Citrus Sinensis ID: 022677

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290---
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF
cccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEEccccHHHHHHHHccccEEEEcccHHHHcccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHcccccEEEEcccccccccEEEc
cccHccccEEEEEccccHHHHccccHEHHHHcccHHHccccccccHccccccEEEEccccccccccccccccccccccccHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEEEccHHHHEccccccccccHHHHHHHHHHHHHcccccEEEEccccccccccHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHHccccEEEEEccccccHHHccccEEccccHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHccccEEEEccccccccEEEEc
MAEQHVSLKRvqvaqpkhlfkQTQLLVTLTQHYSRILnnsnmsfsrinrarPLLVRCmsnipensvyggpkpqnpnqrVTLTHLRqkhkngepitmvtaydypsavhldsagidiclvgdsaamvvhghdttlpITLEEMLVHCRAVargakrpllvgdlpfgtyesstnQAVDTAVRILKEGGmdaikleggspsriTAARGIVEAGIAVMGHVGLTPQAisvlggfrpqgknvTSAVKVVETALALQEVGCFSVvlecvpppvaAAATsalqiptigigagpfcsgqvsff
maeqhvslkrvqvaqpkhlfkQTQLLVTLTQHYSRIlnnsnmsfsRINRARPLLVRCMSNIPensvyggpkpqNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFgtyesstnqaVDTAVRILKEGGMdaikleggspsrITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECvpppvaaaaTSALQIPTIGIGAGPFCSGQVSFF
************VAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNI*******************************PITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSG*****
************VA****LF***QLLVTLTQHYS***********************************************THLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF
*********RVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF
*****VSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEQHVSLKRVQVAQPKHLFKQTQLLVTLTQHYSRILNNSNMSFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query293 2.2.26 [Sep-21-2011]
Q9Y7B6349 3-methyl-2-oxobutanoate h yes no 0.737 0.618 0.543 2e-61
Q3A9L0276 3-methyl-2-oxobutanoate h yes no 0.737 0.782 0.502 3e-59
B0TC10276 3-methyl-2-oxobutanoate h yes no 0.726 0.771 0.514 6e-59
Q5YZ95283 3-methyl-2-oxobutanoate h yes no 0.767 0.795 0.506 1e-57
Q7NMK3260 3-methyl-2-oxobutanoate h yes no 0.723 0.815 0.504 9e-57
A0PXQ3275 3-methyl-2-oxobutanoate h yes no 0.716 0.763 0.511 1e-56
Q47R98280 3-methyl-2-oxobutanoate h yes no 0.784 0.821 0.489 1e-56
B8HWP9261 3-methyl-2-oxobutanoate h yes no 0.723 0.812 0.504 2e-56
Q2RM79269 3-methyl-2-oxobutanoate h yes no 0.733 0.799 0.532 3e-56
A1VBJ4307 3-methyl-2-oxobutanoate h yes no 0.696 0.664 0.521 3e-56
>sp|Q9Y7B6|PANB_EMENI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=panB PE=3 SV=1 Back     alignment and function desciption
 Score =  236 bits (601), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 155/217 (71%), Gaps = 1/217 (0%)

Query: 74  NPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTL 133
           NP ++VT+  LR  +K GEPITM+TA+D+PSA   D+AG+D+ LVGDS AMV  G   T 
Sbjct: 60  NPRKKVTMQTLRNLYKKGEPITMLTAHDFPSAHVADAAGMDMILVGDSLAMVALGMQDTS 119

Query: 134 PITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGG 193
            +TL++MLVHCR+VAR A+    V DLP G+YE S  QA+ +A+RI+KEG +  +KLEGG
Sbjct: 120 EVTLDDMLVHCRSVARAAQSAFTVSDLPMGSYEVSPEQALQSAIRIVKEGRVQGVKLEGG 179

Query: 194 SPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGC 253
                 A + I  AGI V+GH+GLTPQ  + LGGFR QGK+ T A+K+++ ALA+QE G 
Sbjct: 180 E-EMAPAIKRITTAGIPVVGHIGLTPQRQNALGGFRVQGKSTTDALKLLKDALAVQEAGA 238

Query: 254 FSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQV 290
           F +V+E VPP +A+  T  L +PTIGIGAG  CSGQV
Sbjct: 239 FMIVIEAVPPEIASIVTQKLSVPTIGIGAGNGCSGQV 275

Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (taxid: 227321)
EC: 2EC: .EC: 1EC: .EC: 2EC: .EC: 1EC: 1
>sp|Q3A9L0|PANB_CARHZ 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Carboxydothermus hydrogenoformans (strain Z-2901 / DSM 6008) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|B0TC10|PANB_HELMI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|Q5YZ95|PANB_NOCFA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|Q7NMK3|PANB_GLOVI 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=panB PE=3 SV=2 Back     alignment and function description
>sp|A0PXQ3|PANB_CLONN 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Clostridium novyi (strain NT) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|Q47R98|PANB_THEFY 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Thermobifida fusca (strain YX) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|B8HWP9|PANB_CYAP4 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|Q2RM79|PANB_MOOTA 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=panB PE=3 SV=1 Back     alignment and function description
>sp|A1VBJ4|PANB_DESVV 3-methyl-2-oxobutanoate hydroxymethyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=panB PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query293
297821010353 hypothetical protein ARALYDRAFT_486638 [ 0.853 0.708 0.876 1e-125
15233139354 Phosphoenolpyruvate carboxylase family p 0.846 0.700 0.879 1e-124
15225928347 ketopantoate hydroxymethyltransferase 1 0.843 0.711 0.863 1e-124
225454302363 PREDICTED: 3-methyl-2-oxobutanoate hydro 0.815 0.658 0.878 1e-121
224130402360 ketopantoate hydroxymethyltransferase [P 0.815 0.663 0.895 1e-119
297828337346 KPHMT1/PANB1 [Arabidopsis lyrata subsp. 0.836 0.708 0.824 1e-115
255541718362 3-methyl-2-oxobutanoate hydroxymethyltra 0.815 0.660 0.878 1e-115
449443772347 PREDICTED: 3-methyl-2-oxobutanoate hydro 0.856 0.723 0.830 1e-114
356522560358 PREDICTED: 3-methyl-2-oxobutanoate hydro 0.870 0.712 0.810 1e-113
357504415351 3-methyl-2-oxobutanoate hydroxymethyltra 0.812 0.678 0.85 1e-108
>gi|297821010|ref|XP_002878388.1| hypothetical protein ARALYDRAFT_486638 [Arabidopsis lyrata subsp. lyrata] gi|297324226|gb|EFH54647.1| hypothetical protein ARALYDRAFT_486638 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 220/251 (87%), Positives = 235/251 (93%), Gaps = 1/251 (0%)

Query: 43  SFSRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDY 102
           S SR +RA    VR MSN+PEN+VYGGPK QNPNQRVTLT LRQKH+ GEPITMVTAYDY
Sbjct: 8   SCSRASRAI-TTVRFMSNVPENTVYGGPKSQNPNQRVTLTQLRQKHRKGEPITMVTAYDY 66

Query: 103 PSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPF 162
           PSAVH+D+AGID+CLVGDSAAMVVHG+DTTLPI+L+EMLVHCRAVARGAKRPLLVGDLPF
Sbjct: 67  PSAVHIDTAGIDVCLVGDSAAMVVHGYDTTLPISLDEMLVHCRAVARGAKRPLLVGDLPF 126

Query: 163 GTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAI 222
           GTYESSTNQAVDTAVR+LKEGGMDAIKLEGGSPSRITAA+ IVEAGIAVMGHVGLTPQAI
Sbjct: 127 GTYESSTNQAVDTAVRVLKEGGMDAIKLEGGSPSRITAAKSIVEAGIAVMGHVGLTPQAI 186

Query: 223 SVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGA 282
           SVLGGFRPQGKN+ SAVKVVETA+ALQE GCFSVVLECVPPPVAAAATSAL IPTIGIGA
Sbjct: 187 SVLGGFRPQGKNIASAVKVVETAMALQEAGCFSVVLECVPPPVAAAATSALNIPTIGIGA 246

Query: 283 GPFCSGQVSFF 293
           GPFCSGQV  +
Sbjct: 247 GPFCSGQVLVY 257

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|15233139|ref|NP_191712.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] gi|42572757|ref|NP_974474.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] gi|6850844|emb|CAB71083.1| 3-methyl-2-oxobutanoate hydroxy-methyl-transferase-like protein [Arabidopsis thaliana] gi|21593121|gb|AAM65070.1| 3-methyl-2-oxobutanoate hydroxy-methyl-transferase-like protein [Arabidopsis thaliana] gi|94442441|gb|ABF19008.1| At3g61530 [Arabidopsis thaliana] gi|332646697|gb|AEE80218.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] gi|332646698|gb|AEE80219.1| Phosphoenolpyruvate carboxylase family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15225928|ref|NP_182135.1| ketopantoate hydroxymethyltransferase 1 [Arabidopsis thaliana] gi|3702336|gb|AAC62893.1| 3-methyl-2-oxobutanoate hydroxy-methyl-transferase [Arabidopsis thaliana] gi|28466955|gb|AAO44086.1| At2g46110 [Arabidopsis thaliana] gi|110735692|dbj|BAE99826.1| 3-methyl-2-oxobutanoate hydroxy-methyl-transferase [Arabidopsis thaliana] gi|330255551|gb|AEC10645.1| ketopantoate hydroxymethyltransferase 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|225454302|ref|XP_002276965.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxymethyltransferase [Vitis vinifera] Back     alignment and taxonomy information
>gi|224130402|ref|XP_002320828.1| ketopantoate hydroxymethyltransferase [Populus trichocarpa] gi|222861601|gb|EEE99143.1| ketopantoate hydroxymethyltransferase [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297828337|ref|XP_002882051.1| KPHMT1/PANB1 [Arabidopsis lyrata subsp. lyrata] gi|297327890|gb|EFH58310.1| KPHMT1/PANB1 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255541718|ref|XP_002511923.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase, putative [Ricinus communis] gi|223549103|gb|EEF50592.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449443772|ref|XP_004139651.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxymethyltransferase-like [Cucumis sativus] gi|449475405|ref|XP_004154444.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxymethyltransferase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356522560|ref|XP_003529914.1| PREDICTED: 3-methyl-2-oxobutanoate hydroxymethyltransferase-like [Glycine max] Back     alignment and taxonomy information
>gi|357504415|ref|XP_003622496.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase [Medicago truncatula] gi|355497511|gb|AES78714.1| 3-methyl-2-oxobutanoate hydroxymethyltransferase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query293
TAIR|locus:2082847354 PANB2 [Arabidopsis thaliana (t 0.836 0.692 0.853 7e-109
TAIR|locus:2062969347 KPHMT1 "ketopantoate hydroxyme 0.832 0.703 0.837 1.9e-108
DICTYBASE|DDB_G0286637 833 DDB_G0286637 "3-methyl-2-oxobu 0.730 0.256 0.493 8.6e-56
ASPGD|ASPL0000048463349 pantoB [Emericella nidulans (t 0.839 0.704 0.478 1.1e-55
UNIPROTKB|G4NB94373 MGG_00599 "3-methyl-2-oxobutan 0.767 0.603 0.515 1.1e-53
TIGR_CMR|CHY_2377276 CHY_2377 "3-methyl-2-oxobutano 0.723 0.768 0.492 3.8e-53
TIGR_CMR|DET_0803282 DET_0803 "3-methyl-2-oxobutano 0.723 0.751 0.483 7.4e-50
UNIPROTKB|P0A5Q8281 panB "3-methyl-2-oxobutanoate 0.767 0.800 0.450 3.7e-48
TIGR_CMR|GSU_1705267 GSU_1705 "3-methyl-2-oxobutano 0.730 0.801 0.474 6e-48
CGD|CAL0005148309 orf19.6057 [Candida albicans ( 0.726 0.689 0.460 9.8e-48
TAIR|locus:2082847 PANB2 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1076 (383.8 bits), Expect = 7.0e-109, P = 7.0e-109
 Identities = 210/246 (85%), Positives = 224/246 (91%)

Query:    45 SRINRARPLLVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPS 104
             SR +RA    VR MSN+PE++VYGGPKPQN NQRVTLT LRQKH+ GEPITMVTAYDYPS
Sbjct:    11 SRASRAITT-VRFMSNVPEDTVYGGPKPQNSNQRVTLTQLRQKHRKGEPITMVTAYDYPS 69

Query:   105 AVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGT 164
             AVH+D+AGID+CLVGDSAAMVVHG+DTTLPI+LEEMLVHCRAVARGAKRPLLVGDLPFGT
Sbjct:    70 AVHIDTAGIDVCLVGDSAAMVVHGYDTTLPISLEEMLVHCRAVARGAKRPLLVGDLPFGT 129

Query:   165 YESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISV 224
             YESSTNQAVDTAVR+LKEGGMDAIKLEGGSPSRITAA+ IVEAGIAVMGHVGLTPQAISV
Sbjct:   130 YESSTNQAVDTAVRVLKEGGMDAIKLEGGSPSRITAAKSIVEAGIAVMGHVGLTPQAISV 189

Query:   225 LGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECXXXXXXXXXTSALQIPTIGIGAGP 284
             LGGFRPQGKN+ SAVKVVETA+ALQE GCFSVVLEC         TSAL IPTIGIGAGP
Sbjct:   190 LGGFRPQGKNIASAVKVVETAMALQEAGCFSVVLECVPPPVAAAATSALNIPTIGIGAGP 249

Query:   285 FCSGQV 290
             FCSGQV
Sbjct:   250 FCSGQV 255
GO:0003824 "catalytic activity" evidence=IEA
GO:0003864 "3-methyl-2-oxobutanoate hydroxymethyltransferase activity" evidence=IEA;IGI;ISS
GO:0009507 "chloroplast" evidence=ISM
GO:0015940 "pantothenate biosynthetic process" evidence=IEA;IGI;ISS
GO:0005739 "mitochondrion" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IDA
GO:0050897 "cobalt ion binding" evidence=IDA
TAIR|locus:2062969 KPHMT1 "ketopantoate hydroxymethyltransferase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0286637 DDB_G0286637 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000048463 pantoB [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NB94 MGG_00599 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_2377 CHY_2377 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0803 DET_0803 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|P0A5Q8 panB "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1705 GSU_1705 "3-methyl-2-oxobutanoate hydroxymethyltransferase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
CGD|CAL0005148 orf19.6057 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B8HWP9PANB_CYAP42, ., 1, ., 2, ., 1, 10.50470.72350.8122yesno
B7JVF9PANB_CYAP82, ., 1, ., 2, ., 1, 10.51410.72010.8210yesno
A9WFR7PANB_CHLAA2, ., 1, ., 2, ., 1, 10.51850.72690.7580yesno
B9LII0PANB_CHLSY2, ., 1, ., 2, ., 1, 10.51850.72690.7580yesno
Q729A6PANB_DESVH2, ., 1, ., 2, ., 1, 10.52190.69620.6644yesno
Q5YZ95PANB_NOCFA2, ., 1, ., 2, ., 1, 10.50650.76790.7950yesno
A8A9H3PANB_IGNH42, ., 1, ., 2, ., 1, 10.50460.72350.8060yesno
B0TC10PANB_HELMI2, ., 1, ., 2, ., 1, 10.51400.72690.7717yesno
Q7NMK3PANB_GLOVI2, ., 1, ., 2, ., 1, 10.50470.72350.8153yesno
A1VBJ4PANB_DESVV2, ., 1, ., 2, ., 1, 10.52190.69620.6644yesno
B8G644PANB_CHLAD2, ., 1, ., 2, ., 1, 10.54160.72690.7634yesno
Q2RM79PANB_MOOTA2, ., 1, ., 2, ., 1, 10.53240.73370.7992yesno
Q9Y7B6PANB_EMENI2, ., 1, ., 2, ., 1, 10.54370.73720.6189yesno
Q3A9L0PANB_CARHZ2, ., 1, ., 2, ., 1, 10.50230.73720.7826yesno
B1XQ35PANB_SYNP22, ., 1, ., 2, ., 1, 10.50700.72350.8091yesno
Q311U7PANB_DESDG2, ., 1, ., 2, ., 1, 10.54450.68600.6955yesno
Q8YWS8PANB_NOSS12, ., 1, ., 2, ., 1, 10.52350.71670.8171yesno
Q3M672PANB_ANAVT2, ., 1, ., 2, ., 1, 10.52830.71670.8171yesno
A5N5W0PANB_CLOK52, ., 1, ., 2, ., 1, 10.50710.70640.7392yesno
A0PXQ3PANB_CLONN2, ., 1, ., 2, ., 1, 10.51180.71670.7636yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.20.766
4th Layer2.1.2.110.824

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query293
PLN02424332 PLN02424, PLN02424, ketopantoate hydroxymethyltran 1e-175
cd06557254 cd06557, KPHMT-like, Ketopantoate hydroxymethyltra 1e-124
pfam02548261 pfam02548, Pantoate_transf, Ketopantoate hydroxyme 1e-120
PRK00311264 PRK00311, panB, 3-methyl-2-oxobutanoate hydroxymet 1e-118
COG0413268 COG0413, PanB, Ketopantoate hydroxymethyltransfera 1e-102
TIGR00222263 TIGR00222, panB, 3-methyl-2-oxobutanoate hydroxyme 6e-77
cd06556240 cd06556, ICL_KPHMT, Members of the ICL/PEPM_KPHMT 7e-45
COG2513289 COG2513, PrpB, PEP phosphonomutase and related enz 2e-04
pfam13714238 pfam13714, PEP_mutase, Phosphoenolpyruvate phospho 0.001
>gnl|CDD|215233 PLN02424, PLN02424, ketopantoate hydroxymethyltransferase Back     alignment and domain information 
 Score =  487 bits (1256), Expect = e-175
 Identities = 203/233 (87%), Positives = 221/233 (94%)

Query: 58  MSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICL 117
           MSN+PE++VYGGPKPQNP QRVTL  LRQK++ GEPITMVTAYDYPSAVH+DSAGID+CL
Sbjct: 1   MSNLPEDTVYGGPKPQNPAQRVTLRTLRQKYRRGEPITMVTAYDYPSAVHVDSAGIDVCL 60

Query: 118 VGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAV 177
           VGDSAAMVVHGHDTTLPITL+EMLVHCRAVARGA RPLLVGDLPFG+YESST+QAV++AV
Sbjct: 61  VGDSAAMVVHGHDTTLPITLDEMLVHCRAVARGANRPLLVGDLPFGSYESSTDQAVESAV 120

Query: 178 RILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTS 237
           R+LKEGGMDA+KLEGGSPSR+TAA+ IVEAGIAVMGHVGLTPQAISVLGGFRPQG+   S
Sbjct: 121 RMLKEGGMDAVKLEGGSPSRVTAAKAIVEAGIAVMGHVGLTPQAISVLGGFRPQGRTAES 180

Query: 238 AVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQV 290
           AVKVVETALALQE GCF+VVLECVP PVAAA TSALQIPTIGIGAGPFCSGQV
Sbjct: 181 AVKVVETALALQEAGCFAVVLECVPAPVAAAITSALQIPTIGIGAGPFCSGQV 233

