573001 | • | 0.502 | |||||||||
| GSVIVG00014701001 | • | 0.502 | |||||||||
| GSVIVG00001938001 | • | 0.502 | |||||||||
| GSVIVG00009465001 | • | • | 0.501 | ||||||||
| GSVIVG00028499001 | • | 0.501 | |||||||||
| GSVIVG00018092001 | • | 0.500 | |||||||||
| GSVIVG00017029001 | • | 0.498 | |||||||||
| GSVIVG00013467001 | • | 0.498 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 294 | |||
| pfam07082 | 250 | pfam07082, DUF1350, Protein of unknown function (D | 2e-33 |
| >gnl|CDD|115718 pfam07082, DUF1350, Protein of unknown function (DUF1350) | Back alignment and domain information |
|---|
Score = 122 bits (308), Expect = 2e-33
Identities = 75/223 (33%), Positives = 96/223 (43%), Gaps = 66/223 (29%)
Query: 2 VIATPYASGFDYFYIADEVQLKADRCLRFLQE----TVQDLPTFGIGHSLGSVIHLLIGS 57
VIATP+ + FD+ IA V K + L L LP +G+GHS+G +HLLIGS
Sbjct: 50 VIATPFVNTFDHGAIALSVLNKFEYALERLVHRGGYPPAYLPIYGLGHSMGCKLHLLIGS 109
Query: 58 RYAVPRTGNILMAFNNREASVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQ 117
Y V R GNILMAFNN A
Sbjct: 110 LYDVERAGNILMAFNNYPA----------------------------------------- 128
Query: 118 LENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLIKFKD 177
KQ +P ++ EFTP P ET LI+ Y + RNLLIKF++
Sbjct: 129 ---------KQAIPWMDNFGT------ALSVEFTPSPTETNHLIQERYPVRRNLLIKFQN 173
Query: 178 DSIDETSTLAQVLSSDSAISSMLDM-SIRMLPGDHGLPLQQAL 219
D ID+T+ L +L + DM + LPG+H PL Q L
Sbjct: 174 DDIDQTARLRSILRAKFG-----DMVTALKLPGNHLTPLGQDL 211
|
This family consists of several hypothetical proteins from both cyanobacteria and plants. Members of this family are typically around 250 residues in length. The function of this family is unknown but the species distribution indicates that the family may be involved in photosynthesis. Length = 250 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 294 | |||
| PF07082 | 250 | DUF1350: Protein of unknown function (DUF1350); In | 100.0 | |
| KOG1455 | 313 | consensus Lysophospholipase [Lipid transport and m | 96.02 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 95.43 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 95.31 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 95.13 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 94.99 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 94.97 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 94.69 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 94.41 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 94.26 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 94.12 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 94.11 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 94.06 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 93.98 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 93.92 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 93.68 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 93.64 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 93.58 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 93.47 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 93.23 | |
| PLN02965 | 255 | Probable pheophorbidase | 93.07 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 93.0 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 92.88 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 92.71 | |
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 92.67 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 92.66 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 92.55 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 92.53 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 92.36 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 91.84 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 91.73 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 91.62 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 91.57 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 91.29 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 91.29 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 91.24 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 91.13 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 91.0 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 90.75 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 90.71 | |
| PLN02578 | 354 | hydrolase | 90.54 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 90.51 | |
| PLN02511 | 388 | hydrolase | 90.33 | |
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 90.33 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 90.09 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 89.88 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 89.85 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 89.4 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 89.35 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 88.68 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 88.66 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 88.35 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 87.84 | |
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 87.69 | |
| KOG2382 | 315 | consensus Predicted alpha/beta hydrolase [General | 87.37 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 86.75 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 86.37 | |
| PLN02454 | 414 | triacylglycerol lipase | 85.79 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 85.56 | |
| PRK10566 | 249 | esterase; Provisional | 85.46 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 84.34 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 84.04 | |
| PF05057 | 217 | DUF676: Putative serine esterase (DUF676); InterPr | 83.35 | |
| PLN02847 | 633 | triacylglycerol lipase | 83.24 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 83.03 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 82.28 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 82.27 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 81.98 | |
| KOG2029 | 697 | consensus Uncharacterized conserved protein [Funct | 81.93 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 81.49 | |
| PLN02571 | 413 | triacylglycerol lipase | 81.33 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 81.3 | |
| KOG2369 | 473 | consensus Lecithin:cholesterol acyltransferase (LC | 80.98 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 80.57 | |
| PF00756 | 251 | Esterase: Putative esterase; InterPro: IPR000801 T | 80.07 |
| >PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.5e-74 Score=530.25 Aligned_cols=198 Identities=48% Similarity=0.773 Sum_probs=183.9
Q ss_pred CEEeecCCCCCChHHHHHHHHHHHHHHHHHHHHhh----CCCCcceeecchhHHHHHHhcccCCCCccceEEEeecCccc
Q 022612 1 MVIATPYASGFDYFYIADEVQLKADRCLRFLQETV----QDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMAFNNREA 76 (294)
Q Consensus 1 ~VIATPY~~~fDH~~iA~~v~~~F~~~~~~L~~~~----~~lP~~gvGHSlG~kLhlLigs~~~~~r~gniliSFNN~~A 76 (294)