Length = 332
>gnl|CDD|119342 cd06557, KPHMT-like, Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>gnl|CDD|217097 pfam02548, Pantoate_transf, Ketopantoate hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|234723 PRK00311, panB, 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|223490 COG0413, PanB, Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|232882 TIGR00222, panB, 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>gnl|CDD|119341 cd06556, ICL_KPHMT, Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>gnl|CDD|225311 COG2513, PrpB, PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|222337 pfam13714, PEP_mutase, Phosphoenolpyruvate phosphomutase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 293
PLN02424332 ketopantoate hydroxymethyltransferase 100.0
PF02548261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 100.0
COG0413268 PanB Ketopantoate hydroxymethyltransferase [Coenzy 100.0
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 100.0
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 100.0
KOG2949306 consensus Ketopantoate hydroxymethyltransferase [C 100.0
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 100.0
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 100.0
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 100.0
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 100.0
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 100.0
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 100.0
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 100.0
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 100.0
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 99.97
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 99.96
PRK15063 428 isocitrate lyase; Provisional 99.92
TIGR01346 527 isocit_lyase isocitrate lyase. Isocitrate lyase an 99.25
COG2224 433 AceA Isocitrate lyase [Energy production and conve 98.85
PRK06498 531 isocitrate lyase; Provisional 98.45
KOG1260 492 consensus Isocitrate lyase [Energy production and 98.35
PLN02892 570 isocitrate lyase 98.22
TIGR03151 307 enACPred_II putative enoyl-(acyl-carrier-protein) 97.67
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 97.64
PRK08185283 hypothetical protein; Provisional 97.6
PRK13585241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 97.59
PF00463 526 ICL: Isocitrate lyase family; InterPro: IPR000918 97.5
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 97.49
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 97.49
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 97.45
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.38
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazol 97.37
PRK06801286 hypothetical protein; Provisional 97.32
PRK06806281 fructose-bisphosphate aldolase; Provisional 97.31
cd00945201 Aldolase_Class_I Class I aldolases. The class I al 97.21
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 97.2
PF09370268 TIM-br_sig_trns: TIM-barrel signal transduction pr 97.13
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carb 97.12
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 97.12
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 97.11
TIGR01769205 GGGP geranylgeranylglyceryl phosphate synthase. Th 97.1
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 97.06
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 96.99
cd04731243 HisF The cyclase subunit of imidazoleglycerol phos 96.97
TIGR02317285 prpB methylisocitrate lyase. Members of this famil 96.96
PRK08610286 fructose-bisphosphate aldolase; Reviewed 96.96
PRK00748233 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 96.92
PRK07709285 fructose-bisphosphate aldolase; Provisional 96.91
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 96.87
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 96.86
cd00947276 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) a 96.83
PRK12857284 fructose-1,6-bisphosphate aldolase; Reviewed 96.81
COG0826 347 Collagenase and related proteases [Posttranslation 96.79
TIGR00167288 cbbA ketose-bisphosphate aldolases. fructose-bisph 96.78
TIGR00737 319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 96.7
PRK07315293 fructose-bisphosphate aldolase; Provisional 96.67
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 96.66
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 96.63
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino a 96.61
cd04743 320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like doma 96.51
cd00377243 ICL_PEPM Members of the ICL/PEPM enzyme family cat 96.44
TIGR02320285 PEP_mutase phosphoenolpyruvate phosphomutase. A cl 96.39
PF03437254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 96.38
PRK07565334 dihydroorotate dehydrogenase 2; Reviewed 96.36
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epim 96.35
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bispho 96.35
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 96.29
PRK12738286 kbaY tagatose-bisphosphate aldolase; Reviewed 96.28
PRK11320292 prpB 2-methylisocitrate lyase; Provisional 96.25
PRK07475245 hypothetical protein; Provisional 96.24
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 96.23
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 96.22
TIGR02319294 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phos 96.21
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 96.2
PRK10415 321 tRNA-dihydrouridine synthase B; Provisional 96.17
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 96.1
PRK14024241 phosphoribosyl isomerase A; Provisional 96.1
PRK09195284 gatY tagatose-bisphosphate aldolase; Reviewed 96.1
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) 96.01
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 96.0
PF13714238 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB 95.94
TIGR00737319 nifR3_yhdG putative TIM-barrel protein, nifR3 fami 95.92
cd06556240 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme sup 95.92
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 95.92
cd06557254 KPHMT-like Ketopantoate hydroxymethyltransferase ( 95.86
PRK00278260 trpC indole-3-glycerol-phosphate synthase; Reviewe 95.86
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 95.85
PLN02274505 inosine-5'-monophosphate dehydrogenase 95.84
PRK14042 596 pyruvate carboxylase subunit B; Provisional 95.83
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 95.77
TIGR02321290 Pphn_pyruv_hyd phosphonopyruvate hydrolase. This f 95.75
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 95.75
PRK00208250 thiG thiazole synthase; Reviewed 95.74
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c 95.72
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); 95.7
PRK12737284 gatY tagatose-bisphosphate aldolase; Reviewed 95.7
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A 95.69
TIGR00007230 phosphoribosylformimino-5-aminoimidazole carboxami 95.69
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 95.68
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called 95.67
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 95.67
PRK12581 468 oxaloacetate decarboxylase; Provisional 95.67
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 95.66
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 95.63
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 95.61
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 95.6
PRK00311264 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 95.52
TIGR00674285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 95.49
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 95.49
PRK14040 593 oxaloacetate decarboxylase; Provisional 95.45
PRK12331 448 oxaloacetate decarboxylase; Provisional 95.44
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 95.42
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 95.42
PRK11815 333 tRNA-dihydrouridine synthase A; Provisional 95.4
COG0821 361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 95.4
PRK00366 360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 95.35
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 95.35
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R 95.35
TIGR00742 318 yjbN tRNA dihydrouridine synthase A. Members of th 95.32
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FM 95.3
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 95.28
PF04481242 DUF561: Protein of unknown function (DUF561); Inte 95.27
cd00951 289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 95.26
PRK03170292 dihydrodipicolinate synthase; Provisional 95.26
TIGR00612 346 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-dipho 95.24
TIGR00683290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 95.22
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 95.2
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine m 95.18
PRK12330 499 oxaloacetate decarboxylase; Provisional 95.17
PRK08645 612 bifunctional homocysteine S-methyltransferase/5,10 95.16
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 95.12
TIGR00674 285 dapA dihydrodipicolinate synthase. Dihydrodipicoli 95.11
PF03060 330 NMO: Nitronate monooxygenase; InterPro: IPR004136 95.08
PRK13111258 trpA tryptophan synthase subunit alpha; Provisiona 95.07
PRK00208250 thiG thiazole synthase; Reviewed 95.07
PRK03170 292 dihydrodipicolinate synthase; Provisional 95.06
CHL00162267 thiG thiamin biosynthesis protein G; Validated 95.06
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 95.04
PRK07028 430 bifunctional hexulose-6-phosphate synthase/ribonuc 95.03
PRK04147293 N-acetylneuraminate lyase; Provisional 95.03
cd00408 281 DHDPS-like Dihydrodipicolinate synthase family. A 95.03
cd08205 367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 95.02
PF04131192 NanE: Putative N-acetylmannosamine-6-phosphate epi 94.95
COG0042 323 tRNA-dihydrouridine synthase [Translation, ribosom 94.94
PRK09282 592 pyruvate carboxylase subunit B; Validated 94.92
PRK07535261 methyltetrahydrofolate:corrinoid/iron-sulfur prote 94.92
TIGR00736231 nifR3_rel_arch TIM-barrel protein, putative. Membe 94.91
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 94.91
TIGR02313 294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 94.88
COG0329 299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 94.85
TIGR02313294 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic ac 94.84
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 94.82
PRK07534336 methionine synthase I; Validated 94.79
PRK07226267 fructose-bisphosphate aldolase; Provisional 94.77
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 94.74
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 94.74
TIGR00259257 thylakoid_BtpA membrane complex biogenesis protein 94.71
TIGR00742318 yjbN tRNA dihydrouridine synthase A. Members of th 94.71
TIGR03217 333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 94.7
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 94.69
PRK04147 293 N-acetylneuraminate lyase; Provisional 94.68
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 94.64
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-lik 94.63
PRK08195 337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 94.6
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 94.58
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme met 94.56
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 94.56
PRK01033258 imidazole glycerol phosphate synthase subunit HisF 94.53
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 94.48
cd00952 309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 94.41
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 94.39
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 94.38
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 94.38
TIGR01949258 AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep 94.38
PF00701 289 DHDPS: Dihydrodipicolinate synthetase family; Inte 94.37
PLN02489335 homocysteine S-methyltransferase 94.36
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 94.35
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 94.32
PRK14042 596 pyruvate carboxylase subunit B; Provisional 94.28
PLN02274505 inosine-5'-monophosphate dehydrogenase 94.26
cd00950 284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a ke 94.24
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM 94.23
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 94.2
PRK05835307 fructose-bisphosphate aldolase; Provisional 94.18
COG0434263 SgcQ Predicted TIM-barrel enzyme [General function 94.16
TIGR01037300 pyrD_sub1_fam dihydroorotate dehydrogenase (subfam 94.11
PRK02615347 thiamine-phosphate pyrophosphorylase; Provisional 94.02
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 94.01
COG1794 230 RacX Aspartate racemase [Cell envelope biogenesis, 94.0
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 93.99
PF00701289 DHDPS: Dihydrodipicolinate synthetase family; Inte 93.96
PRK12330 499 oxaloacetate decarboxylase; Provisional 93.96
PRK10200 230 putative racemase; Provisional 93.93
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 93.91
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 93.9
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 93.9
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 93.88
cd00953 279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 93.87
PRK09485304 mmuM homocysteine methyltransferase; Provisional 93.82
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate 93.78
PRK07084321 fructose-bisphosphate aldolase; Provisional 93.76
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like F 93.75
cd02812219 PcrB_like PcrB_like proteins. One member of this f 93.73
cd00954 288 NAL N-Acetylneuraminic acid aldolase, also called 93.73
cd02911233 arch_FMN Archeal FMN-binding domain. This family o 93.72
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuramin 93.7
cd00381 325 IMPDH IMPDH: The catalytic domain of the inosine m 93.69
PLN02417280 dihydrodipicolinate synthase 93.68
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 93.67
cd08210 364 RLP_RrRLP Ribulose bisphosphate carboxylase like p 93.64
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 93.58
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 93.55
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase, eu 93.53
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 93.51
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 93.47
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 93.46
cd00405203 PRAI Phosphoribosylanthranilate isomerase (PRAI) c 93.44
PF01116287 F_bP_aldolase: Fructose-bisphosphate aldolase clas 93.43
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (Na 93.41
TIGR03249 296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 93.4
TIGR00683 290 nanA N-acetylneuraminate lyase. N-acetylneuraminat 93.4
PRK14041 467 oxaloacetate decarboxylase; Provisional 93.35
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin 93.35
COG0646311 MetH Methionine synthase I (cobalamin-dependent), 93.24
PTZ00314495 inosine-5'-monophosphate dehydrogenase; Provisiona 93.17
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl 93.17
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 93.14
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 93.13
TIGR00035 229 asp_race aspartate racemase. 93.1
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 93.1
PRK08649368 inosine 5-monophosphate dehydrogenase; Validated 93.09
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 93.07
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN 93.06
COG3473238 Maleate cis-trans isomerase [Secondary metabolites 93.03
TIGR01303475 IMP_DH_rel_1 IMP dehydrogenase family protein. Thi 92.99
PF00290259 Trp_syntA: Tryptophan synthase alpha chain; InterP 92.97
PRK03620 303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 92.93
PF01207 309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 92.92
PRK10558256 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Pro 92.92
TIGR00222263 panB 3-methyl-2-oxobutanoate hydroxymethyltransfer 92.91
PRK08318 420 dihydropyrimidine dehydrogenase subunit B; Validat 92.91
TIGR01361260 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate 92.89
TIGR02127261 pyrF_sub2 orotidine 5'-phosphate decarboxylase, su 92.77
cd07937275 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcar 92.76
COG2070 336 Dioxygenases related to 2-nitropropane dioxygenase 92.69
PLN02417 280 dihydrodipicolinate synthase 92.66
TIGR01304369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 92.66
PLN02424332 ketopantoate hydroxymethyltransferase 92.66
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 92.64
PRK09197350 fructose-bisphosphate aldolase; Provisional 92.6
PLN028581378 fructose-bisphosphate aldolase 92.6
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldol 92.53
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 92.53
PRK13523337 NADPH dehydrogenase NamA; Provisional 92.52
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 92.47
TIGR03217333 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase. 92.45
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c 92.42
PRK07226267 fructose-bisphosphate aldolase; Provisional 92.38
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 92.29
PF01487224 DHquinase_I: Type I 3-dehydroquinase; InterPro: IP 92.26
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 92.23
PRK12331 448 oxaloacetate decarboxylase; Provisional 92.1
PF02581180 TMP-TENI: Thiamine monophosphate synthase/TENI; In 92.09
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d 92.09
PF00478352 IMPDH: IMP dehydrogenase / GMP reductase domain; I 92.09
cd07944266 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase- 92.03
TIGR00343 287 pyridoxal 5'-phosphate synthase, synthase subunit 92.01
PF02574305 S-methyl_trans: Homocysteine S-methyltransferase; 92.01
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of 92.0
PRK10128267 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional 91.84
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also 91.83
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 91.64
PLN02617538 imidazole glycerol phosphate synthase hisHF 91.61
PRK06806281 fructose-bisphosphate aldolase; Provisional 91.6
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Ca 91.59
cd00453340 FTBP_aldolase_II Fructose/tagarose-bisphosphate al 91.57
PRK05096346 guanosine 5'-monophosphate oxidoreductase; Provisi 91.55
TIGR00284 499 dihydropteroate synthase-related protein. This pro 91.54
TIGR01302450 IMP_dehydrog inosine-5'-monophosphate dehydrogenas 91.53
PRK05286344 dihydroorotate dehydrogenase 2; Reviewed 91.52
PRK15063428 isocitrate lyase; Provisional 91.48
PF00682237 HMGL-like: HMGL-like of this family is not conserv 91.42
PRK08195337 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic ac 91.23
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 91.13
CHL00162267 thiG thiamin biosynthesis protein G; Validated 91.09
PRK00230230 orotidine 5'-phosphate decarboxylase; Reviewed 91.08
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 91.06
PF04551 359 GcpE: GcpE protein; InterPro: IPR004588 This prote 90.98
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 90.98
PLN02591250 tryptophan synthase 90.97
PRK03620303 5-dehydro-4-deoxyglucarate dehydratase; Provisiona 90.96
cd08205367 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase l 90.95
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 90.9
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind 90.88
TIGR00126211 deoC deoxyribose-phosphate aldolase. Deoxyribose-p 90.83
TIGR02082 1178 metH 5-methyltetrahydrofolate--homocysteine methyl 90.73
TIGR00735254 hisF imidazoleglycerol phosphate synthase, cyclase 90.71
PRK12858340 tagatose 1,6-diphosphate aldolase; Reviewed 90.69
COG0284240 PyrF Orotidine-5'-phosphate decarboxylase [Nucleot 90.6
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN 90.53
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-deh 90.49
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthes 90.46
PRK12595360 bifunctional 3-deoxy-7-phosphoheptulonate synthase 90.42
TIGR01304 369 IMP_DH_rel_2 IMP dehydrogenase family protein. Thi 90.37
PRK02083253 imidazole glycerol phosphate synthase subunit HisF 90.34
TIGR00693196 thiE thiamine-phosphate pyrophosphorylase. This mo 90.33
PRK00865 261 glutamate racemase; Provisional 90.29
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN 90.2
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin 90.2
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 90.2
PRK14041 467 oxaloacetate decarboxylase; Provisional 90.13
PRK12581 468 oxaloacetate decarboxylase; Provisional 90.11
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 90.08
PRK15452 443 putative protease; Provisional 90.01
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin 90.0
PRK13523337 NADPH dehydrogenase NamA; Provisional 90.0
PRK11197381 lldD L-lactate dehydrogenase; Provisional 89.98
TIGR01362258 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase. 89.93
TIGR01520357 FruBisAldo_II_A fructose-bisphosphate aldolase, cl 89.91
PRK09282 592 pyruvate carboxylase subunit B; Validated 89.89
PLN02535364 glycolate oxidase 89.87
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl 89.8
PRK05567486 inosine 5'-monophosphate dehydrogenase; Reviewed 89.78
PF01207309 Dus: Dihydrouridine synthase (Dus); InterPro: IPR0 89.65
TIGR02660365 nifV_homocitr homocitrate synthase NifV. This fami 89.56
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phospha 89.52
PRK13396352 3-deoxy-7-phosphoheptulonate synthase; Provisional 89.49
PRK09283323 delta-aminolevulinic acid dehydratase; Validated 89.36
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 89.24
PRK06843404 inosine 5-monophosphate dehydrogenase; Validated 89.18
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di 89.16
PRK10605362 N-ethylmaleimide reductase; Provisional 89.1
cd00502225 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinat 89.09
cd00953279 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolas 89.04
PF07302221 AroM: AroM protein; InterPro: IPR010843 This famil 88.98
TIGR01740213 pyrF orotidine 5'-phosphate decarboxylase, subfami 88.95
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 88.88
PRK00125278 pyrF orotidine 5'-phosphate decarboxylase; Reviewe 88.79
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 88.77
COG1954181 GlpP Glycerol-3-phosphate responsive antiterminato 88.77
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like 88.75
PF03060330 NMO: Nitronate monooxygenase; InterPro: IPR004136 88.7
PLN02495 385 oxidoreductase, acting on the CH-CH group of donor 88.66
PRK07807479 inosine 5-monophosphate dehydrogenase; Validated 88.66
TIGR01108 582 oadA oxaloacetate decarboxylase alpha subunit. Thi 88.64
TIGR00067 251 glut_race glutamate racemase. The most closely rel 88.58
TIGR03239249 GarL 2-dehydro-3-deoxyglucarate aldolase. In E. co 88.41
TIGR02708367 L_lactate_ox L-lactate oxidase. Members of this pr 88.33
cd07941273 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 88.23
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid t 88.14
PRK05437352 isopentenyl pyrophosphate isomerase; Provisional 88.05
TIGR02129253 hisA_euk phosphoribosylformimino-5-aminoimidazole 88.03
PRK00915 513 2-isopropylmalate synthase; Validated 87.98
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 87.9
PLN02746347 hydroxymethylglutaryl-CoA lyase 87.74
COG0821 361 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphat 87.6
PRK12999 1146 pyruvate carboxylase; Reviewed 87.5
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase, ba 87.49
cd04823320 ALAD_PBGS_aspartate_rich Porphobilinogen synthase 87.32
TIGR02311249 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldola 87.32
PRK09250348 fructose-bisphosphate aldolase; Provisional 87.21
TIGR01521 347 FruBisAldo_II_B fructose-bisphosphate aldolase, cl 87.19
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisi 86.94
PRK15108345 biotin synthase; Provisional 86.92
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom 86.9
PRK08185283 hypothetical protein; Provisional 86.69
TIGR02090 363 LEU1_arch isopropylmalate/citramalate/homocitrate 86.59
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 86.57
cd00946 345 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bis 86.54
cd00384314 ALAD_PBGS Porphobilinogen synthase (PBGS), which i 86.46
PRK10605362 N-ethylmaleimide reductase; Provisional 86.42
PRK14040 593 oxaloacetate decarboxylase; Provisional 86.33
TIGR01859282 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, 86.24
TIGR00259 257 thylakoid_BtpA membrane complex biogenesis protein 86.18
TIGR01182204 eda Entner-Doudoroff aldolase. 2-deydro-3-deoxypho 86.16
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 86.13
TIGR02151333 IPP_isom_2 isopentenyl-diphosphate delta-isomerase 86.09
PRK08227264 autoinducer 2 aldolase; Validated 85.96
PRK07475 245 hypothetical protein; Provisional 85.89
PF00490324 ALAD: Delta-aminolevulinic acid dehydratase; Inter 85.79
PRK07107502 inosine 5-monophosphate dehydrogenase; Validated 85.57
PRK13399 347 fructose-1,6-bisphosphate aldolase; Provisional 85.44
COG5564276 Predicted TIM-barrel enzyme, possibly a dioxygenas 85.39
PRK06015201 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 85.32
PRK00507221 deoxyribose-phosphate aldolase; Provisional 85.29
TIGR01496257 DHPS dihydropteroate synthase. This model represen 85.06
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 84.88
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 84.82
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 84.77
COG0113 330 HemB Delta-aminolevulinic acid dehydratase [Coenzy 84.67
PRK11858 378 aksA trans-homoaconitate synthase; Reviewed 84.64
TIGR00977 526 LeuA_rel 2-isopropylmalate synthase/homocitrate sy 84.61
TIGR02660 365 nifV_homocitr homocitrate synthase NifV. This fami 84.6
PRK08673335 3-deoxy-7-phosphoheptulonate synthase; Reviewed 84.53
PRK13397250 3-deoxy-7-phosphoheptulonate synthase; Provisional 84.51
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 84.43
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosom 84.4
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the 84.36
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of 84.33
cd07948262 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate s 84.2
TIGR00677281 fadh2_euk methylenetetrahydrofolate reductase, euk 84.18
cd04722200 TIM_phosphate_binding TIM barrel proteins share a 83.98
PF00490 324 ALAD: Delta-aminolevulinic acid dehydratase; Inter 83.92
PRK07709285 fructose-bisphosphate aldolase; Provisional 83.92
TIGR01163210 rpe ribulose-phosphate 3-epimerase. This family co 83.77
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 83.75
PRK09490 1229 metH B12-dependent methionine synthase; Provisiona 83.71
PRK11572248 copper homeostasis protein CutC; Provisional 83.54
PTZ00413398 lipoate synthase; Provisional 83.49
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding 83.34
PF01177 216 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro 83.25
PRK05692287 hydroxymethylglutaryl-CoA lyase; Provisional 83.21
TIGR00262256 trpA tryptophan synthase, alpha subunit. Tryptopha 83.2
PRK08999312 hypothetical protein; Provisional 83.19
cd04824320 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthas 83.17
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 83.06
cd08207 406 RLP_NonPhot Ribulose bisphosphate carboxylase like 82.89
PRK05198264 2-dehydro-3-deoxyphosphooctonate aldolase; Provisi 82.84
TIGR01919243 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy 82.76
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synt 82.7
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 82.69
PRK00366 360 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate s 82.66
PRK08508279 biotin synthase; Provisional 82.66
PF03437 254 BtpA: BtpA family; InterPro: IPR005137 Photosystem 82.59
PRK07998283 gatY putative fructose-1,6-bisphosphate aldolase; 82.49
PF01136 233 Peptidase_U32: Peptidase family U32 This is family 82.4
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 82.39
cd03315265 MLE_like Muconate lactonizing enzyme (MLE) like su 82.33
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 82.32
PLN02489335 homocysteine S-methyltransferase 82.32
PRK14114241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met 82.22
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-ph 82.18
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 82.17
PRK10481224 hypothetical protein; Provisional 82.09
TIGR03326 412 rubisco_III ribulose bisphosphate carboxylase, typ 82.06
PRK13384322 delta-aminolevulinic acid dehydratase; Provisional 82.04
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. T 81.96
TIGR03332 407 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosp 81.83
TIGR01093228 aroD 3-dehydroquinate dehydratase, type I. Type II 81.78
PF01791236 DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 81.55
cd08209 391 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopent 81.53
cd03316357 MR_like Mandelate racemase (MR)-like subfamily of 81.32
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN 81.3
PRK13384 322 delta-aminolevulinic acid dehydratase; Provisional 81.29
COG2185143 Sbm Methylmalonyl-CoA mutase, C-terminal domain/su 81.19
cd04725216 OMP_decarboxylase_like Orotidine 5'-phosphate deca 81.14
PLN02979366 glycolate oxidase 80.98
cd08148 366 RuBisCO_large Ribulose bisphosphate carboxylase la 80.88
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN 80.84
PRK13753 279 dihydropteroate synthase; Provisional 80.5
PF02548 261 Pantoate_transf: Ketopantoate hydroxymethyltransfe 80.49
TIGR03586 327 PseI pseudaminic acid synthase. 80.43
PRK09283 323 delta-aminolevulinic acid dehydratase; Validated 80.34
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carb 80.29
PRK09490 1229 metH B12-dependent methionine synthase; Provisiona 80.12
PRK07360371 FO synthase subunit 2; Reviewed 80.08
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding dom 80.07
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information 
Probab=100.00  E-value=7.3e-81  Score=591.26  Aligned_cols=236  Identities=86%  Similarity=1.337  Sum_probs=226.2

Q ss_pred             ccCCCCCCCCCCCCCCCCCCcCCHHHHHHhhhCCCcEEEEecCCHHHHHHHHHcCCcEEEECchhhhhhccCCCCccCCH
Q 022677           58 MSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITL  137 (293)
Q Consensus        58 ~s~~~~~~~~~~~~~~~~~~~~t~~~Lr~l~~~g~pi~m~tayD~~SAriae~AG~DailvGdSla~~~lG~~dt~~vtl  137 (293)
                      +|+.|+.++|+.+.++.+.+|+|+.+|+++|++|+||+|+|||||+||+++|++|+|+||||||++|++|||+||.+||+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~k~ti~~l~~~k~~g~kivmlTAyD~~sA~i~d~aGvD~ILVGDSlgmv~lG~~~T~~Vtl   80 (332)
T PLN02424          1 MSNLPEDTVYGGPKPQNPAQRVTLRTLRQKYRRGEPITMVTAYDYPSAVHVDSAGIDVCLVGDSAAMVVHGHDTTLPITL   80 (332)
T ss_pred             CCCCCcccccCCCCcccCCCCcCHHHHHHHHhCCCcEEEEecCCHHHHHHHHHcCCCEEEECCcHHHHhcCCCCCCCcCH
Confidence            57788889999887766667899999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHcccCCCeEEeeCCCCCCCCCHHHHHHHHHHHHHHhCCCEEEeCCCCCCcHHHHHHHHHcCCcEEEeccc
Q 022677          138 EEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGL  217 (293)
Q Consensus       138 ~eml~h~raV~Ra~~~p~vvaDmpfGsy~~s~e~av~~A~rl~keaGa~gVkiEgg~~~~~~~ikal~~~GIpV~GHiGL  217 (293)
                      |||++|+++|+|++++||+++|||||||+.|++++++||.|+|+++||++||||||.....++|++|+++||||||||||
T Consensus        81 d~mi~H~~aV~Rga~~a~vVaDmPfgSY~~s~e~av~nA~rl~~eaGa~aVKlEGg~~~~~~~I~~l~~~GIPV~gHiGL  160 (332)
T PLN02424         81 DEMLVHCRAVARGANRPLLVGDLPFGSYESSTDQAVESAVRMLKEGGMDAVKLEGGSPSRVTAAKAIVEAGIAVMGHVGL  160 (332)
T ss_pred             HHHHHHHHHHhccCCCCEEEeCCCCCCCCCCHHHHHHHHHHHHHHhCCcEEEECCCcHHHHHHHHHHHHcCCCEEEeecc
Confidence            99999999999999999999999999999999999999999999999999999999323468899999999999999999


Q ss_pred             cceeeeecCCcccccCCHHHHHHHHHHHHHHHHcCCcEEEecCCCHHHHHHHHHhcCCCEEEeCCCCCCCceeeeC
Q 022677          218 TPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF  293 (293)
Q Consensus       218 tPq~~~~lgGf~vqGrt~~~a~e~l~rA~a~eeAGA~~IvlE~vp~e~a~~It~~l~iPtIGIGaG~~~dGQvLV~  293 (293)
                      |||+++++||||+|||+++++.++++||++||+||||+|||||+|++++++||++++|||||||||++|||||||+
T Consensus       161 tPQs~~~lGGykvqGr~~~~a~~li~dA~ale~AGAf~ivLE~Vp~~la~~It~~l~IPtIGIGAG~~cDGQVLV~  236 (332)
T PLN02424        161 TPQAISVLGGFRPQGRTAESAVKVVETALALQEAGCFAVVLECVPAPVAAAITSALQIPTIGIGAGPFCSGQVLVY  236 (332)
T ss_pred             cceeehhhcCccccCCCHHHHHHHHHHHHHHHHcCCcEEEEcCCcHHHHHHHHHhCCCCEEeecCCCCCCceeEeH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999996

>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>COG0413 PanB Ketopantoate hydroxymethyltransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>KOG2949 consensus Ketopantoate hydroxymethyltransferase [Coenzyme transport and metabolism] Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PRK15063 isocitrate lyase; Provisional Back     alignment and domain information
>TIGR01346 isocit_lyase isocitrate lyase Back     alignment and domain information
>COG2224 AceA Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>PRK06498 isocitrate lyase; Provisional Back     alignment and domain information
>KOG1260 consensus Isocitrate lyase [Energy production and conversion] Back     alignment and domain information
>PLN02892 isocitrate lyase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PF00463 ICL: Isocitrate lyase family; InterPro: IPR000918 Isocitrate lyase (4 Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK06801 hypothetical protein; Provisional Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd00945 Aldolase_Class_I Class I aldolases Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>PF09370 TIM-br_sig_trns: TIM-barrel signal transduction protein; InterPro: IPR009215 Members of this family are predicted to have a TIM barrel fold, based on PSI-BLAST analysis (iteration 4) and on SCOP prediction (using SMART) Back     alignment and domain information
>COG2513 PrpB PEP phosphonomutase and related enzymes [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) Back     alignment and domain information
>TIGR02317 prpB methylisocitrate lyase Back     alignment and domain information
>PRK08610 fructose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd00947 TBP_aldolase_IIB Tagatose-1,6-bisphosphate (TBP) aldolase and related Type B Class II aldolases Back     alignment and domain information
>PRK12857 fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>COG0826 Collagenase and related proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00167 cbbA ketose-bisphosphate aldolases Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>PRK07315 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>cd00377 ICL_PEPM Members of the ICL/PEPM enzyme family catalyze either P-C or C-C bond formation/cleavage Back     alignment and domain information
>TIGR02320 PEP_mutase phosphoenolpyruvate phosphomutase Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01858 tag_bisphos_ald class II aldolase, tagatose bisphosphate family Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>PRK12738 kbaY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PRK11320 prpB 2-methylisocitrate lyase; Provisional Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>TIGR02319 CPEP_Pphonmut carboxyvinyl-carboxyphosphonate phosphorylmutase Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK14024 phosphoribosyl isomerase A; Provisional Back     alignment and domain information
>PRK09195 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>PF13714 PEP_mutase: Phosphoenolpyruvate phosphomutase; PDB: 1ZLP_A 3EOO_C 1UJQ_D 1O5Q_A 2DUA_A 2HJP_A 2HRW_A 2QIW_A 3KZ2_B 3IH1_B Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family Back     alignment and domain information
>cd06556 ICL_KPHMT Members of the ICL/PEPM_KPHMT enzyme superfamily catalyze the formation and cleavage of either P-C or C-C bonds Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>cd06557 KPHMT-like Ketopantoate hydroxymethyltransferase (KPHMT) is the first enzyme in the pantothenate biosynthesis pathway Back     alignment and domain information
>PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>TIGR02321 Pphn_pyruv_hyd phosphonopyruvate hydrolase Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water Back     alignment and domain information
>PRK12737 gatY tagatose-bisphosphate aldolase; Reviewed Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00311 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>PRK10550 tRNA-dihydrouridine synthase C; Provisional Back     alignment and domain information
>PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>PF04481 DUF561: Protein of unknown function (DUF561); InterPro: IPR007570 Protein in this entry are of unknown function and are found in cyanobacteria and the chloroplasts of algae Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>TIGR00612 ispG_gcpE 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK08645 bifunctional homocysteine S-methyltransferase/5,10-methylenetetrahydrofolate reductase protein; Reviewed Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>TIGR00674 dapA dihydrodipicolinate synthase Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PRK13111 trpA tryptophan synthase subunit alpha; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK03170 dihydrodipicolinate synthase; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>cd00408 DHDPS-like Dihydrodipicolinate synthase family Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: N-acyl-D-glucosamine 6-phosphate = N-acyl-D-mannosamine 6-phosphate It is probably encoded by the yhcJ gene [] Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK07535 methyltetrahydrofolate:corrinoid/iron-sulfur protein methyltransferase; Validated Back     alignment and domain information
>TIGR00736 nifR3_rel_arch TIM-barrel protein, putative Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02313 HpaI-NOT-DapA 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>PRK07534 methionine synthase I; Validated Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>TIGR00742 yjbN tRNA dihydrouridine synthase A Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK04147 N-acetylneuraminate lyase; Provisional Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>PRK01033 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PLN02489 homocysteine S-methyltransferase Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK14042 pyruvate carboxylase subunit B; Provisional Back     alignment and domain information
>PLN02274 inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>cd00950 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enzyme in lysine biosynthesis Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>PRK05835 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG0434 SgcQ Predicted TIM-barrel enzyme [General function prediction only] Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein Back     alignment and domain information
>PRK02615 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>COG1794 RacX Aspartate racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>PF00701 DHDPS: Dihydrodipicolinate synthetase family; InterPro: IPR002220 Dihydropicolinate synthase (DHDPS) is the key enzyme in lysine biosynthesis via the diaminopimelate pathway of prokaryotes, some phycomycetes and higher plants Back     alignment and domain information
>PRK12330 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK10200 putative racemase; Provisional Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>PRK09485 mmuM homocysteine methyltransferase; Provisional Back     alignment and domain information
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA) Back     alignment and domain information
>PRK07084 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>cd02812 PcrB_like PcrB_like proteins Back     alignment and domain information
>cd00954 NAL N-Acetylneuraminic acid aldolase, also called N-acetylneuraminate lyase (NAL), which catalyses the reversible aldol reaction of N-acetyl-D-mannosamine and pyruvate to give N-acetyl-D-neuraminic acid (D-sialic acid) Back     alignment and domain information
>cd02911 arch_FMN Archeal FMN-binding domain Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>cd08210 RLP_RrRLP Ribulose bisphosphate carboxylase like proteins (RLPs) similar to R Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP) Back     alignment and domain information
>PF01116 F_bP_aldolase: Fructose-bisphosphate aldolase class-II; InterPro: IPR000771 Fructose-bisphosphate aldolase [, ] is a glycolytic enzyme that catalyses the reversible aldol cleavage or condensation of fructose-1,6-bisphosphate into dihydroxyacetone-phosphate and glyceraldehyde 3-phosphate Back     alignment and domain information
>cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>TIGR00683 nanA N-acetylneuraminate lyase Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>COG0646 MetH Methionine synthase I (cobalamin-dependent), methyltransferase domain [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>TIGR00035 asp_race aspartate racemase Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK08649 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain Back     alignment and domain information
>COG3473 Maleate cis-trans isomerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein Back     alignment and domain information
>PF00290 Trp_syntA: Tryptophan synthase alpha chain; InterPro: IPR002028 Tryptophan synthase (4 Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>PRK10558 alpha-dehydro-beta-deoxy-D-glucarate aldolase; Provisional Back     alignment and domain information
>TIGR00222 panB 3-methyl-2-oxobutanoate hydroxymethyltransferase Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>TIGR01361 DAHP_synth_Bsub phospho-2-dehydro-3-deoxyheptonate aldolase Back     alignment and domain information
>TIGR02127 pyrF_sub2 orotidine 5'-phosphate decarboxylase, subfamily 2 Back     alignment and domain information
>cd07937 DRE_TIM_PC_TC_5S Pyruvate carboxylase and Transcarboxylase 5S, carboxyltransferase domain Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>PLN02417 dihydrodipicolinate synthase Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PLN02424 ketopantoate hydroxymethyltransferase Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK09197 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PLN02858 fructose-bisphosphate aldolase Back     alignment and domain information
>cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>TIGR03217 4OH_2_O_val_ald 4-hydroxy-2-oxovalerate aldolase Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>PF01487 DHquinase_I: Type I 3-dehydroquinase; InterPro: IPR001381 3-dehydroquinate dehydratase (4 Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>PRK12331 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PF02581 TMP-TENI: Thiamine monophosphate synthase/TENI; InterPro: IPR003733 Thiamine monophosphate synthase (TMP) (2 Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase Back     alignment and domain information
>cd07944 DRE_TIM_HOA_like 4-hydroxy-2-oxovalerate aldolase-like, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>PF02574 S-methyl_trans: Homocysteine S-methyltransferase; InterPro: IPR003726 S-methylmethionine: homocysteine methyltransferase 2 Back     alignment and domain information
>cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family Back     alignment and domain information
>PRK10128 2-keto-3-deoxy-L-rhamnonate aldolase; Provisional Back     alignment and domain information
>cd00951 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also called 5-keto-4-deoxy-glucarate dehydratase (KDGDH), which is member of dihydrodipicolinate synthase (DHDPS) family that comprises several pyruvate-dependent class I aldolases Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>PLN02617 imidazole glycerol phosphate synthase hisHF Back     alignment and domain information
>PRK06806 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG0800 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00453 FTBP_aldolase_II Fructose/tagarose-bisphosphate aldolase class II Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR00284 dihydropteroate synthase-related protein Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>PRK15063 isocitrate lyase; Provisional Back     alignment and domain information
>PF00682 HMGL-like: HMGL-like of this family is not conserved in other members Back     alignment and domain information
>PRK08195 4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid aldolase,; Validated Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK00230 orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PF04551 GcpE: GcpE protein; InterPro: IPR004588 This protein previously of unknown biochemical function is essential in Escherichia coli Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>PRK03620 5-dehydro-4-deoxyglucarate dehydratase; Provisional Back     alignment and domain information
>cd08205 RuBisCO_IV_RLP Ribulose bisphosphate carboxylase like proteins, Rubisco-Form IV Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain Back     alignment and domain information
>TIGR00126 deoC deoxyribose-phosphate aldolase Back     alignment and domain information
>TIGR02082 metH 5-methyltetrahydrofolate--homocysteine methyltransferase Back     alignment and domain information
>TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit Back     alignment and domain information
>PRK12858 tagatose 1,6-diphosphate aldolase; Reviewed Back     alignment and domain information
>COG0284 PyrF Orotidine-5'-phosphate decarboxylase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 Back     alignment and domain information
>TIGR03249 KdgD 5-dehydro-4-deoxyglucarate dehydratase Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12595 bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismate mutase; Reviewed Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>TIGR00693 thiE thiamine-phosphate pyrophosphorylase Back     alignment and domain information
>PRK00865 glutamate racemase; Provisional Back     alignment and domain information
>cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PRK14041 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>PRK12581 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>PRK15452 putative protease; Provisional Back     alignment and domain information
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain Back     alignment and domain information
>PRK13523 NADPH dehydrogenase NamA; Provisional Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01362 KDO8P_synth 3-deoxy-8-phosphooctulonate synthase Back     alignment and domain information
>TIGR01520 FruBisAldo_II_A fructose-bisphosphate aldolase, class II, yeast/E Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PLN02535 glycolate oxidase Back     alignment and domain information
>cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) Back     alignment and domain information
>PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF01207 Dus: Dihydrouridine synthase (Dus); InterPro: IPR001269 Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa Back     alignment and domain information
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>PRK06843 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>cd00502 DHQase_I Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase Back     alignment and domain information
>cd00953 KDG_aldolase KDG (2-keto-3-deoxygluconate) aldolases found in archaea Back     alignment and domain information
>PF07302 AroM: AroM protein; InterPro: IPR010843 This family consists of several bacterial and archaeal AroM proteins Back     alignment and domain information
>TIGR01740 pyrF orotidine 5'-phosphate decarboxylase, subfamily 1 Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>PRK00125 pyrF orotidine 5'-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK05718 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG1954 GlpP Glycerol-3-phosphate responsive antiterminator (mRNA-binding) [Transcription] Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>PF03060 NMO: Nitronate monooxygenase; InterPro: IPR004136 2-Nitropropane dioxygenase (1 Back     alignment and domain information
>PLN02495 oxidoreductase, acting on the CH-CH group of donors Back     alignment and domain information
>PRK07807 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>TIGR00067 glut_race glutamate racemase Back     alignment and domain information
>TIGR03239 GarL 2-dehydro-3-deoxyglucarate aldolase Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase Back     alignment and domain information
>cd07941 DRE_TIM_LeuA3 Desulfobacterium autotrophicum LeuA3 and related proteins, N-terminal catalytic TIM barrel domain Back     alignment and domain information
>COG0159 TrpA Tryptophan synthase alpha chain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type Back     alignment and domain information
>PRK00915 2-isopropylmalate synthase; Validated Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>PLN02746 hydroxymethylglutaryl-CoA lyase Back     alignment and domain information
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial Back     alignment and domain information
>cd04823 ALAD_PBGS_aspartate_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>TIGR02311 HpaI 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase Back     alignment and domain information
>PRK09250 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01521 FruBisAldo_II_B fructose-bisphosphate aldolase, class II, Calvin cycle subtype Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK15108 biotin synthase; Provisional Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>PRK08185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00946 FBP_aldolase_IIA Class II Type A, Fructose-1,6-bisphosphate (FBP) aldolases Back     alignment and domain information
>cd00384 ALAD_PBGS Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK10605 N-ethylmaleimide reductase; Provisional Back     alignment and domain information
>PRK14040 oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>TIGR01859 fruc_bis_ald_ fructose-1,6-bisphosphate aldolase, class II, various bacterial and amitochondriate protist Back     alignment and domain information
>TIGR00259 thylakoid_BtpA membrane complex biogenesis protein, BtpA family Back     alignment and domain information
>TIGR01182 eda Entner-Doudoroff aldolase Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>PRK08227 autoinducer 2 aldolase; Validated Back     alignment and domain information
>PRK07475 hypothetical protein; Provisional Back     alignment and domain information
>PF00490 ALAD: Delta-aminolevulinic acid dehydratase; InterPro: IPR001731 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>PRK07107 inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13399 fructose-1,6-bisphosphate aldolase; Provisional Back     alignment and domain information
>COG5564 Predicted TIM-barrel enzyme, possibly a dioxygenase [General function prediction only] Back     alignment and domain information
>PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK00507 deoxyribose-phosphate aldolase; Provisional Back     alignment and domain information
>TIGR01496 DHPS dihydropteroate synthase Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>COG0113 HemB Delta-aminolevulinic acid dehydratase [Coenzyme metabolism] Back     alignment and domain information
>PRK11858 aksA trans-homoaconitate synthase; Reviewed Back     alignment and domain information
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein Back     alignment and domain information
>TIGR02660 nifV_homocitr homocitrate synthase NifV Back     alignment and domain information
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed Back     alignment and domain information
>PRK13397 3-deoxy-7-phosphoheptulonate synthase; Provisional Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>cd07948 DRE_TIM_HCS Saccharomyces cerevisiae homocitrate synthase and related proteins, catalytic TIM barrel domain Back     alignment and domain information
>TIGR00677 fadh2_euk methylenetetrahydrofolate reductase, eukaryotic type Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PF00490 ALAD: Delta-aminolevulinic acid dehydratase; InterPro: IPR001731 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway [] Back     alignment and domain information
>PRK07709 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>TIGR01163 rpe ribulose-phosphate 3-epimerase Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information
>PRK11572 copper homeostasis protein CutC; Provisional Back     alignment and domain information
>PTZ00413 lipoate synthase; Provisional Back     alignment and domain information
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain Back     alignment and domain information
>PF01177 Asp_Glu_race: Asp/Glu/Hydantoin racemase; InterPro: IPR015942 This entry represents a group of related proteins that includes aspartate racemase, glutamate racemase, hydantoin racemase and arylmalonate decarboxylase Back     alignment and domain information
>PRK05692 hydroxymethylglutaryl-CoA lyase; Provisional Back     alignment and domain information
>TIGR00262 trpA tryptophan synthase, alpha subunit Back     alignment and domain information
>PRK08999 hypothetical protein; Provisional Back     alignment and domain information
>cd04824 eu_ALAD_PBGS_cysteine_rich Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the biosynthesis of tetrapyrroles, such as heme, vitamin B12 and chlorophyll Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>cd08207 RLP_NonPhot Ribulose bisphosphate carboxylase like proteins from nonphototrophic bacteria Back     alignment and domain information
>PRK05198 2-dehydro-3-deoxyphosphooctonate aldolase; Provisional Back     alignment and domain information
>TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase Back     alignment and domain information
>cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information
>PRK00366 ispG 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Reviewed Back     alignment and domain information
>PRK08508 biotin synthase; Provisional Back     alignment and domain information
>PF03437 BtpA: BtpA family; InterPro: IPR005137 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane Back     alignment and domain information
>PRK07998 gatY putative fructose-1,6-bisphosphate aldolase; Reviewed Back     alignment and domain information
>PF01136 Peptidase_U32: Peptidase family U32 This is family U32 in the peptidase classification Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>cd03315 MLE_like Muconate lactonizing enzyme (MLE) like subgroup of the enolase superfamily Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PLN02489 homocysteine S-methyltransferase Back     alignment and domain information
>PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK10481 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03326 rubisco_III ribulose bisphosphate carboxylase, type III Back     alignment and domain information
>PRK13384 delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ Back     alignment and domain information
>TIGR03332 salvage_mtnW 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>TIGR01093 aroD 3-dehydroquinate dehydratase, type I Back     alignment and domain information
>PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism Back     alignment and domain information
>cd08209 RLP_DK-MTP-1-P-enolase 2,3-diketo-5-methylthiopentyl-1-phosphate enolase Back     alignment and domain information
>cd03316 MR_like Mandelate racemase (MR)-like subfamily of the enolase superfamily Back     alignment and domain information
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4 Back     alignment and domain information
>PRK13384 delta-aminolevulinic acid dehydratase; Provisional Back     alignment and domain information
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism] Back     alignment and domain information
>cd04725 OMP_decarboxylase_like Orotidine 5'-phosphate decarboxylase (ODCase) is a dimeric enzyme that decarboxylates orotidine 5'-monophosphate (OMP) to form uridine 5'-phosphate (UMP), an essential step in the pyrimidine biosynthetic pathway Back     alignment and domain information
>PLN02979 glycolate oxidase Back     alignment and domain information
>cd08148 RuBisCO_large Ribulose bisphosphate carboxylase large chain Back     alignment and domain information
>cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 Back     alignment and domain information
>PRK13753 dihydropteroate synthase; Provisional Back     alignment and domain information
>PF02548 Pantoate_transf: Ketopantoate hydroxymethyltransferase; InterPro: IPR003700 The panB gene from Escherichia coli encodes the first enzyme of the pantothenate biosynthesis pathway, ketopantoate hydroxymethyltransferase (KPHMT) 2 Back     alignment and domain information
>TIGR03586 PseI pseudaminic acid synthase Back     alignment and domain information
>PRK09283 delta-aminolevulinic acid dehydratase; Validated Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09490 metH B12-dependent methionine synthase; Provisional Back     alignment and domain information
>PRK07360 FO synthase subunit 2; Reviewed Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query293
1oy0_A281 The Crystal Structure Of The First Enzyme Of Pantot 1e-49
3ez4_A269 Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydrox 1e-39
3vav_A275 Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydrox 2e-39
1m3u_A264 Crystal Structure Of Ketopantoate Hydroxymethyltran 7e-36
1o66_A275 Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydrox 3e-30
>pdb|1OY0|A Chain A, The Crystal Structure Of The First Enzyme Of Pantothenate Biosynthetic Pathway, Ketopantoate Hydroxymethyltransferase From Mycobacterium Tuberculosis Shows A Decameric Assembly And Terminal Helix-Swapping Length = 281 Back     alignment and structure 
Iteration: 1