+||||||++||||+++|+++|++|++|++.|.++. .++|+||||||||||||+||||+|+++|+|||+||||||+|
T Consensus 49 ~ViAtPy~~tfDH~~~A~~~~~~f~~~~~~L~~~~~~~~~~lP~~~vGHSlGcklhlLi~s~~~~~r~gniliSFNN~~a 128 (250)
T PF07082_consen 49 AVIATPYVVTFDHQAIAREVWERFERCLRALQKRGGLDPAYLPVYGVGHSLGCKLHLLIGSLFDVERAGNILISFNNFPA 128 (250)
T ss_pred EEEEEecCCCCcHHHHHHHHHHHHHHHHHHHHHhcCCCcccCCeeeeecccchHHHHHHhhhccCcccceEEEecCChHH
Confidence 59999999999999999999999999999999854 46999999999999999999999999999999999999999
Q ss_pred cccccCcccccchhhhhhhhhhhhhccCchhhhhhhHHHHhhhhcCchhhhhcchhhhccchhHhhhcCcccceecCHHH
Q 022612 77 SVAIPLFSPVFVPMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQVLPLVEQLPPLYMDLVKGREEFTPKPEE 156 (294)
Q Consensus 77 ~~aIPl~~~~~~p~~~~Lgpll~~~~~sp~~r~~a~~~~~~~~~~~~~~~~~~l~~~eql~~v~~~va~g~~EF~PsP~E 156 (294)
++|||+++ +|+|.+ ++||+|||+|
T Consensus 129 ~~aIP~~~--------~l~~~l------------------------------------------------~~EF~PsP~E 152 (250)
T PF07082_consen 129 DEAIPLLE--------QLAPAL------------------------------------------------RLEFTPSPEE 152 (250)
T ss_pred HhhCchHh--------hhcccc------------------------------------------------ccCccCCHHH
Confidence 99999986 333211 4899999999
Q ss_pred HHHHHHHhhCcCcceeEeeCCCCCcCcHHHHHHhccccccccccccceeecCCCCccccccCCCCCChhhhhhhccchhh
Q 022612 157 TRRLIKSYYGISRNLLIKFKDDSIDETSTLAQVLSSDSAISSMLDMSIRMLPGDHGLPLQQALPDVPPAMADAVNRGSEL 236 (294)
Q Consensus 157 T~~li~~~Y~v~rnLLIkF~dD~IDqT~~L~~~L~~r~~~~~~~~~~~~~LpG~HLTPlgq~~~~~p~~~~~~~~~G~~~ 236 (294)
|+++|+++|.++|||||||++|+||||+.|+++|++|+.+. ++.++|||||||||+|+++| |.|++|
T Consensus 153 T~~li~~~Y~~~rnLLIkF~~D~iDqt~~L~~~L~~r~~~~----~~~~~L~G~HLTPl~q~~~~---------~~g~~f 219 (250)
T PF07082_consen 153 TRRLIRESYQVRRNLLIKFNDDDIDQTDELEQILQQRFPDM----VSIQTLPGNHLTPLGQDLKW---------QVGSSF 219 (250)
T ss_pred HHHHHHHhcCCccceEEEecCCCccchHHHHHHHhhhcccc----ceEEeCCCCCCCcCcCCcCC---------ccCCcc
Confidence 99999999999999999999999999999999999997421 37999999999999999999 889888
Q ss_pred hhhccCCCchHHHHHhhccCCCcchHHHHHhHHHHHHHHHHHHHHhhcc
Q 022612 237 IANLTIGTPWETITKEVSNSFGVDSRILRADISKDIEHLVDVISSWMAS 285 (294)
Q Consensus 237 ~~~~~~~tP~d~va~~~~~~~g~~~q~~r~~~~~d~~~L~~~I~~W~~~ 285 (294)
||+|+| +||+|+++++|+++|+++|++||++
T Consensus 220 -------tP~da~-----------~q~~k~~~~~d~~~L~~~i~~Wl~~ 250 (250)
T PF07082_consen 220 -------TPLDAV-----------GQWLKQEVLRDLRRLKREILDWLNP 250 (250)
T ss_pred -------CchHHH-----------HHHHHHHHHHHHHHHHHHHHHHcCC
Confidence 999999 7999999999999999999999985
|
Members of this family are typically around 250 residues in length. The function of this family is unknown but the species distribution indicates that the family may be involved in photosynthesis. |
| >KOG1455 consensus Lysophospholipase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases | Back alignment and domain information |
|---|
| >PLN02847 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >KOG2029 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 294 | |||
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-04 |
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Score = 47.2 bits (111), Expect = 4e-06
Identities = 43/309 (13%), Positives = 91/309 (29%), Gaps = 84/309 (27%)
Query: 19 EVQLKADRCLR-FLQETVQDLPTFGIGHSLGSVI------HLLIGSRYAVPRTGNILMAF 71
E Q + L F V + + S++ H++ S+ AV T +
Sbjct: 13 EHQYQYKDILSVFEDAFVDNFDCKDVQDMPKSILSKEEIDHII-MSKDAVSGTLRLFWTL 71
Query: 72 NNREASVAIPLFSPVFV--PMAQSIGPLLSQIASSPTVRLGAEMTLKQLENLSPPIMKQV 129
+++ + FV + + L+S I + E P +M ++
Sbjct: 72 LSKQEEMV-----QKFVEEVLRINYKFLMSPIKT---------------EQRQPSMMTRM 111
Query: 130 LPLVEQLPPLYMDLVKGREEFTPKPEETRRLIKSYYGISRNLLI---------KFKDDSI 180
+EQ LY D + + + +L ++ + + K
Sbjct: 112 Y--IEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGK------ 163
Query: 181 DETSTLA-QVLSSDSAISSM------LDMSIRMLPGDHGLPLQ----------QALPDVP 223
+ +A V S M L++ P LQ + D
Sbjct: 164 ---TWVALDVCLSYKVQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHS 220
Query: 224 PAMADAVNRGSELIANLTIGTP-----------WETITKEVSNSFGVDSRILRADISKDI 272
+ ++ + L P + N+F + +IL ++
Sbjct: 221 SNIKLRIHSIQAELRRLLKSKPYENCLLVLLNVQ---NAKAWNAFNLSCKILL--TTRFK 275
Query: 273 EHLVDVISS 281
+ + D +S+
Sbjct: 276 Q-VTDFLSA 283
|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 294 | |||
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 96.7 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 96.6 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 96.39 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 96.36 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 96.23 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 96.07 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 95.91 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 95.88 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 95.73 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 95.68 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 95.65 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 95.61 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 95.58 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 95.49 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 95.46 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 95.46 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 95.34 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 95.24 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 95.18 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 95.17 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 95.15 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 95.14 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 95.11 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 95.07 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 95.07 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 95.05 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 95.02 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 95.02 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 95.02 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 95.01 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 94.98 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 94.98 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 94.98 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 94.97 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 94.94 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 94.93 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 94.93 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 94.92 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 94.89 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 94.89 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 94.87 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 94.86 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 94.85 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 94.84 