 Score =  192 bits (489), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/233 (44%), Positives = 144/233 (61%), Gaps = 6/233 (2%)
Query: 61  IPENSVYGGPKP--QNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLV 118
           + E ++YG   P    P  ++   HL++   +G    M+TAYDY +A   D AGI + LV
Sbjct: 1   MSEQTIYGANTPGGSGPRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLV 60
Query: 119 GDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVR 178
           GDSAA VV+G+DTT+PI+++E++   R V RGA   L+V DLPFG+YE+    A+  A R
Sbjct: 61  GDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATR 120
Query: 179 ILKEGGMDAIKLEGGSPSRITAARG-IVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTS 237
            LK+GG  A+KLEGG   R+      +  AGI VM H+G TPQ+++ LGGFR QG+   +
Sbjct: 121 FLKDGGAHAVKLEGG--ERVAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRG-DA 177
Query: 238 AVKVVETALALQEVGCFSVVLECXXXXXXXXXTSALQIPTIGIGAGPFCSGQV 290
           A + +  A+A+ E G F+VV+E          T  L IPT+GIGAGP C GQV
Sbjct: 178 AEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQV 230
>pdb|3EZ4|A Chain A, Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydroxymethyltransferase From Burkholderia Pseudomallei Length = 269 Back     alignment and structure
>pdb|3VAV|A Chain A, Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydroxymethyltransferase From Burkholderia Thailandensis Length = 275 Back     alignment and structure
>pdb|1M3U|A Chain A, Crystal Structure Of Ketopantoate Hydroxymethyltransferase Complexed The Product Ketopantoate Length = 264 Back     alignment and structure
>pdb|1O66|A Chain A, Crystal Structure Of 3-Methyl-2-Oxobutanoate Hydroxymethyltransferase Length = 275 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query293
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 1e-126
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 1e-113
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 1e-112
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 1e-111
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 5e-05
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 8e-05
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 1e-04
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 1e-04
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 7e-04
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Length = 281 Back     alignment and structure
 Score =  361 bits (929), Expect = e-126
 Identities = 106/232 (45%), Positives = 146/232 (62%), Gaps = 4/232 (1%)

Query: 61  IPENSVYGGPKP--QNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLV 118
           + E ++YG   P    P  ++   HL++   +G    M+TAYDY +A   D AGI + LV
Sbjct: 1   MSEQTIYGANTPGGSGPRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLV 60

Query: 119 GDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVR 178
           GDSAA VV+G+DTT+PI+++E++   R V RGA   L+V DLPFG+YE+    A+  A R
Sbjct: 61  GDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATR 120

Query: 179 ILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSA 238
            LK+GG  A+KLEGG          +  AGI VM H+G TPQ+++ LGGFR QG+   +A
Sbjct: 121 FLKDGGAHAVKLEGGER-VAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRG-DAA 178

Query: 239 VKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQV 290
            + +  A+A+ E G F+VV+E VP  +A   T  L IPT+GIGAGP C GQV
Sbjct: 179 EQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQV 230
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} PDB: 3ez4_A Length = 275 Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Length = 264 Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Length = 275 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} Length = 298 Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Length = 255 Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Length = 287 Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Length = 295 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query293
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 100.0
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 100.0
3vav_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 100.0
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 100.0
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 100.0
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 100.0
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 100.0
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 100.0
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 100.0
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 100.0
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 100.0
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 100.0
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 100.0
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 100.0
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 100.0
3eol_A 433 Isocitrate lyase; seattle structural center for in 99.93
1f8m_A 429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 99.93
3i4e_A 439 Isocitrate lyase; structural genomics, seattle str 99.92
3lg3_A 435 Isocitrate lyase; conserved, CD, proteomics eviden 99.91
1dqu_A 538 Isocitrate lyase; beta barrel; 2.80A {Emericella n 99.82
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 97.81
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 97.8
2z6i_A 332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 97.67
2p10_A286 MLL9387 protein; putative phosphonopyruvate hydrol 97.62
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 97.6
1rd5_A262 Tryptophan synthase alpha chain, chloroplast; hydr 97.4
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 97.38
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 97.33
1qo2_A241 Molecule: N-((5-phosphoribosyl)-formimino)-5-amino 97.33
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 97.33
2f6u_A234 GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate sy 97.29
3bo9_A 326 Putative nitroalkan dioxygenase; TM0800, structura 97.29
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 97.26
2w6r_A266 Imidazole glycerol phosphate synthase subunit HISF 97.24
1ujp_A271 Tryptophan synthase alpha chain; riken structural 97.22
3tdn_A247 FLR symmetric alpha-beta TIM barrel; symmetric sup 97.16
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 97.13
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 97.11
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 97.07
3ih1_A305 Methylisocitrate lyase; alpha-beta structure, TIM- 97.07
1viz_A240 PCRB protein homolog; structural genomics, unknown 96.99
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 96.98
3vzx_A228 Heptaprenylglyceryl phosphate synthase; biosynthes 96.84
2y88_A244 Phosphoribosyl isomerase A; aromatic amino acid bi 96.83
3bw2_A 369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 96.78
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 96.76
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 96.73
2gjl_A 328 Hypothetical protein PA1024; 2-nitropropane dioxyg 96.71
3b0p_A350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 96.67
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.66
3w01_A235 Heptaprenylglyceryl phosphate synthase; biosynthes 96.62
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 96.56
1qop_A268 Tryptophan synthase alpha chain; lyase, carbon-oxy 96.53
1wbh_A214 KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} 96.53
3lye_A307 Oxaloacetate acetyl hydrolase; (alpha/beta)8 barre 96.52
3nav_A271 Tryptophan synthase alpha chain; alpha subunit, st 96.48
3fa4_A302 2,3-dimethylmalate lyase; alpha/beta barrel, helix 96.46
3khj_A 361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 96.45
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 96.44
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 96.42
4adt_A297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 96.39
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 96.3
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 96.29
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 96.26
3eoo_A298 Methylisocitrate lyase; seattle structural genomic 96.2
1z41_A338 YQJM, probable NADH-dependent flavin oxidoreductas 96.2
1xg4_A295 Probable methylisocitrate lyase; 2-methylisocitrat 96.16
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 96.12
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 96.1
1y0e_A223 Putative N-acetylmannosamine-6-phosphate 2-epimer; 96.06
1s2w_A295 Phosphoenolpyruvate phosphomutase; phosphonopyruva 96.04
4fo4_A 366 Inosine 5'-monophosphate dehydrogenase; structural 96.03
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 96.0
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 95.94
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 95.89
3b8i_A287 PA4872 oxaloacetate decarboxylase; alpha/beta barr 95.85
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 95.84
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 95.82
3l21_A 304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 95.81
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 95.81
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 95.76
2ze3_A275 DFA0005; organic waste LEFT-OVER decomposition, al 95.75
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 95.69
1mxs_A225 KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate a 95.69
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 95.66
1eep_A404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 95.62
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 95.61
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 95.58
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 95.57
2vc6_A 292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 95.55
1ypf_A336 GMP reductase; GUAC, purines, pyrimidines, nucleos 95.53
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 95.53
2uva_G 2060 Fatty acid synthase beta subunits; fungal, dehydra 95.52
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 95.5
2qiw_A255 PEP phosphonomutase; structural genomics, joint ce 95.48
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 95.44
4fo4_A366 Inosine 5'-monophosphate dehydrogenase; structural 95.44
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 95.41
2c6q_A351 GMP reductase 2; TIM barrel, metal-binding, NADP, 95.4
1jub_A311 Dihydroorotate dehydrogenase A; homodimer, alpha-b 95.39
2ehh_A 294 DHDPS, dihydrodipicolinate synthase; structural ge 95.36
2yxg_A 289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 95.36
1lt8_A 406 Betaine-homocysteine methyltransferase; homocystei 95.36
3qja_A272 IGPS, indole-3-glycerol phosphate synthase; struct 95.34
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 95.33
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 95.28
1eep_A 404 Inosine 5'-monophosphate dehydrogenase; alpha-beta 95.27
3m5v_A 301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 95.24
3cpr_A 304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 95.23
3b0p_A 350 TRNA-dihydrouridine synthase; TIM barrel, oxidored 95.22
2nli_A368 Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid 95.18
2yw3_A207 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox 95.18
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 95.16
2hjp_A290 Phosphonopyruvate hydrolase; phosporus-Ca cleavage 95.13
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 95.09
3r2g_A 361 Inosine 5'-monophosphate dehydrogenase; structural 95.03
1wa3_A205 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, 94.96
3d0c_A 314 Dihydrodipicolinate synthase; lysine biosynthesis, 94.96
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 94.95
3khj_A361 Inosine-5-monophosphate dehydrogenase; enzyme-inhi 94.93
3fkr_A309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 94.9
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 94.86
2nzl_A392 Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G 94.82
1jcn_A514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 94.77
3m5v_A301 DHDPS, dihydrodipicolinate synthase; TIM barrel, c 94.75
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 94.74
1ypf_A 336 GMP reductase; GUAC, purines, pyrimidines, nucleos 94.73
2rfg_A 297 Dihydrodipicolinate synthase; beta barrel, amino-a 94.73
1o5k_A306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 94.7
3daq_A292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 94.7
2yxg_A289 DHDPS, dihydrodipicolinate synthase; MJ0244, TIM b 94.69
3a5f_A 291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 94.67
1p4c_A380 L(+)-mandelate dehydrogenase; TIM barrel, hydroxy 94.67
3eb2_A300 Putative dihydrodipicolinate synthetase; lysine bi 94.65
2ojp_A 292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 94.64
1zlp_A318 PSR132, petal death protein; TIM-barrel, helix swa 94.63
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 94.62
2yci_X271 5-methyltetrahydrofolate corrinoid/iron sulfur PR 94.58
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 94.56
3dz1_A 313 Dihydrodipicolinate synthase; lysine biosynthesis, 94.55
1f76_A336 Dihydroorotate dehydrogenase; monomer, alpha-beta- 94.55
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 94.55
3fkr_A 309 L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL f 94.55
1xky_A 301 Dihydrodipicolinate synthase; TIM barrel, , lysine 94.53
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 94.51
3o07_A291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 94.49
1f6k_A293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 94.48
1o5k_A 306 DHDPS, dihydrodipicolinate synthase; TM1521, struc 94.47
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 94.46
3si9_A 315 DHDPS, dihydrodipicolinate synthase; structural ge 94.46
1kbi_A511 Cytochrome B2, L-LCR; flavocytochrome B2, electron 94.45
1sfl_A238 3-dehydroquinate dehydratase; 3-dehydroquinase, en 94.39
2ehh_A294 DHDPS, dihydrodipicolinate synthase; structural ge 94.34
2r8w_A 332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 94.33
1xky_A301 Dihydrodipicolinate synthase; TIM barrel, , lysine 94.32
3gr7_A340 NADPH dehydrogenase; flavin, FMN, beta-alpha-barre 94.31
3qfe_A 318 Putative dihydrodipicolinate synthase family PROT; 94.29
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 94.27
1gvf_A286 Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; 94.27
3b4u_A 294 Dihydrodipicolinate synthase; structural genomics, 94.26
2qjg_A273 Putative aldolase MJ0400; beta-alpha barrel, lyase 94.25
3o1n_A276 3-dehydroquinate dehydratase; structural genomics, 94.23
2hmc_A 344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 94.22
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 94.22
3cpr_A304 Dihydrodipicolinate synthetase; (beta/alpha)8-barr 94.22
4fxs_A496 Inosine-5'-monophosphate dehydrogenase; structural 94.21
3flu_A 297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 94.2
3ffs_A400 Inosine-5-monophosphate dehydrogenase; beta-alpha 94.2
3s5o_A 307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 94.18
3b4u_A294 Dihydrodipicolinate synthase; structural genomics, 94.18
3d0c_A314 Dihydrodipicolinate synthase; lysine biosynthesis, 94.17
2e6f_A314 Dihydroorotate dehydrogenase; chagas disease, pyri 94.15
2hmc_A344 AGR_L_411P, dihydrodipicolinate synthase; alpha-be 94.12
1vhn_A318 Putative flavin oxidoreducatase; structural genomi 94.11
1vyr_A364 Pentaerythritol tetranitrate reductase; oxidoreduc 94.11
3qfe_A318 Putative dihydrodipicolinate synthase family PROT; 94.09
3na8_A 315 Putative dihydrodipicolinate synthetase; lyase; HE 94.08
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 94.03
3si9_A315 DHDPS, dihydrodipicolinate synthase; structural ge 94.02
3tak_A 291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 94.01
3qze_A 314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 94.0
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 94.0
3na8_A315 Putative dihydrodipicolinate synthetase; lyase; HE 93.99
1gox_A370 (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu 93.98
2r14_A377 Morphinone reductase; H-tunnelling, flavoprotein, 93.95
2vc6_A292 MOSA, dihydrodipicolinate synthase; DHDPS, TIM bar 93.94
3hgj_A349 Chromate reductase; TIM barrel, oxidoreductase; HE 93.94
1o66_A275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 93.92
3tak_A291 DHDPS, dihydrodipicolinate synthase; TIM barrel, l 93.91
3i4e_A439 Isocitrate lyase; structural genomics, seattle str 93.91
2wkj_A303 N-acetylneuraminate lyase; directed evolution, sia 93.84
3e96_A 316 Dihydrodipicolinate synthase; structural genomics, 93.81
3l21_A304 DHDPS, dihydrodipicolinate synthase; DAPA, dimer, 93.8
3qze_A314 DHDPS, dihydrodipicolinate synthase; alpha beta ba 93.79
2rfg_A297 Dihydrodipicolinate synthase; beta barrel, amino-a 93.77
3q94_A288 Fructose-bisphosphate aldolase, class II; structur 93.74
2v9d_A 343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 93.7
4avf_A490 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 93.7
1nvm_A 345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 93.69
2wkj_A 303 N-acetylneuraminate lyase; directed evolution, sia 93.68
1me8_A503 Inosine-5'-monophosphate dehydrogenase; alpha beta 93.64
2gou_A365 Oxidoreductase, FMN-binding; OLD yeallow enzyme, f 93.64
2eq5_A228 228AA long hypothetical hydantoin racemase; struct 93.59
1f6k_A 293 N-acetylneuraminate lyase; beta barrel; 1.60A {Hae 93.57
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 93.52
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 93.51
1jcn_A 514 Inosine monophosphate dehydrogenase I; IMPD, IMPDH 93.51
3r2g_A361 Inosine 5'-monophosphate dehydrogenase; structural 93.5
4af0_A556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 93.47
1mzh_A225 Deoxyribose-phosphate aldolase; alpha-beta barrel, 93.41
2v9d_A343 YAGE; dihydrodipicolinic acid synthase, N-acetyl n 93.4
2r91_A 286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 93.36
3daq_A 292 DHDPS, dihydrodipicolinate synthase; lysine biosyn 93.34
3sgz_A352 Hydroxyacid oxidase 2; flavoprotein, homology, INH 93.34
3txv_A 450 Probable tagatose 6-phosphate kinase; structural g 93.33
3eb2_A 300 Putative dihydrodipicolinate synthetase; lysine bi 93.29
2fiq_A 420 Putative tagatose 6-phosphate kinase 1; structural 93.29
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 93.28
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 93.27
3oa3_A288 Aldolase; structural genomics, seattle structural 93.26
2r91_A286 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM 93.23
3flu_A297 DHDPS, dihydrodipicolinate synthase; TIM barrel, b 93.2
3tfx_A259 Orotidine 5'-phosphate decarboxylase; PSI-biology, 93.16
4djd_D323 C/Fe-SP, corrinoid/iron-sulfur protein small subun 93.12
1oy0_A281 Ketopantoate hydroxymethyltransferase; domain swap 93.08
2r8w_A332 AGR_C_1641P; APC7498, dihydrodipicolinate synthase 93.06
3usb_A511 Inosine-5'-monophosphate dehydrogenase; structural 93.03
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 92.94
1ub3_A220 Aldolase protein; schiff base, deoxyribose phospha 92.91
3sr7_A365 Isopentenyl-diphosphate delta-isomerase; isopenten 92.89
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 92.88
1ep3_A311 Dihydroorotate dehydrogenase B (PYRD subunit); het 92.85
2ojp_A292 DHDPS, dihydrodipicolinate synthase; dimer, lysine 92.85
1w3i_A293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 92.84
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 92.81
2nuw_A288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 92.81
2nuw_A 288 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho a 92.77
3f4w_A211 Putative hexulose 6 phosphate synthase; humps, mal 92.76
2xed_A273 Putative maleate isomerase; nicotinic acid catabol 92.74
1to3_A304 Putative aldolase YIHT; beta-alpha barrel, structu 92.72
3s5o_A307 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; 92.69
2pgw_A 384 Muconate cycloisomerase; enolase superfamily, octa 92.69
2yzr_A 330 Pyridoxal biosynthesis lyase PDXS; redox protein, 92.67
1vs1_A276 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha 92.66
2yr1_A257 3-dehydroquinate dehydratase; amino acid biosynthe 92.65
3dz1_A313 Dihydrodipicolinate synthase; lysine biosynthesis, 92.63
2uv8_G 2051 Fatty acid synthase subunit beta (FAS1); fatty aci 92.62
3a5f_A291 Dihydrodipicolinate synthase; TIM barrel, enzyme, 92.59
1nvm_A345 HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered 92.55
3e96_A316 Dihydrodipicolinate synthase; structural genomics, 92.53
1vrd_A494 Inosine-5'-monophosphate dehydrogenase; TM1347, st 92.43
3h5d_A 311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 92.37
3nl6_A 540 Thiamine biosynthetic bifunctional enzyme; thiamin 92.33
1rvk_A 382 Isomerase/lactonizing enzyme; enolase superfamily, 92.26
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 92.26
2qgy_A 391 Enolase from the environmental genome shotgun sequ 92.26
1pii_A 452 N-(5'phosphoribosyl)anthranilate isomerase; bifunc 92.2
1w3i_A 293 EDA, 2-keto-3-deoxy gluconate aldolase; archaeal m 92.19
1rqb_A 539 Transcarboxylase 5S subunit; TIM-barrel, carbamyla 92.18
2ftp_A302 Hydroxymethylglutaryl-COA lyase; structural genomi 92.1
3vav_A 275 3-methyl-2-oxobutanoate hydroxymethyltransferase; 92.06
1p0k_A349 Isopentenyl-diphosphate delta-isomerase; terpene b 92.03
1mdl_A359 Mandelate racemase; isomerase, mandelate pathway, 92.02
2nv1_A305 Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b 92.01
1q7z_A 566 5-methyltetrahydrofolate S-homocysteine methyltran 92.0
3ajx_A207 3-hexulose-6-phosphate synthase; HPS, OMPDC supraf 91.95
2ovl_A 371 Putative racemase; structural genomics, PSI-2, pro 91.87
2og9_A 393 Mandelate racemase/muconate lactonizing enzyme; NY 91.85
3i65_A415 Dihydroorotate dehydrogenase homolog, mitochondria 91.84
1twd_A256 Copper homeostasis protein CUTC; TIM-like protein, 91.83
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 91.8
1vcf_A332 Isopentenyl-diphosphate delta-isomerase; TIM barre 91.72
2gjl_A328 Hypothetical protein PA1024; 2-nitropropane dioxyg 91.7
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 91.69
3l5l_A363 Xenobiotic reductase A; TIM barrel, oxidoreductase 91.67
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 91.63
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 91.61
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 91.54
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 91.49
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 91.47
2nx9_A 464 Oxaloacetate decarboxylase 2, subunit alpha; carbo 91.44
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 91.41
3eeg_A 325 2-isopropylmalate synthase; 11106D, beta barrel, P 91.41
1vhn_A 318 Putative flavin oxidoreducatase; structural genomi 91.4
2dgd_A223 223AA long hypothetical arylmalonate decarboxylas; 91.39
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 91.35
3qvl_A245 Putative hydantoin racemase; isomerase; HET: 5HY; 91.33
1w8s_A263 FBP aldolase, fructose-bisphosphate aldolase class 91.28
2bdq_A224 Copper homeostasis protein CUTC; alpha beta protei 91.25
1yxy_A234 Putative N-acetylmannosamine-6-phosphate 2-epimer; 91.22
3aty_A379 Tcoye, prostaglandin F2A synthase; alpha/beta barr 91.16
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 91.15
2pp0_A 398 L-talarate/galactarate dehydratase; enolase superf 91.13
2nql_A 388 AGR_PAT_674P, isomerase/lactonizing enzyme; enolas 91.12
3lg3_A435 Isocitrate lyase; conserved, CD, proteomics eviden 91.09
2o56_A 407 Putative mandelate racemase; dehydratase, structur 91.05
1jvn_A555 Glutamine, bifunctional histidine biosynthesis pro 91.03
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 91.03
4dwd_A 393 Mandelate racemase/muconate lactonizing enzyme, C 90.98
3qvl_A 245 Putative hydantoin racemase; isomerase; HET: 5HY; 90.94
3tr9_A314 Dihydropteroate synthase; biosynthesis of cofactor 90.93
2qkf_A280 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; 90.83
3h5d_A311 DHDPS, dihydrodipicolinate synthase; lysine biosyn 90.82
3stp_A 412 Galactonate dehydratase, putative; PSI biology, st 90.78
3s81_A 268 Putative aspartate racemase; structural genomics, 90.75
3bw2_A369 2-nitropropane dioxygenase; TIM barrel, oxidoreduc 90.73
2nwr_A267 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KD 90.67
3kru_A343 NADH:flavin oxidoreductase/NADH oxidase; homotetra 90.66
1thf_D253 HISF protein; thermophIle, TIM-barrel, histidine b 90.62
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 90.62
1eye_A280 DHPS 1, dihydropteroate synthase I; alpha-beta bar 90.62
2qr6_A393 IMP dehydrogenase/GMP reductase; NP_599840.1, G re 90.55
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 90.54
2zsk_A 226 PH1733, 226AA long hypothetical aspartate racemase 90.51
3ojc_A 231 Putative aspartate/glutamate racemase; structural 90.39
1ps9_A 671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 90.32
4dpp_A 360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 90.3
2zbt_A297 Pyridoxal biosynthesis lyase PDXS; pyridoxine bios 90.28
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 90.28
3iwp_A287 Copper homeostasis protein CUTC homolog; conserved 90.28
1f8m_A429 Isocitrate lyase, ICL; alpha-beta barrel, helix-sw 90.23
2zad_A345 Muconate cycloisomerase; muconate lactonizing enzy 90.21
1xm3_A264 Thiazole biosynthesis protein THIG; structural gen 90.21
3eol_A433 Isocitrate lyase; seattle structural center for in 90.2
3ozy_A 389 Putative mandelate racemase; beta-alpha barrel, en 90.1
2ox4_A 403 Putative mandelate racemase; enolase, dehydratase, 90.05
3nvt_A385 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; 90.03
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 89.88
3o07_A 291 Pyridoxine biosynthesis protein SNZ1; (beta/alpha) 89.8
3gka_A361 N-ethylmaleimide reductase; decode biostructures, 89.8
4af0_A 556 Inosine-5'-monophosphate dehydrogenase; oxidoreduc 89.73
2eq5_A 228 228AA long hypothetical hydantoin racemase; struct 89.72
1f6y_A262 5-methyltetrahydrofolate corrinoid/iron sulfur PR 89.69
3ngj_A239 Deoxyribose-phosphate aldolase; lyase, structural 89.67
3sz8_A285 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgci 89.59
1ka9_F252 Imidazole glycerol phosphtate synthase; riken stru 89.56
2gl5_A 410 Putative dehydratase protein; structural genomics, 89.52
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 89.51
3rr1_A 405 GALD, putative D-galactonate dehydratase; enolase, 89.45
4ab4_A362 Xenobiotic reductase B; oxidoreductase, OLD yellow 89.44
3r12_A260 Deoxyribose-phosphate aldolase; TIM beta/alpha-bar 89.29
1o60_A292 2-dehydro-3-deoxyphosphooctonate aldolase; structu 89.22
3o63_A243 Probable thiamine-phosphate pyrophosphorylase; thi 89.01
3ist_A 269 Glutamate racemase; structural genomics, cell WALL 88.93
1jfl_A 228 Aspartate racemase; alpha-beta structure, HOMO-dim 88.87
2oz8_A389 MLL7089 protein; structural genomics, unknown func 88.8
3out_A 268 Glutamate racemase; structural genomics, center fo 88.79
1vr6_A350 Phospho-2-dehydro-3-deoxyheptonate aldolase; TM034 88.77
2pcq_A283 Putative dihydrodipicolinate synthase; lyase, lysi 88.71
2gzm_A 267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 88.65
4hb7_A270 Dihydropteroate synthase; transferase; 1.95A {Stap 88.61
3jr2_A218 Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulon 88.48
3ble_A 337 Citramalate synthase from leptospira interrogans; 88.43
3l5a_A419 NADH/flavin oxidoreductase/NADH oxidase; OLD yello 88.42
3i4k_A 383 Muconate lactonizing enzyme; structural genomics, 88.25
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 88.21
3bjs_A 428 Mandelate racemase/muconate lactonizing enzyme; en 88.13
3ble_A337 Citramalate synthase from leptospira interrogans; 88.13
4gj1_A243 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me 88.09
2qde_A 397 Mandelate racemase/muconate lactonizing enzyme FA 88.07
1m3u_A264 3-methyl-2-oxobutanoate hydroxymethyltransferase; 88.04
1nu5_A 370 Chloromuconate cycloisomerase; enzyme, dehalogenat 88.02
1tzz_A 392 Hypothetical protein L1841; structural genomics, m 87.98
1b73_A 254 Glutamate racemase; isomerase; 2.30A {Aquifex pyro 87.9
3uhf_A 274 Glutamate racemase; structural genomics, center fo 87.88
4e5t_A 404 Mandelate racemase / muconate lactonizing enzyme, 87.77
3rcy_A 433 Mandelate racemase/muconate lactonizing enzyme-LI 87.74
3out_A268 Glutamate racemase; structural genomics, center fo 87.73
2a4a_A281 Deoxyribose-phosphate aldolase; lyase, TIM beta/al 87.64
3k30_A 690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 87.6
2rdx_A379 Mandelate racemase/muconate lactonizing enzyme, P; 87.57
3tsm_A272 IGPS, indole-3-glycerol phosphate synthase; struct 87.57
2z6i_A332 Trans-2-enoyl-ACP reductase II; fatty acid synthes 87.4
3fok_A307 Uncharacterized protein CGL0159; CGL0159 ,brevibac 87.4
1tkk_A 366 Similar to chloromuconate cycloisomerase; epimeras 87.37
2rdx_A 379 Mandelate racemase/muconate lactonizing enzyme, P; 87.32
3tr2_A239 Orotidine 5'-phosphate decarboxylase; purines, pyr 87.31
3vcn_A 425 Mannonate dehydratase; enolase, magnesium binding 87.24
1zco_A262 2-dehydro-3-deoxyphosphoheptonate aldolase; arabin 87.22
1tx2_A297 DHPS, dihydropteroate synthase; folate biosynthesi 87.22
3ceu_A210 Thiamine phosphate pyrophosphorylase; TIM barrel-l 87.18
4e4u_A 412 Mandalate racemase/muconate lactonizing enzyme; ma 87.17
2vp8_A318 Dihydropteroate synthase 2; RV1207 transferase, fo 87.11
2poz_A 392 Putative dehydratase; octamer, structural genomics 87.11
2gdq_A 382 YITF; mandelate racemase/muconate lactonizing enzy 86.98
1zfj_A491 Inosine monophosphate dehydrogenase; IMPDH, CBS do 86.9
2vvt_A 290 Glutamate racemase; isomerase, peptidoglycan synth 86.85
2oho_A 273 Glutamate racemase; isomerase; 2.25A {Streptococcu 86.84
2oz8_A 389 MLL7089 protein; structural genomics, unknown func 86.79
1h1y_A228 D-ribulose-5-phosphate 3-epimerase; oxidative pent 86.78
1tv5_A443 Dhodehase, dihydroorotate dehydrogenase homolog, m 86.7
2qq6_A 410 Mandelate racemase/muconate lactonizing enzyme- li 86.57
2jfq_A 286 Glutamate racemase; cell WALL, isomerase, cell sha 86.56
3bo9_A326 Putative nitroalkan dioxygenase; TM0800, structura 86.54
3kts_A192 Glycerol uptake operon antiterminator regulatory; 86.47
2v82_A212 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; l 86.29
1vc4_A254 Indole-3-glycerol phosphate synthase; lyase, trypt 86.24
1aj0_A282 DHPS, dihydropteroate synthase; antibiotic, resist 86.16
3go2_A 409 Putative L-alanine-DL-glutamate epimerase; structu 86.12
3toy_A383 Mandelate racemase/muconate lactonizing enzyme FA 86.08
1zuw_A272 Glutamate racemase 1; (R)-glutamate, peptidoglycan 85.99
3ldv_A255 Orotidine 5'-phosphate decarboxylase; structural g 85.98
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 85.97
3ij6_A312 Uncharacterized metal-dependent hydrolase; structu 85.88
1zuw_A 272 Glutamate racemase 1; (R)-glutamate, peptidoglycan 85.78
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 85.55
3sjn_A 374 Mandelate racemase/muconate lactonizing protein; e 85.49
1p1x_A260 Deoxyribose-phosphate aldolase; alpha-beta barrel, 85.3
3v3w_A 424 Starvation sensing protein RSPA; enolase, enzyme f 85.25
2jfz_A 255 Glutamate racemase; cell WALL, isomerase, cell sha 85.19
1ydn_A295 Hydroxymethylglutaryl-COA lyase; TIM-barrel protei 84.95
3nur_A357 Amidohydrolase; TIM barrel; 1.75A {Staphylococcus 84.86
4adt_A 297 Pyridoxine biosynthetic enzyme PDX1 homologue, PU; 84.84
1icp_A376 OPR1, 12-oxophytodienoate reductase 1; beta-alpha- 84.75
3ovp_A228 Ribulose-phosphate 3-epimerase; iron binding, isom 84.72
3ru6_A303 Orotidine 5'-phosphate decarboxylase; structural g 84.68
3r4e_A 418 Mandelate racemase/muconate lactonizing enzyme; en 84.47
1vzw_A244 Phosphoribosyl isomerase A; histidine biosynthesis 84.44
2wqp_A349 Polysialic acid capsule biosynthesis protein SIAC; 84.4
2gwg_A350 4-oxalomesaconate hydratase; TIM-barrel like prote 84.38
3lab_A217 Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) 84.29
1h7n_A342 5-aminolaevulinic acid dehydratase; lyase, aldolas 84.24
1sjd_A 368 N-acylamino acid racemase; lyase, isomerase; HET: 84.17
2cw6_A298 Hydroxymethylglutaryl-COA lyase, mitochondrial; HM 84.13
2pcq_A 283 Putative dihydrodipicolinate synthase; lyase, lysi 84.11
1vcv_A226 Probable deoxyribose-phosphate aldolase; DERA, hyp 84.06
3sbf_A 401 Mandelate racemase / muconate lactonizing enzyme; 83.86
2hzg_A 401 Mandelate racemase/muconate lactonizing enzyme/EN 83.83
1ydo_A307 HMG-COA lyase; TIM-barrel protein, structural geno 83.8
2ekc_A 262 AQ_1548, tryptophan synthase alpha chain; structur 83.8
2p8b_A 369 Mandelate racemase/muconate lactonizing enzyme fam 83.74
2gzm_A267 Glutamate racemase; enzyme, isomerase; HET: DGL; 1 83.74
3glc_A295 Aldolase LSRF; TIM barrel, lyase, schiff base; HET 83.68
3k13_A300 5-methyltetrahydrofolate-homocysteine methyltrans; 83.6
2ovl_A371 Putative racemase; structural genomics, PSI-2, pro 83.51
3tml_A288 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 83.5
1l6s_A 323 Porphobilinogen synthase; dehydratase, lyase; HET: 83.45
1w1z_A328 Delta-aminolevulinic acid dehydratase; synthase, t 83.39
3dxi_A320 Putative aldolase; TIM barrel, 11107N, PSI2, NYSGX 83.25
3ndo_A231 Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid 83.24
4ef8_A354 Dihydroorotate dehydrogenase; phenyl isothiocyanat 83.21
4inf_A373 Metal-dependent hydrolase; amidohydrolase, metal b 83.15
2pgw_A384 Muconate cycloisomerase; enolase superfamily, octa 83.11
2hsa_B402 12-oxophytodienoate reductase 3; alpha beta 8 barr 83.09
1eix_A245 Orotidine 5'-monophosphate decarboxylase; alpha-be 83.05
1h5y_A253 HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py 83.02
2h9a_B310 CO dehydrogenase/acetyl-COA synthase, iron- sulfur 82.93
2yyu_A246 Orotidine 5'-phosphate decarboxylase; TIM barrel, 82.85
3ugv_A 390 Enolase; enzyme function initiative, EFI, lyase; 2 82.68
3obk_A 356 Delta-aminolevulinic acid dehydratase; ssgcid, str 82.67
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 82.64
2hxt_A 441 L-fuconate dehydratase; enolase superfamily, D-ery 82.52
3tji_A 422 Mandelate racemase/muconate lactonizing enzyme, N 82.51
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, A 82.23
1vhc_A224 Putative KHG/KDPG aldolase; structural genomics, u 82.21
2czd_A208 Orotidine 5'-phosphate decarboxylase; pyrimidine b 82.05
3fs2_A298 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, 81.99
1r0m_A 375 N-acylamino acid racemase; isomerase; 1.30A {Deino 81.93
3tha_A252 Tryptophan synthase alpha chain; structural genomi 81.91
3tj4_A 372 Mandelate racemase; enolase, dehydratase, enzyme f 81.52
3m47_A228 Orotidine 5'-phosphate decarboxylase; orotidine 5' 81.3
3ewb_X293 2-isopropylmalate synthase; LEUA, structural genom 81.23
3eez_A 378 Putative mandelate racemase/muconate lactonizing e 81.23
3noy_A 366 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; 81.08
2ps2_A 371 Putative mandelate racemase/muconate lactonizing e 80.75
4dpp_A360 DHDPS 2, dihydrodipicolinate synthase 2, chloropla 80.69
2tps_A227 Protein (thiamin phosphate synthase); thiamin bios 80.59
3obk_A356 Delta-aminolevulinic acid dehydratase; ssgcid, str 80.45
3jva_A 354 Dipeptide epimerase; enolase superfamily, isomeras 80.41
3tcs_A 388 Racemase, putative; PSI-biology, nysgrc, structura 80.37
3zwt_A367 Dihydroorotate dehydrogenase (quinone), mitochond; 80.22
2y5s_A294 DHPS, dihydropteroate synthase; transferase, folat 80.18
3oix_A345 Putative dihydroorotate dehydrogenase; dihydrooro 80.17
2dwu_A 276 Glutamate racemase; isomerase; HET: DGL; 1.60A {Ba 80.16
2y88_A 244 Phosphoribosyl isomerase A; aromatic amino acid bi 80.16
3vkj_A368 Isopentenyl-diphosphate delta-isomerase; type 2 is 80.15
1l6s_A323 Porphobilinogen synthase; dehydratase, lyase; HET: 80.13
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
Probab=100.00  E-value=1.9e-77  Score=558.51  Aligned_cols=230  Identities=46%  Similarity=0.770  Sum_probs=196.7