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 94.82 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 94.82 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 94.8 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 94.78 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 94.78 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 94.77 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 94.77 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 94.76 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 94.75 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 94.75 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 94.75 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 94.73 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 94.73 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 94.73 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 94.72 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 94.68 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 94.65 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 94.65 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 94.65 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 94.64 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 94.63 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 94.63 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 94.62 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 94.62 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 94.56 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 94.55 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 94.52 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 94.51 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 94.49 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 94.47 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 94.46 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 94.45 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 94.45 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 94.45 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 94.39 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 94.38 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 94.35 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 94.34 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 94.33 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 94.3 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 94.28 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 94.24 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 94.23 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 94.23 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 94.15 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 94.14 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 94.09 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 94.08 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 94.08 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 94.05 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 94.05 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 94.04 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 94.0 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 93.98 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 93.96 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 93.92 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 93.91 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 93.83 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 93.81 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 93.79 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 93.76 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 93.75 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 93.7 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 93.68 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 93.66 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 93.65 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 93.63 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 93.63 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 93.47 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 93.46 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 93.42 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 93.42 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 92.5 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 93.31 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 93.27 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 93.24 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 93.22 | |
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 93.16 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 92.9 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 92.86 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 92.71 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 92.69 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 92.67 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 92.49 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 92.39 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 92.32 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 92.3 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 92.24 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 92.01 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 91.86 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 91.47 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 91.38 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 91.32 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 91.3 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 91.3 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 91.26 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 91.18 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 91.02 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 90.91 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 90.85 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 90.61 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 90.59 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 90.51 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 90.42 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 89.89 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 89.64 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 89.57 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 89.57 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 89.55 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 89.54 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 89.29 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 89.18 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 88.96 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 88.95 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 88.54 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 88.49 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 88.42 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 88.41 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 88.19 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 88.13 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 87.74 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 87.72 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 87.62 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 87.57 | |