Q ss_pred             hhhcccCCCCCCCCCCCCCCCCCCcCCHHHHHHhhhCCCcEEEEecCCHHHHHHHHHcCCcEEEECchhhhhhccCCCCc
Q 022677           54 LVRCMSNIPENSVYGGPKPQNPNQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTL  133 (293)
Q Consensus        54 ~~~~~s~~~~~~~~~~~~~~~~~~~~t~~~Lr~l~~~g~pi~m~tayD~~SAriae~AG~DailvGdSla~~~lG~~dt~  133 (293)
                      +.||++++|.    |.+    ++||+|+.+|+++|++++||+|+||||++||+++|++|||+|+||||++|++||||||.
T Consensus         4 ~~~~~~~~~~----~~~----~~~~~t~~~lr~~k~~g~~i~~~tayDa~sA~l~e~aG~d~ilvGdSl~~~~lG~~dt~   75 (281)
T 1oy0_A            4 QTIYGANTPG----GSG----PRTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTV   75 (281)
T ss_dssp             ----------------------CCCCCHHHHHHHHHHTCCEEEEECCSHHHHHHHHTTTCCEEEECTTHHHHTTCCSSSS
T ss_pred             ccccCCCCCC----CCC----CCCCcCHHHHHHHHhCCCcEEEEeCcCHHHHHHHHHcCCCEEEECHHHHHHHcCCCCCC
Confidence            3566666554    221    34789999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCHHHHHHHHHHHHcccCCCeEEeeCCCCCCCCCHHHHHHHHHHHHHHhCCCEEEeCCCCCCcHHHHHHHHHcCCcEEE
Q 022677          134 PITLEEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMG  213 (293)
Q Consensus       134 ~vtl~eml~h~raV~Ra~~~p~vvaDmpfGsy~~s~e~av~~A~rl~keaGa~gVkiEgg~~~~~~~ikal~~~GIpV~G  213 (293)
                      ++|+|||++|+++|+|++++|||++|||||||+.|++++++|+.|+++|+||++||||||.+ ..+.|++++++||||||
T Consensus        76 ~vTldemi~h~~aV~r~~~~~~vvaD~pfgsy~~s~~~a~~na~rl~~eaGa~aVklEdg~e-~~~~I~al~~agIpV~g  154 (281)
T 1oy0_A           76 PISIDELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGGER-VAEQIACLTAAGIPVMA  154 (281)
T ss_dssp             SCCGGGTHHHHHHHHHHCTTSEEEEECCTTSSTTCHHHHHHHHHHHHHTTCCSEEEEEBSGG-GHHHHHHHHHHTCCEEE
T ss_pred             CCCHHHHHHHHHHHHhcCCCCeEEEECCCCcccCCHHHHHHHHHHHHHHhCCeEEEECCcHH-HHHHHHHHHHCCCCEEe
Confidence            99999999999999999999999999999999889999999999999989999999999975 57789999999999999


Q ss_pred             eccccceeeeecCCcccccCCHHHHHHHHHHHHHHHHcCCcEEEecCCCHHHHHHHHHhcCCCEEEeCCCCCCCceeeeC
Q 022677          214 HVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF  293 (293)
Q Consensus       214 HiGLtPq~~~~lgGf~vqGrt~~~a~e~l~rA~a~eeAGA~~IvlE~vp~e~a~~It~~l~iPtIGIGaG~~~dGQvLV~  293 (293)
                      |+|||||+.+++|||++||||+ +++++++||++|+|||||+||+||+|++++++|++++++||||||||++|||||||+
T Consensus       155 HiGLtPqsv~~~ggf~v~grt~-~a~~~i~rA~a~~eAGA~~ivlE~vp~~~a~~it~~l~iP~igIGaG~~~dgQvLV~  233 (281)
T 1oy0_A          155 HIGFTPQSVNTLGGFRVQGRGD-AAEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVW  233 (281)
T ss_dssp             EEECCC--------------CH-HHHHHHHHHHHHHHHTCSEEEEESCCHHHHHHHHHHCSSCEEEESSCSCSSEEEECH
T ss_pred             eecCCcceecccCCeEEEeCcH-HHHHHHHHHHHHHHcCCcEEEEecCCHHHHHHHHHhCCCCEEEeCCCCCCCcceeeH
Confidence            9999999999999999999999 999999999999999999999999999999999999999999999999999999995
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>1dqu_A Isocitrate lyase; beta barrel; 2.80A {Emericella nidulans} SCOP: c.1.12.7 Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol-PHOS lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2f6u_A GGGPS, (S)-3-O-geranylgeranylglyceryl phosphate synthase; non-canonical TIM-barrel, prenyltransferase, archaeal lipid synthesis, dimer; HET: CIT; 1.55A {Archaeoglobus fulgidus} SCOP: c.1.4.1 PDB: 2f6x_A* Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} Back     alignment and structure
>1ujp_A Tryptophan synthase alpha chain; riken structural genomics/P initiative, RSGI, structural genomics, lyase; HET: CIT; 1.34A {Thermus thermophilus} SCOP: c.1.2.4 PDB: 1wxj_A* Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>1viz_A PCRB protein homolog; structural genomics, unknown function; 1.85A {Bacillus subtilis} SCOP: c.1.4.1 Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>3vzx_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; 1.54A {Bacillus subtilis} PDB: 3vzy_A* 3vzz_A* 3w00_A* 1viz_A Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>3w01_A Heptaprenylglyceryl phosphate synthase; biosynthesis, prenyltransferases, enzyme catalysis, transfer; HET: PGE; 1.54A {Staphylococcus aureus} PDB: 3w02_A Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1qop_A Tryptophan synthase alpha chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.1.2.4 PDB: 1k8x_A* 1wbj_A* 2clk_A* 2j9z_A* 3cep_A* 1k8y_A* 1a5s_A* 1a50_A* 1c29_A* 1c8v_A* 1c9d_A* 1bks_A* 1cx9_A* 1fuy_A* 1cw2_A* 1k7e_A* 1k7f_A* 1k7x_A* 1k3u_A* 1k8z_A* ... Back     alignment and structure
>1wbh_A KHG/KDPG aldolase; lyase; 1.55A {Escherichia coli} SCOP: c.1.10.1 PDB: 2c0a_A 1wau_A 1eua_A 1eun_A 1fq0_A* 1fwr_A* Back     alignment and structure
>3lye_A Oxaloacetate acetyl hydrolase; (alpha/beta)8 barrel; 1.30A {Cryphonectria parasitica} PDB: 3m0j_A* 3m0k_A Back     alignment and structure
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 Back     alignment and structure
>3fa4_A 2,3-dimethylmalate lyase; alpha/beta barrel, helix swapping; 2.18A {Aspergillus niger} PDB: 3fa3_A Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3eoo_A Methylisocitrate lyase; seattle structural genomics center for infectious disease, ssgcid; 2.90A {Burkholderia pseudomallei 1655} SCOP: c.1.12.7 Back     alignment and structure
>1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* Back     alignment and structure
>1xg4_A Probable methylisocitrate lyase; 2-methylisocitrate lyase/inhibitor complex, isocitrate lyase superfamily; HET: ICT; 1.60A {Escherichia coli} PDB: 1xg3_A* 1mum_A 1oqf_A 1ujq_A 1o5q_A Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 Back     alignment and structure
>1s2w_A Phosphoenolpyruvate phosphomutase; phosphonopyruvate, phosphonate biosynthesis pathway, isomera; 1.69A {Mytilus edulis} SCOP: c.1.12.7 PDB: 1m1b_A 1s2t_A 1s2v_A 1pym_A 1s2u_A Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>3b8i_A PA4872 oxaloacetate decarboxylase; alpha/beta barrel, helix swapping, lyase; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>2ze3_A DFA0005; organic waste LEFT-OVER decomposition, alkaliphilic, ICL/PEPM superfamily, alpha-ketoglutarate LIG isomerase; HET: AKG; 1.65A {Deinococcus ficus} Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta-BA lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1 Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>2uva_G Fatty acid synthase beta subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; HET: FMN; 3.10A {Thermomyces lanuginosus} PDB: 2uvc_G* Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>2qiw_A PEP phosphonomutase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: P6G; 1.80A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* Back     alignment and structure
>1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1lt8_A Betaine-homocysteine methyltransferase; homocysteine metabolism, homocysteinemia, zinc, thiol alkyl transfer; HET: CBH CIT; 2.05A {Homo sapiens} SCOP: c.1.26.1 PDB: 1lt7_A* 1umy_A Back     alignment and structure
>3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* Back     alignment and structure
>2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* Back     alignment and structure
>2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>2hjp_A Phosphonopyruvate hydrolase; phosporus-Ca cleavage, PEP mutase/isocitrate lyase superfamily; HET: XYS PPR; 1.90A {Variovorax SP} PDB: 2dua_A* 2hrw_A Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3m5v_A DHDPS, dihydrodipicolinate synthase; TIM barrel, csgid, amino-acid biosynthesis, diaminopimelate biosynthesis, lyase, lysine biosynthesis; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.1.10.0 PDB: 3ler_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>2yxg_A DHDPS, dihydrodipicolinate synthase; MJ0244, TIM beta/alpha-barrel fold, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>1zlp_A PSR132, petal death protein; TIM-barrel, helix swapping,2-ethyl-3-methylmalate lyase, 2-P methylmalate lyase, lyase/PEP mutase superfamily; 2.70A {Dianthus caryophyllus} Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>2yci_X 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; 1.78A {Carboxydothermus hydrogenoformans} PDB: 2ycj_A* 2yck_X* Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>3fkr_A L-2-keto-3-deoxyarabonate dehydratase; DHDPS/NAL family, complex, pyruvate, lyase; HET: KPI; 1.80A {Azospirillum brasilense} PDB: 3fkk_A Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>1o5k_A DHDPS, dihydrodipicolinate synthase; TM1521, structural genomics, J protein structure initiative, joint center for structural G lyase; HET: MCL; 1.80A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 3pb2_A 3pb0_A Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Back     alignment and structure
>1sfl_A 3-dehydroquinate dehydratase; 3-dehydroquinase, enzyme turnover, shikimate pathway, lyase; 1.90A {Staphylococcus aureus subsp} SCOP: c.1.10.1 PDB: 1sfj_A* Back     alignment and structure
>2ehh_A DHDPS, dihydrodipicolinate synthase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>1xky_A Dihydrodipicolinate synthase; TIM barrel, , lysine biosynthesis;spine, lyase; 1.94A {Bacillus anthracis} SCOP: c.1.10.1 PDB: 1xl9_A 3hij_A* Back     alignment and structure
>3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>1gvf_A Tagatose-bisphosphate aldolase AGAY; lyase, zinc.; HET: PGH; 1.45A {Escherichia coli} SCOP: c.1.10.2 Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A Back     alignment and structure
>3o1n_A 3-dehydroquinate dehydratase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, lyase; 1.03A {Salmonella enterica subsp} PDB: 3s42_A 3l2i_A* 3lb0_A 4guf_A 4gug_A* 4guh_A* 3nnt_A* 4guj_A* 3m7w_A 3oex_A 4gfs_A* 4gui_A* 1gqn_A 1l9w_A* 1qfe_A* Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3cpr_A Dihydrodipicolinate synthetase; (beta/alpha)8-barrel fold with A C-terminal alpha-helical segment, amino-acid biosynthesis, cytoplasm; HET: MCL; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>3b4u_A Dihydrodipicolinate synthase; structural genomics, PSI-2, MC protein structure initiative, midwest center for structural genomics; 1.20A {Agrobacterium tumefaciens str} Back     alignment and structure
>3d0c_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI-2, structural genomics; 1.90A {Oceanobacillus iheyensis HTE831} Back     alignment and structure
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* Back     alignment and structure
>2hmc_A AGR_L_411P, dihydrodipicolinate synthase; alpha-beta barrel (TIM barrel), structural genomics, PSI-2, structure initiative; HET: MSE; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... Back     alignment and structure
>3qfe_A Putative dihydrodipicolinate synthase family PROT; seattle structural genomics center for infectious disease, S coccidioides, valley fever; 2.35A {Coccidioides immitis} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3si9_A DHDPS, dihydrodipicolinate synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, TIM barrel; 2.10A {Bartonella henselae} Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>3na8_A Putative dihydrodipicolinate synthetase; lyase; HET: MSE; 1.85A {Pseudomonas aeruginosa} Back     alignment and structure
>1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 Back     alignment and structure
>2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* Back     alignment and structure
>2vc6_A MOSA, dihydrodipicolinate synthase; DHDPS, TIM barrel, schiff base, lyase; HET: MCL; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* Back     alignment and structure
>1o66_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics; HET: MSE; 1.75A {Neisseria meningitidis serogroup B} SCOP: c.1.12.8 PDB: 1o68_A* Back     alignment and structure
>3tak_A DHDPS, dihydrodipicolinate synthase; TIM barrel, lysine biosynthesis, pyruvate, lyase; 1.42A {Acinetobacter baumannii} PDB: 3pud_A* 3pue_A* 3pul_A 3rk8_A 3tce_A* 3tdf_A 3u8g_A 3uqn_A 4dxv_A Back     alignment and structure
>3i4e_A Isocitrate lyase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.69A {Burkholderia pseudomallei} Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>3l21_A DHDPS, dihydrodipicolinate synthase; DAPA, dimer, RV2753C, lysine biosynthesis, amino-acid biosynthesis, diaminopimelate biosynthesis; HET: KPI CME; 2.10A {Mycobacterium tuberculosis} SCOP: c.1.10.1 PDB: 1xxx_A Back     alignment and structure
>3qze_A DHDPS, dihydrodipicolinate synthase; alpha beta barrel, cytoplasmic; 1.59A {Pseudomonas aeruginosa} PDB: 3puo_A* 3noe_A 3ps7_A* 3s8h_A Back     alignment and structure
>2rfg_A Dihydrodipicolinate synthase; beta barrel, amino-acid biosynthesis, diaminopimelate biosyn lyase, lysine biosynthesis, schiff base; 1.50A {Hahella chejuensis} Back     alignment and structure
>3q94_A Fructose-bisphosphate aldolase, class II; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta barrel; HET: 13P; 2.30A {Bacillus anthracis} SCOP: c.1.10.0 Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>2wkj_A N-acetylneuraminate lyase; directed evolution, sialic acid mimetics, aldolase, S base, carbohydrate metabolism, N-acetylneuraminic acid LYAS; HET: KPI PYR; 1.45A {Escherichia coli} PDB: 2wnq_A 2xfw_A* 2wpb_A* 2wnz_A* 2ygy_A* 2wo5_A* 2wnn_A* 3lbm_A 3lbc_A 3lcf_A 3lcl_A 3lcg_A 3lch_A 3lci_A 1hl2_A 1fdy_A 1fdz_A 1nal_1 3lcx_A 3lcw_A Back     alignment and structure
>1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Back     alignment and structure
>2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1f6k_A N-acetylneuraminate lyase; beta barrel; 1.60A {Haemophilus influenzae} SCOP: c.1.10.1 PDB: 1f5z_A 1f6p_A 1f73_A* 1f74_A* 1f7b_A* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Back     alignment and structure
>3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Back     alignment and structure
>2v9d_A YAGE; dihydrodipicolinic acid synthase, N-acetyl neuraminate lyase, NAL, lyase, DHDPS, prophage; 2.15A {Escherichia coli} PDB: 2v8z_A 3nev_A* 3n2x_A* Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>3daq_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, diaminopimelate biosynthesis, lyase, schiff B; 1.45A {Staphylococcus aureus} SCOP: c.1.10.0 PDB: 3di1_A 3di0_A Back     alignment and structure
>3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* Back     alignment and structure
>3txv_A Probable tagatose 6-phosphate kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3eb2_A Putative dihydrodipicolinate synthetase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2., structural genomics; HET: PGE; 2.04A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2fiq_A Putative tagatose 6-phosphate kinase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics; 2.25A {Escherichia coli} SCOP: c.1.10.7 Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Back     alignment and structure
>2r91_A 2-keto-3-deoxy-(6-phospho-)gluconate aldolase; TIM barrel, thermophilic, lyase; 2.00A {Thermoproteus tenax} PDB: 2r94_A Back     alignment and structure
>3flu_A DHDPS, dihydrodipicolinate synthase; TIM barrel, beta-alpha-barrel, amino-acid biosynthesis, diaminopimelate biosynthesis; 2.00A {Neisseria meningitidis serogroup B} SCOP: c.1.10.0 Back     alignment and structure
>3tfx_A Orotidine 5'-phosphate decarboxylase; PSI-biology, nysgrc, 000529, structural genomics, NEW YORK S genomics research consortium; 2.19A {Lactobacillus acidophilus} Back     alignment and structure
>4djd_D C/Fe-SP, corrinoid/iron-sulfur protein small subunit; TIM barrel, rossmann fold, B12-dependent methyltransferase; HET: B12; 2.38A {Moorella thermoacetica} PDB: 4dje_D* 4djf_D* Back     alignment and structure
>1oy0_A Ketopantoate hydroxymethyltransferase; domain swapping, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: c.1.12.8 Back     alignment and structure
>2r8w_A AGR_C_1641P; APC7498, dihydrodipicolinate synthase, agrobacterium tumefac C58, structural genomics, PSI-2; HET: MSE; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Back     alignment and structure
>3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* Back     alignment and structure
>2ojp_A DHDPS, dihydrodipicolinate synthase; dimer, lysine biosynthe lyase; HET: KGC GOL; 1.70A {Escherichia coli} PDB: 1yxc_A 1dhp_A 1yxd_A* 2ats_A* 3du0_A* 3c0j_A* 3ubs_A* 4eou_A* 3i7q_A* 3i7r_A* 3i7s_A* 2pur_A* 1s5v_A 1s5w_A 1s5t_A 3den_A* 2a6l_A 2a6n_A 3g0s_A Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>2nuw_A 2-keto-3-deoxygluconate/2-keto-3-deoxy-6-phospho aldolase; TIM barrel, lyase; 1.80A {Sulfolobus acidocaldarius dsm 639} PDB: 2nux_A 2nuy_A Back     alignment and structure
>3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 Back     alignment and structure
>2xed_A Putative maleate isomerase; nicotinic acid catabolism, cofactor-independent CIS-trans isomerase; 1.95A {Nocardia farcinica} PDB: 2xec_A Back     alignment and structure
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 Back     alignment and structure
>3s5o_A 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; beta barrel, schiff base, hydroxyproline metabolis; HET: KPI; 1.97A {Homo sapiens} SCOP: c.1.10.0 PDB: 3s5n_A Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2yzr_A Pyridoxal biosynthesis lyase PDXS; redox protein, pyridoxal phosphate, structural genomi NPPSFA; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vs1_A 3-deoxy-7-phosphoheptulonate synthase; (beta/alpha)8 barrel, transferase; HET: PEP; 2.30A {Aeropyrum pernix} Back     alignment and structure
>2yr1_A 3-dehydroquinate dehydratase; amino acid biosynthesis, 3-dehydroquinase, structural genomi NPPSFA; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>3dz1_A Dihydrodipicolinate synthase; lysine biosynthesis, pyruvate, TIM barrel, NYSGXRC, PSI2, structural genomics; 1.87A {Rhodopseudomonas palustris} SCOP: c.1.10.0 Back     alignment and structure
>2uv8_G Fatty acid synthase subunit beta (FAS1); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_G* 3hmj_G* Back     alignment and structure
>3a5f_A Dihydrodipicolinate synthase; TIM barrel, enzyme, amino-acid biosynthesis, cytoplasm, diaminopimelate biosynthesis, lyase; HET: KPI; 1.19A {Clostridium botulinum A} PDB: 3bi8_A* 3ird_A* Back     alignment and structure
>1nvm_A HOA, 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: a.5.7.1 c.1.10.5 Back     alignment and structure
>3e96_A Dihydrodipicolinate synthase; structural genomics, nysgrc, target 9375C, operon, PSI-2; 1.80A {Bacillus clausii ksm-k16} SCOP: c.1.10.0 Back     alignment and structure
>1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3nl6_A Thiamine biosynthetic bifunctional enzyme; thiamin biosynthesis, eukaryoyes, transferase; HET: TPS ACP; 2.61A {Candida glabrata} PDB: 3nl2_A* 3nl5_A* 3nl3_A* 3nm3_A* 3nm1_A* Back     alignment and structure
>1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2qgy_A Enolase from the environmental genome shotgun sequencing of the sargasso SEA; structural genomics, unknown function, PSI-2; 1.80A {Environmental sample} Back     alignment and structure
>1pii_A N-(5'phosphoribosyl)anthranilate isomerase; bifunctional(isomerase and synthase); 2.00A {Escherichia coli} SCOP: c.1.2.4 c.1.2.4 PDB: 1jcm_P* 2kzh_A Back     alignment and structure
>1w3i_A EDA, 2-keto-3-deoxy gluconate aldolase; archaeal metabolism, pyruvate; 1.7A {Sulfolobus solfataricus} SCOP: c.1.10.1 PDB: 1w37_A 1w3n_A* 1w3t_A* 2yda_A* Back     alignment and structure
>1rqb_A Transcarboxylase 5S subunit; TIM-barrel, carbamylated lysine, transfera; HET: KCX; 1.90A {Propionibacterium freudenreichii subspshermanii} SCOP: a.5.7.2 c.1.10.5 PDB: 1rqe_A 1rqh_A* 1rr2_A* 1u5j_A* 1s3h_A* Back     alignment and structure
>2ftp_A Hydroxymethylglutaryl-COA lyase; structural genomics, PSI, protein structure initiativ midwest center for structural genomics, MCSG; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3vav_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; structural genomics, seattle structural genomics center for infectious disease; 1.80A {Burkholderia thailandensis} SCOP: c.1.12.8 PDB: 3ez4_A Back     alignment and structure
>1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* Back     alignment and structure
>1mdl_A Mandelate racemase; isomerase, mandelate pathway, magnesium; HET: RMN SMN; 1.85A {Pseudomonas aeruginosa} SCOP: c.1.11.2 d.54.1.1 PDB: 1mdr_A* 3uxk_A* 3uxl_A* 1dtn_A* 1mra_A* 2mnr_A 1mns_A Back     alignment and structure
>2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A Back     alignment and structure
>1q7z_A 5-methyltetrahydrofolate S-homocysteine methyltransferase; methionine, cobalamin, vitamin B12; 1.70A {Thermotoga maritima} SCOP: c.1.21.2 c.1.26.1 PDB: 1q7q_A 1q7m_A 1q85_A 1q8a_A 1q8j_A* 3bof_A 3bol_A Back     alignment and structure
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>2og9_A Mandelate racemase/muconate lactonizing enzyme; NYSGXRC, protein structure initiative (PSI) II, PSI-2, 9382A mandelate racemase; 1.90A {Polaromonas SP} PDB: 3cb3_A* Back     alignment and structure
>3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* Back     alignment and structure
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* Back     alignment and structure
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>2nx9_A Oxaloacetate decarboxylase 2, subunit alpha; carboxyltransferase structure, B enzymes, Zn2+ binding site, TIM-barrel fold, lyase; 1.70A {Vibrio cholerae} Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>3eeg_A 2-isopropylmalate synthase; 11106D, beta barrel, PSI-II, structural genomics, protein structure initiative; 2.78A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1vhn_A Putative flavin oxidoreducatase; structural genomics, unknown function; HET: FMN; 1.59A {Thermotoga maritima} SCOP: c.1.4.1 Back     alignment and structure
>2dgd_A 223AA long hypothetical arylmalonate decarboxylas; octamer, alpha/beta structure, lyase; 2.90A {Sulfolobus tokodaii} Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A Back     alignment and structure
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae} Back     alignment and structure
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 Back     alignment and structure
>3aty_A Tcoye, prostaglandin F2A synthase; alpha/beta barrel, oxidoreductase, flavin mononucleotide; HET: FMN; 1.70A {Trypanosoma cruzi} PDB: 3atz_A* Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>2pp0_A L-talarate/galactarate dehydratase; enolase superfamily, LYA; 2.20A {Salmonella typhimurium} PDB: 2pp1_A* 2pp3_A* Back     alignment and structure
>2nql_A AGR_PAT_674P, isomerase/lactonizing enzyme; enolase, structural genomics, protein structure initiative, nysgxrc; 1.80A {Agrobacterium tumefaciens str} PDB: 4dn1_A Back     alignment and structure
>3lg3_A Isocitrate lyase; conserved, CD, proteomics evidence (cytopl periplasmic), drug target functions; 1.40A {Yersinia pestis} SCOP: c.1.12.7 PDB: 1igw_A Back     alignment and structure
>2o56_A Putative mandelate racemase; dehydratase, structural genomics, protein structure initiati 2; 2.00A {Salmonella typhimurium} Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A SUBS tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>4dwd_A Mandelate racemase/muconate lactonizing enzyme, C domain protein; structural genomics, EFI, enzyme function initiative, metal protein; HET: MSE; 1.50A {Paracoccus denitrificans} PDB: 3n4e_A* Back     alignment and structure
>3qvl_A Putative hydantoin racemase; isomerase; HET: 5HY; 1.82A {Klebsiella pneumoniae subsp} PDB: 3qvk_A* 3qvj_A Back     alignment and structure
>3tr9_A Dihydropteroate synthase; biosynthesis of cofactors, prosthetic groups, and carriers, transferase; HET: PT1; 1.90A {Coxiella burnetii} Back     alignment and structure
>2qkf_A 3-deoxy-D-manno-octulosonic acid 8- phosphate SYN; manno-octulosonate, synthase, lipopolysaccharide, KDOP, KDO8 KDO8PS; 1.75A {Neisseria meningitidis serogroup B} PDB: 3stf_A 3qpy_A 3ste_A 3qpz_A 3qq0_A 3fyo_A* 3qq1_A 3fyp_A* 3stc_A 3stg_A 1phw_A 1g7v_A* 1gg0_A 1phq_A* 1d9e_A 1pl9_A* 1q3n_A* 1x6u_A* 1x8f_A 1g7u_A* Back     alignment and structure
>3h5d_A DHDPS, dihydrodipicolinate synthase; lysine biosynthesis, amino-ACI biosynthesis, schiff base, cytoplasm, diaminopimelate biosy lyase; HET: MES; 1.99A {Streptococcus pneumoniae} Back     alignment and structure
>3stp_A Galactonate dehydratase, putative; PSI biology, structural genomics, NEW YORK structural genomi research consortium; 1.88A {Labrenzia aggregata iam 12614} PDB: 3sqs_A 3ssz_A Back     alignment and structure
>3s81_A Putative aspartate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta fold, cytosol; 1.80A {Salmonella enterica subsp} PDB: 3s7z_A Back     alignment and structure
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* Back     alignment and structure
>2nwr_A 2-dehydro-3-deoxyphosphooctonate aldolase; KDO, KDO8P, KDO8PS, PEP, A5P, transferase; HET: PEP; 1.50A {Aquifex aeolicus} PDB: 2nws_A* 2nx1_A* 3e0i_A* 1fwn_A* 1fwt_A* 1fws_A* 1fx6_A 1fww_A 1fxq_A* 1fy6_A* 1jcx_A* 1jcy_A* 1pck_A* 1pcw_A* 1fxp_A* 2a21_A* 2a2i_A* 1pe1_A* 3e12_A* 2nx3_A* ... Back     alignment and structure
>3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* Back     alignment and structure
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>1eye_A DHPS 1, dihydropteroate synthase I; alpha-beta barrel, transferase; HET: PMM; 1.70A {Mycobacterium tuberculosis H37RV} SCOP: c.1.21.1 Back     alignment and structure
>2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>2zsk_A PH1733, 226AA long hypothetical aspartate racemase; alpha/beta fold, unknown function; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>3ojc_A Putative aspartate/glutamate racemase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 1.75A {Yersinia pestis} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>3iwp_A Copper homeostasis protein CUTC homolog; conserved sequence motif, metal-binding site, polymorphism, metal binding protein; 2.50A {Homo sapiens} Back     alignment and structure
>1f8m_A Isocitrate lyase, ICL; alpha-beta barrel, helix-swapping, closed conformation, bromopyuvate modification, structural genomics; 1.80A {Mycobacterium tuberculosis H37RV} SCOP: c.1.12.7 PDB: 1f61_A 1f8i_A Back     alignment and structure
>2zad_A Muconate cycloisomerase; muconate lactonizing enzyme (MLE), TM0006, struct genomics, NPPSFA; HET: 1PE; 1.60A {Thermotoga maritima} PDB: 3deq_A 3der_A* 3des_A* 3dfy_A Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>3eol_A Isocitrate lyase; seattle structural center for infectious disease, ssgcid; 2.00A {Brucella melitensis} PDB: 3oq8_A 3e5b_A 3p0x_A* Back     alignment and structure
>3ozy_A Putative mandelate racemase; beta-alpha barrel, enolase superfamily member, M-xylarate, U function; HET: DXL; 1.30A {Bordetella bronchiseptica} PDB: 3ozm_A* 3h12_A 3op2_A* Back     alignment and structure
>2ox4_A Putative mandelate racemase; enolase, dehydratase, structural genomics, protein structure initiative, PSI, nysgrc; 1.80A {Zymomonas mobilis} Back     alignment and structure
>3nvt_A 3-deoxy-D-arabino-heptulosonate 7-phosphate synth; bifunctional 3-deoxy-7-phosphoheptulonate synthase/chorismat listeria monocytogenes EGD-E; 1.95A {Listeria monocytogenes} PDB: 3tfc_A* Back     alignment and structure
>3o07_A Pyridoxine biosynthesis protein SNZ1; (beta/alpha)8-barrel, pyridoxal 5-phosphate synthase, PLP G3 SNO1, biosynthetic protein; HET: 1GP; 1.80A {Saccharomyces cerevisiae} PDB: 3o06_A 3o05_A* 3fem_A Back     alignment and structure
>3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 Back     alignment and structure
>4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* Back     alignment and structure
>2eq5_A 228AA long hypothetical hydantoin racemase; structural genomics, NPPSFA, national project on P structural and functional analyses; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1f6y_A 5-methyltetrahydrofolate corrinoid/iron sulfur PR methyltransferase; carbon dioxide fixation, cobalamin, methyltatrahydrofolate; 2.20A {Moorella thermoacetica} SCOP: c.1.21.2 PDB: 2e7f_A* 4djd_A* 4dje_A* 4djf_A* 2ogy_A* Back     alignment and structure
>3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Back     alignment and structure
>3sz8_A 2-dehydro-3-deoxyphosphooctonate aldolase 2; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.05A {Burkholderia pseudomallei} PDB: 3tmq_A* 3und_A* Back     alignment and structure
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 Back     alignment and structure
>2gl5_A Putative dehydratase protein; structural genomics, protein structure initiati nysgxrc; 1.60A {Salmonella typhimurium} SCOP: c.1.11.2 d.54.1.1 PDB: 4e6m_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3rr1_A GALD, putative D-galactonate dehydratase; enolase, magnesium binding site, lyase; 1.95A {Ralstonia pickettii} PDB: 3rra_A Back     alignment and structure
>4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} Back     alignment and structure
>3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* Back     alignment and structure
>1o60_A 2-dehydro-3-deoxyphosphooctonate aldolase; structural genomics, transferase; 1.80A {Haemophilus influenzae} SCOP: c.1.10.4 PDB: 3e9a_A Back     alignment and structure
>3o63_A Probable thiamine-phosphate pyrophosphorylase; thiamin biosynthesis, TIM barrel, transferase; 2.35A {Mycobacterium tuberculosis} Back     alignment and structure
>3ist_A Glutamate racemase; structural genomics, cell WALL biogenesis/degradation, isomerase, peptidoglycan synthesis; HET: MSE; 1.65A {Listeria monocytogenes} PDB: 3hfr_A* 3isv_A* Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Back     alignment and structure
>1vr6_A Phospho-2-dehydro-3-deoxyheptonate aldolase; TM0343, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative; 1.92A {Thermotoga maritima} SCOP: c.1.10.4 PDB: 1rzm_A* 3pg9_A* 3pg8_A* Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>4hb7_A Dihydropteroate synthase; transferase; 1.95A {Staphylococcus aureus} PDB: 1ad1_A 1ad4_A* Back     alignment and structure
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid,CSG bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} SCOP: c.1.2.0 PDB: 3ieb_A* Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} Back     alignment and structure
>3i4k_A Muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9450D, isomerase, PSI-2, protein structure initiative; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>3bjs_A Mandelate racemase/muconate lactonizing enzyme; enolase, structural genomics, PSI-2, protein struc initiative; 2.70A {Polaromonas SP} Back     alignment and structure
>3ble_A Citramalate synthase from leptospira interrogans; TIM barrel, licmsn, substrate specificity, acyltransferase, amino-acid biosynthesis; 2.00A {Leptospira interrogans} PDB: 3blf_A 3bli_A* Back     alignment and structure
>4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} Back     alignment and structure
>2qde_A Mandelate racemase/muconate lactonizing enzyme FA protein; PSI-II, NYSGXRC, enolase, structural genomics, protei structure initiative, PSI-2; 1.93A {Azoarcus SP} Back     alignment and structure
>1m3u_A 3-methyl-2-oxobutanoate hydroxymethyltransferase; beta-alpha-barrel, TIM-barrel, ketopantoate, selenomethionin decamer; HET: KPL; 1.80A {Escherichia coli} SCOP: c.1.12.8 Back     alignment and structure
>1nu5_A Chloromuconate cycloisomerase; enzyme, dehalogenation; 1.95A {Pseudomonas SP} SCOP: c.1.11.2 d.54.1.1 Back     alignment and structure
>1tzz_A Hypothetical protein L1841; structural genomics, mandelate racemase like fold, nysgxrc target T1523, PSI, protein structure initiative; 1.86A {Bradyrhizobium japonicum} SCOP: c.1.11.2 d.54.1.1 PDB: 2dw7_A* 2dw6_A* Back     alignment and structure
>1b73_A Glutamate racemase; isomerase; 2.30A {Aquifex pyrophilus} SCOP: c.78.2.1 c.78.2.1 PDB: 1b74_A* Back     alignment and structure
>3uhf_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich fold, isomerase; HET: DGL; 1.83A {Campylobacter jejuni} PDB: 3uho_A* 3uhp_A Back     alignment and structure
>4e5t_A Mandelate racemase / muconate lactonizing enzyme, terminal domain protein; aldolase, structural genomics, biology; 2.90A {Labrenzia alexandrii} Back     alignment and structure
>3rcy_A Mandelate racemase/muconate lactonizing enzyme-LI protein; structural genomics, protein structure initiative; HET: RIB; 1.99A {Roseovarius SP} PDB: 3t4w_A Back     alignment and structure
>3out_A Glutamate racemase; structural genomics, center for structural genomics of infec diseases, csgid, MURI, cell envelope; HET: MSE DGL; 1.65A {Francisella tularensis subsp} Back     alignment and structure
>2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 Back     alignment and structure
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* Back     alignment and structure
>3fok_A Uncharacterized protein CGL0159; CGL0159 ,brevibacterium flavum., structural genomics, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum} Back     alignment and structure
>1tkk_A Similar to chloromuconate cycloisomerase; epimerase, enolase super family,; 2.10A {Bacillus subtilis} SCOP: c.1.11.2 d.54.1.1 PDB: 1jpm_A Back     alignment and structure
>2rdx_A Mandelate racemase/muconate lactonizing enzyme, P; enolase, structural genomics, PSI, protein structu initiative, nysgrc; 2.00A {Roseovarius nubinhibens} Back     alignment and structure
>3tr2_A Orotidine 5'-phosphate decarboxylase; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.00A {Coxiella burnetii} Back     alignment and structure
>3vcn_A Mannonate dehydratase; enolase, magnesium binding site, enzyme function initiative, lyase; 1.45A {Caulobacter crescentus} PDB: 4gme_A* 4fi4_A 3thu_A Back     alignment and structure
>1zco_A 2-dehydro-3-deoxyphosphoheptonate aldolase; arabino-heptulosonate, synthase, shikimate, DAHP, DAH7P, DAH DAH7PS, lyase; HET: PEP; 2.25A {Pyrococcus furiosus} Back     alignment and structure
>1tx2_A DHPS, dihydropteroate synthase; folate biosynthesis, pterine, MA transferase; HET: 680; 1.83A {Bacillus anthracis} SCOP: c.1.21.1 PDB: 1tww_A* 1twz_A* 1tx0_A* 1tws_A* 3h21_A* 3h22_A* 3h23_A* 3h24_A* 3h26_A* 3h2a_A* 3h2c_A* 3h2e_A* 3h2f_A* 3h2m_A* 3h2n_A* 3h2o_A* 3tya_A* 3tyb_A* 3tyc_A* 3tyd_A* ... Back     alignment and structure
>3ceu_A Thiamine phosphate pyrophosphorylase; TIM barrel-like protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4e4u_A Mandalate racemase/muconate lactonizing enzyme; mandelate racemase, aldolase, structural genomics, biology; 1.35A {Unidentified} Back     alignment and structure
>2vp8_A Dihydropteroate synthase 2; RV1207 transferase, folate biosynthesis, antibiotic resistance; 2.64A {Mycobacterium tuberculosis} Back     alignment and structure
>2poz_A Putative dehydratase; octamer, structural genomics, P protein structure initiative, NEW YORK SGX research center structural genomics, nysgxrc; 2.04A {Mesorhizobium loti} Back     alignment and structure
>2gdq_A YITF; mandelate racemase/muconate lactonizing enzyme, TIM-barrel, octamer, structural genomics, PSI; 1.80A {Bacillus subtilis subsp} SCOP: c.1.11.2 d.54.1.1 PDB: 2gge_A Back     alignment and structure
>1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Back     alignment and structure
>2vvt_A Glutamate racemase; isomerase, peptidoglycan synthesis, cell WALL biogenesis/degradation, cell shape, benzyl purine, MURI inhibitor; HET: I24 DGL; 1.65A {Enterococcus faecalis} PDB: 2jfp_A* 2jfo_A* 2jfu_A 2jfv_A* 2jfw_A* Back     alignment and structure
>2oho_A Glutamate racemase; isomerase; 2.25A {Streptococcus pyogenes m1 gas} PDB: 2ohg_A 2ohv_A* Back     alignment and structure
>2oz8_A MLL7089 protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.48A {Mesorhizobium loti} Back     alignment and structure
>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A Back     alignment and structure
>1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 Back     alignment and structure
>2qq6_A Mandelate racemase/muconate lactonizing enzyme- like protein; enolase, Mg ION, PSI-2, NYSGXRC, structural genomics; 2.90A {Rubrobacter xylanophilus dsm 9941} Back     alignment and structure
>2jfq_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: DGL; 2.15A {Staphylococcus aureus} Back     alignment and structure
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} Back     alignment and structure
>3kts_A Glycerol uptake operon antiterminator regulatory; structural genomics, PSI-2, protein structur initiative; HET: UNL; 2.75A {Listeria monocytogenes str} Back     alignment and structure
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A* Back     alignment and structure
>1vc4_A Indole-3-glycerol phosphate synthase; lyase, tryptophan biosynthesis, riken structural genomics/PR initiative, RSGI, structural genomics; 1.80A {Thermus thermophilus} SCOP: c.1.2.4 Back     alignment and structure
>1aj0_A DHPS, dihydropteroate synthase; antibiotic, resistance, transferase, folate, biosynthesis; HET: PH2 SAN; 2.00A {Escherichia coli} SCOP: c.1.21.1 PDB: 1aj2_A* 1ajz_A 3tyz_A* 3tyu_A* 3tzf_A* 3tzn_A Back     alignment and structure
>3go2_A Putative L-alanine-DL-glutamate epimerase; structural genomics, isomerase, PSI-2; 1.70A {Burkholderia xenovorans} PDB: 2oo6_A 3sn0_A 3sn1_A* 3sn4_A* Back     alignment and structure
>3toy_A Mandelate racemase/muconate lactonizing enzyme FA protein; enolase, magnesium binding site, lyase; HET: P4C; 1.80A {Bradyrhizobium SP} PDB: 3tte_A* Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
>3ldv_A Orotidine 5'-phosphate decarboxylase; structural genomics, infectious diseases; 1.77A {Vibrio cholerae o1 biovar el tor} PDB: 3uwq_A* Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>3ij6_A Uncharacterized metal-dependent hydrolase; structural genomics, amidohydrolase, PSI-2, protein structure initiative; 2.00A {Lactobacillus acidophilus} Back     alignment and structure
>1zuw_A Glutamate racemase 1; (R)-glutamate, peptidoglycan biosynthesi isomerase; HET: DGL; 1.75A {Bacillus subtilis} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>3sjn_A Mandelate racemase/muconate lactonizing protein; enolase, magnesium binding site, lyase; 1.90A {Shewanella pealeana} Back     alignment and structure
>1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Back     alignment and structure
>3v3w_A Starvation sensing protein RSPA; enolase, enzyme function initiative, EFI, lyase; HET: NHE; 1.40A {Cellvibrio japonicus} PDB: 3v4b_A* 4f4r_A 3qkf_A* 3qke_A* 3p93_A* 3ow1_A 3pk7_A* 3rgt_A* 3bsm_A Back     alignment and structure
>2jfz_A Glutamate racemase; cell WALL, isomerase, cell shape, peptidoglycan synthesis, peptidoglycan biosynthesis; HET: 003 DGL; 1.86A {Helicobacter pylori} PDB: 2jfx_A* 2jfy_A* 2w4i_A* Back     alignment and structure
>1ydn_A Hydroxymethylglutaryl-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative; 2.30A {Brucella melitensis} Back     alignment and structure
>3nur_A Amidohydrolase; TIM barrel; 1.75A {Staphylococcus aureus} Back     alignment and structure
>4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A Back     alignment and structure
>1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* Back     alignment and structure
>3ovp_A Ribulose-phosphate 3-epimerase; iron binding, isomerase; HET: XPE; 1.70A {Homo sapiens} SCOP: c.1.2.0 PDB: 3ovq_A* 3ovr_A* 3qc3_A Back     alignment and structure
>3ru6_A Orotidine 5'-phosphate decarboxylase; structural genomics, center for structural genomics of infec diseases (csgid), TIM-barrel; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3r4e_A Mandelate racemase/muconate lactonizing enzyme; enolase fold, mannonate dehydratase, D-mannonate, lyase; HET: CS2; 1.65A {Novosphingobium aromaticivorans} PDB: 2qjj_A 2qjn_A* 2qjm_A* Back     alignment and structure
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>2gwg_A 4-oxalomesaconate hydratase; TIM-barrel like protein, structural genomics, PSI, protein S initiative; 1.80A {Rhodopseudomonas palustris} SCOP: c.1.9.15 Back     alignment and structure
>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A Back     alignment and structure
>1sjd_A N-acylamino acid racemase; lyase, isomerase; HET: NPG; 1.87A {Amycolatopsis SP} SCOP: c.1.11.2 d.54.1.1 PDB: 1sja_A* 1sjb_A* 1sjc_A* Back     alignment and structure
>2cw6_A Hydroxymethylglutaryl-COA lyase, mitochondrial; HMG-COA lyase, ketogenic enzyme; HET: 3HG; 2.10A {Homo sapiens} PDB: 3mp3_A* 3mp4_A 3mp5_A* Back     alignment and structure
>2pcq_A Putative dihydrodipicolinate synthase; lyase, lysine biosynthesis, dihydrodipicoliante, S genomics, NPPSFA; 2.10A {Thermus thermophilus} Back     alignment and structure
>1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Back     alignment and structure
>3sbf_A Mandelate racemase / muconate lactonizing enzyme; enolase fold, acid sugar dehydratase, D-araninonate, isomera; HET: EPE D8T; 1.50A {Vibrionales bacterium swat-3} PDB: 3r25_A 3dfh_A 4gis_A 4gir_A 4ggh_A 3gy1_A Back     alignment and structure
>2hzg_A Mandelate racemase/muconate lactonizing enzyme/EN superfamily; structural genomics, predicted mandelate racemase, PSI; 2.02A {Rhodobacter sphaeroides} Back     alignment and structure
>1ydo_A HMG-COA lyase; TIM-barrel protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG,; 2.71A {Bacillus subtilis subsp} Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2p8b_A Mandelate racemase/muconate lactonizing enzyme family protein; enolase superfamily, prediction of function; HET: NSK; 1.70A {Bacillus cereus atcc 14579} PDB: 2p88_A* 2p8c_A* Back     alignment and structure
>2gzm_A Glutamate racemase; enzyme, isomerase; HET: DGL; 1.99A {Bacillus anthracis} Back     alignment and structure
>3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O Back     alignment and structure
>3k13_A 5-methyltetrahydrofolate-homocysteine methyltrans; 5-methyltetrahydrofolate,methyltransferase, TIM barrel, STRU genomics, PSI-2; HET: MSE THH GOL; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ovl_A Putative racemase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.13A {Streptomyces coelicolor A3} PDB: 3ck5_A Back     alignment and structure
>3tml_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.90A {Burkholderia cenocepacia} PDB: 3t4c_A Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Back     alignment and structure
>1w1z_A Delta-aminolevulinic acid dehydratase; synthase, tetrapyrrole biosynthesis, ALAD, porphyrin biosynt heme biosynthesis, lyase; 2.6A {Prosthecochloris vibrioformis} SCOP: c.1.10.3 PDB: 2c1h_A* Back     alignment and structure
>3dxi_A Putative aldolase; TIM barrel, 11107N, PSI2, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Back     alignment and structure
>4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* Back     alignment and structure
>4inf_A Metal-dependent hydrolase; amidohydrolase, metal binding site, enzyme functi initiative, EFI; 1.48A {Novosphingobium aromaticivorans} PDB: 4ing_A* Back     alignment and structure
>2pgw_A Muconate cycloisomerase; enolase superfamily, octamer, small metabolism, PSI-II, NYSGXRC, structural genomics, PR structure initiative; 1.95A {Sinorhizobium meliloti} Back     alignment and structure
>2hsa_B 12-oxophytodienoate reductase 3; alpha beta 8 barrel, flavoprotein, jasmonate biosynthesis, oxidoreductase; HET: FMN; 1.50A {Solanum lycopersicum} PDB: 2hs6_A* 3hgs_A* 2hs8_A* 3hgo_A* 1q45_A* 2g5w_A* 2q3o_A* Back     alignment and structure
>1eix_A Orotidine 5'-monophosphate decarboxylase; alpha-beta-barrel, protein-inhibitor complex, homodimer, lyase; HET: BMQ; 2.50A {Escherichia coli} SCOP: c.1.2.3 PDB: 1jjk_A* 1l2u_A Back     alignment and structure
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 Back     alignment and structure
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans} PDB: 2ycl_B* Back     alignment and structure
>2yyu_A Orotidine 5'-phosphate decarboxylase; TIM barrel, structural genomics, NPPSFA, national project on structural and functional analyses; HET: C5P; 2.20A {Geobacillus kaustophilus} PDB: 2yyt_A* Back     alignment and structure
>3ugv_A Enolase; enzyme function initiative, EFI, lyase; 2.30A {Alpha proteobacterium BAL199} Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>2hxt_A L-fuconate dehydratase; enolase superfamily, D-erythromohydr unknown function; HET: EHM; 1.70A {Xanthomonas campestris PV} PDB: 1yey_A 2hxu_A* 2hne_A Back     alignment and structure
>3tji_A Mandelate racemase/muconate lactonizing enzyme, N domain protein; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.80A {Enterobacter SP} Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Back     alignment and structure
>1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 Back     alignment and structure
>2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* Back     alignment and structure
>3fs2_A 2-dehydro-3-deoxyphosphooctonate aldolase; ssgcid, bruciellla melitensis, DAHP synthetase I, cytoplasm, lipopolysaccharide biosynthesis; HET: PG4; 1.85A {Brucella melitensis} Back     alignment and structure
>1r0m_A N-acylamino acid racemase; isomerase; 1.30A {Deinococcus radiodurans} SCOP: c.1.11.2 d.54.1.1 PDB: 1xpy_A* 1xs2_A 2ggj_A 2ggi_A 2ggh_A* 2ggg_A* 2fkp_A Back     alignment and structure
>3tha_A Tryptophan synthase alpha chain; structural genomics, center for structural genomics of infec diseases, csgid, lyase; 2.37A {Campylobacter jejuni} Back     alignment and structure
>3tj4_A Mandelate racemase; enolase, dehydratase, enzyme function initiative, EFI, lyase; 1.50A {Agrobacterium tumefaciens} PDB: 4h19_A* Back     alignment and structure
>3m47_A Orotidine 5'-phosphate decarboxylase; orotidine 5'-monophosphate decarboxylase, mutant I218A, LYAS; 1.20A {Methanothermobacter thermautotrophicusdelta H} SCOP: c.1.2.3 PDB: 3li1_A 3m5z_A 3lty_A 3ltp_A* 3g18_A* 3g1d_A* 3g1f_A* 3g1h_A* 3g1a_A* 3lv6_A* 1klz_A* 3g1y_A 3g22_A* 3g24_A* 3p5z_A* 3siz_A* 3sy5_A* 1loq_A* 1lor_A* 1kly_A* ... Back     alignment and structure
>3ewb_X 2-isopropylmalate synthase; LEUA, structural genomics, unknown function, amino-acid biosynthesis; 2.10A {Listeria monocytogenes str} Back     alignment and structure
>3eez_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, unknown function, PSI-2, protein structure initiative; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>3noy_A 4-hydroxy-3-methylbut-2-EN-1-YL diphosphate synth; iron-sulfur protein, non-mevalonate pathway, terpene biosynt isoprenoid biosynthesis; 2.70A {Aquifex aeolicus} Back     alignment and structure
>2ps2_A Putative mandelate racemase/muconate lactonizing enzyme; structural genomics, NYSGXRC, target 9440A, enolase superfamily, PSI-2; 1.80A {Aspergillus oryzae RIB40} Back     alignment and structure
>4dpp_A DHDPS 2, dihydrodipicolinate synthase 2, chloroplastic; amino-acid biosynthesis, (S)-lysine biosynthesis VIA DAP PAT (beta/alpha)8-barrel; 2.00A {Arabidopsis thaliana} PDB: 4dpq_A* 3tuu_A* Back     alignment and structure
>2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* Back     alignment and structure
>3obk_A Delta-aminolevulinic acid dehydratase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; HET: PBG; 2.50A {Toxoplasma gondii ME49} Back     alignment and structure
>3jva_A Dipeptide epimerase; enolase superfamily, isomerase; 1.70A {Enterococcus faecalis V583} PDB: 3jw7_A* 3jzu_A* 3k1g_A* 3kum_A* Back     alignment and structure
>3tcs_A Racemase, putative; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, TIM barrel; HET: PG4; 1.88A {Roseobacter denitrificans} PDB: 3u4f_A 3t9p_A 3t8q_A Back     alignment and structure
>3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... Back     alignment and structure
>2y5s_A DHPS, dihydropteroate synthase; transferase, folate biosynthesis; HET: 78H; 1.95A {Burkholderia cenocepacia} PDB: 2y5j_A* Back     alignment and structure
>3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} Back     alignment and structure
>2dwu_A Glutamate racemase; isomerase; HET: DGL; 1.60A {Bacillus anthracis} Back     alignment and structure
>2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* Back     alignment and structure
>3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* Back     alignment and structure
>1l6s_A Porphobilinogen synthase; dehydratase, lyase; HET: CME DSB; 1.70A {Escherichia coli} SCOP: c.1.10.3 PDB: 1i8j_A* 1l6y_A* 1b4e_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 293
d1oy0a_262 c.1.12.8 (A:) Ketopantoate hydroxymethyltransferas 7e-52
d1m3ua_262 c.1.12.8 (A:) Ketopantoate hydroxymethyltransferas 5e-51
d1o66a_260 c.1.12.8 (A:) Ketopantoate hydroxymethyltransferas 2e-48
d2p10a1197 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 1e-07
d1muma_289 c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichi 2e-06
d1s2wa_275 c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mus 5e-05
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 262 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: Ketopantoate hydroxymethyltransferase PanB
domain: Ketopantoate hydroxymethyltransferase PanB
species: Mycobacterium tuberculosis [TaxId: 1773]