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 87.51 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 87.09 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 86.84 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 86.75 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 86.54 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 86.32 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 86.11 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 85.94 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 85.93 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 85.88 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 85.77 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 85.61 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 85.22 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 84.84 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 84.58 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 84.5 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 83.6 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 83.47 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 83.29 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 83.24 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 83.11 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 83.09 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 83.03 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 82.96 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 82.8 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 81.93 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 81.58 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 81.53 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 80.77 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 80.3 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 80.23 |
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
Probab=96.70 E-value=0.028 Score=45.57 Aligned_cols=40 Identities=25% Similarity=0.368 Sum_probs=32.2
Q ss_pred HHHhhCCCCcceeecchhHHHHHHhcccCCCCccceEEEe
Q 022612 31 LQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMA 70 (294)
Q Consensus 31 L~~~~~~lP~~gvGHSlG~kLhlLigs~~~~~r~gniliS 70 (294)
+.+....-|++.+|||+||.+-+....+++..-++-++++
T Consensus 88 ~~~~~~~~~~~l~G~S~Gg~~a~~~a~~~p~~v~~lvl~~ 127 (286)
T 3qit_A 88 VIQELPDQPLLLVGHSMGAMLATAIASVRPKKIKELILVE 127 (286)
T ss_dssp HHHHSCSSCEEEEEETHHHHHHHHHHHHCGGGEEEEEEES
T ss_pred HHHhcCCCCEEEEEeCHHHHHHHHHHHhChhhccEEEEec
Confidence 3334454579999999999999999888887788888887
|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 294 | |||
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 97.15 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 96.75 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 95.83 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 95.3 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 94.76 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 94.7 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 94.56 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 94.41 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 94.38 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 94.26 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 94.16 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 93.94 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 93.75 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 93.72 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 93.67 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 93.59 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 93.45 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 93.41 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 93.34 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 93.26 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 93.25 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 93.04 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 92.94 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 92.84 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 92.81 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 92.76 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 92.7 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 92.59 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 92.0 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 91.78 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 91.51 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 91.42 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 91.42 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 91.19 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 91.14 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 90.99 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 90.32 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 89.01 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 88.48 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 88.32 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 87.79 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 86.09 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 85.99 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 85.03 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 84.44 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 82.86 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 82.19 |
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Epoxide hydrolase domain: Bacterial epoxide hydrolase species: Agrobacterium radiobacter [TaxId: 358]
Probab=97.15 E-value=0.00096 Score=53.31 Aligned_cols=40 Identities=10% Similarity=0.212 Sum_probs=31.9
Q ss_pred HHHhhCCCCcceeecchhHHHHHHhcccCCCCccceEEEe
Q 022612 31 LQETVQDLPTFGIGHSLGSVIHLLIGSRYAVPRTGNILMA 70 (294)
Q Consensus 31 L~~~~~~lP~~gvGHSlG~kLhlLigs~~~~~r~gniliS 70 (294)
+.+..+.-+++.|||||||.+-+....+++....+.++++
T Consensus 91 ~~~~l~~~~~~lvGhS~Gg~ia~~~a~~~p~~v~~lvl~~ 130 (293)
T d1ehya_ 91 LLDALGIEKAYVVGHDFAAIVLHKFIRKYSDRVIKAAIFD 130 (293)
T ss_dssp HHHHTTCCCEEEEEETHHHHHHHHHHHHTGGGEEEEEEEC
T ss_pred hhhhcCccccccccccccccchhcccccCccccceeeeee
Confidence 4444555678999999999998888888888777877775
|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|