 Score =  169 bits (428), Expect = 7e-52
 Identities = 96/216 (44%), Positives = 134/216 (62%), Gaps = 2/216 (0%)

Query: 78  RVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITL 137
           ++   HL++   +G    M+TAYDY +A   D AGI + LVGDSAA VV+G+DTT+PI++
Sbjct: 3   KIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISI 62

Query: 138 EEMLVHCRAVARGAKRPLLVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSR 197
           +E++   R V RGA   L+V DLPFG+YE+    A+  A R LK+GG  A+K   G    
Sbjct: 63  DELIPLVRGVVRGAPHALVVADLPFGSYEAGPTAALAAATRFLKDGGAHAVK-LEGGERV 121

Query: 198 ITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNVTSAVKVVETALALQEVGCFSVV 257
                 +  AGI VM H+G TPQ+++ LGGFR QG+   +   + +  +A+ E G F+VV
Sbjct: 122 AEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGDAAEQTIADA-IAVAEAGAFAVV 180

Query: 258 LECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF 293
           +E VP  +A   T  L IPT+GIGAGP C GQV  +
Sbjct: 181 MEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVW 216
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Length = 262 Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Length = 260 Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Length = 197 Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Length = 289 Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 275 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query293
d1oy0a_262 Ketopantoate hydroxymethyltransferase PanB {Mycoba 100.0
d1m3ua_262 Ketopantoate hydroxymethyltransferase PanB {Escher 100.0
d1o66a_260 Ketopantoate hydroxymethyltransferase PanB {Neisse 100.0
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 100.0
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 99.97
d1f61a_418 Isocitrate lyase {Mycobacterium tuberculosis [TaxI 99.88
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 99.86
d2p10a1197 Uncharacterized protein Mll9387 {Mesorhizobium lot 99.85
d1dqua_ 519 Isocitrate lyase {Aspergillus nidulans [TaxId: 162 99.49
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 96.2
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 96.08
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 95.99
d1vrda1330 Inosine monophosphate dehydrogenase (IMPDH) {Therm 95.93
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 95.88
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 95.85
d1jfla1115 Aspartate racemase {Archaeon Pyrococcus horikoshii 95.37
d1muma_289 2-methylisocitrate lyase {Escherichia coli [TaxId: 95.36
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 94.85
d1xxxa1296 Dihydrodipicolinate synthase {Mycobacterium tuberc 94.81
d1pvna1362 Inosine monophosphate dehydrogenase (IMPDH) {Tritr 94.26
d1xkya1292 Dihydrodipicolinate synthase {Bacillus anthracis [ 94.12
d1o5ka_ 295 Dihydrodipicolinate synthase {Thermotoga maritima 94.03
d1s2wa_275 Phosphoenolpyruvate mutase {Blue mussel (Mytilus e 94.02
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 93.8
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 93.77
d1gvfa_284 Tagatose-1,6-bisphosphate aldolase {Escherichia co 93.48
d1xkya1 292 Dihydrodipicolinate synthase {Bacillus anthracis [ 93.38
d1f74a_ 293 N-acetylneuraminate lyase {Haemophilus influenzae 93.23
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 93.22
d1y0ea_222 Putative N-acetylmannosamine-6-phosphate 2-epimera 92.91
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 92.84
d2a6na1292 Dihydrodipicolinate synthase {Escherichia coli [Ta 92.81
d1z41a1337 NADPH dehydrogenase NamA {Bacillus subtilis [TaxId 92.79
d1izca_299 Macrophomate synthase {Macrophoma commelinae [TaxI 92.78
d1o5ka_295 Dihydrodipicolinate synthase {Thermotoga maritima 92.67
d1xxxa1 296 Dihydrodipicolinate synthase {Mycobacterium tuberc 92.48
d1gtea2312 Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su 92.26
d1f74a_293 N-acetylneuraminate lyase {Haemophilus influenzae 92.2
d1yxya1230 Putative N-acetylmannosamine-6-phosphate 2-epimera 91.84
d2c1ha1 319 5-aminolaevulinate dehydratase, ALAD (porphobilino 91.51
d1lt7a_ 361 Betaine-homocysteine S-methyltransferase {Human (H 91.45
d1ujpa_271 Trp synthase alpha-subunit {Thermus thermophilus [ 91.43
d1dxea_253 2-dehydro-3-deoxy-galactarate aldolase {Escherichi 91.38
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 91.34
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 91.26
d2tpsa_226 Thiamin phosphate synthase {Bacillus subtilis [Tax 91.23
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 91.2
d2dvta1325 Thermophilic reversible gamma-resorcylate decarbox 91.04
d2a6na1 292 Dihydrodipicolinate synthase {Escherichia coli [Ta 91.02
d1w3ia_ 293 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus 90.84
d1ub3a_211 Deoxyribose-phosphate aldolase DeoC {Thermus therm 90.75
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 90.39
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 89.83
d1eepa_388 Inosine monophosphate dehydrogenase (IMPDH) {Lyme 89.59
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 89.46
d1ojxa_251 Archaeal fructose 1,6-bisphosphate aldolase {Archa 89.3
d2f6ka1306 Putative amidohydrolase LP2961 {Lactobacillus plan 89.0
d1rd5a_261 Trp synthase alpha-subunit {Maize (Zea mays) [TaxI 88.97
d1rvga_305 Fructose-bisphosphate aldolase (FBP aldolase) {The 88.93
d1to3a_291 Putative aldolase YihT {Salmonella typhimurium [Ta 88.91
d1zfja1365 Inosine monophosphate dehydrogenase (IMPDH) {Strep 88.62
d1mzha_225 Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli 87.83
d1jr1a1378 Inosine monophosphate dehydrogenase (IMPDH) {Chine 87.82
d1gzga_329 5-aminolaevulinate dehydratase, ALAD (porphobilino 87.53
d2c1ha1319 5-aminolaevulinate dehydratase, ALAD (porphobilino 87.17
d1geha1 307 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 86.93
d1sfla_236 Type I 3-dehydroquinate dehydratase {Staphylococcu 86.51
d1ykwa1 283 Ribulose 1,5-bisphosphate carboxylase-oxygenase {C 86.5
d2cu0a1368 Inosine monophosphate dehydrogenase (IMPDH) {Pyroc 86.34
d1m3ua_ 262 Ketopantoate hydroxymethyltransferase PanB {Escher 86.16
d1hl2a_295 N-acetylneuraminate lyase {Escherichia coli [TaxId 86.13
d1vcfa1310 Isopentenyl-diphosphate delta-isomerase {Thermus t 86.06
d1pv8a_320 5-aminolaevulinate dehydratase, ALAD (porphobilino 86.0
d1tb3a1349 Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI 85.94
d1hl2a_ 295 N-acetylneuraminate lyase {Escherichia coli [TaxId 85.87
d1o0ya_251 Deoxyribose-phosphate aldolase DeoC {Thermotoga ma 85.77
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 84.77
d1l6sa_323 5-aminolaevulinate dehydratase, ALAD (porphobilino 84.64
d2d69a1 291 Ribulose 1,5-bisphosphate carboxylase-oxygenase {A 84.19
d2gwga1342 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas 83.96
d1h7na_340 5-aminolaevulinate dehydratase, ALAD (porphobilino 83.71
d1vhna_305 Putative flavin oxidoreducatase TM0096 {Thermotoga 83.58
d1rvka1 255 Hypothetical protein Atu3453 {Agrobacterium tumefa 83.33
d1wdda1 325 Ribulose 1,5-bisphosphate carboxylase-oxygenase {R 82.82
d1vyra_363 Pentaerythritol tetranirate reductase {Enterobacte 82.25
d1gqna_252 Type I 3-dehydroquinate dehydratase {Salmonella ty 81.97
d1twda_247 Copper homeostasis protein CutC {Shigella flexneri 81.94
d1p0ka_329 Isopentenyl-diphosphate delta-isomerase {Bacillus 81.66
d1p4ca_353 Membrane-associated (S)-mandelate dehydrogenase {P 80.92
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 80.73
d1geqa_248 Trp synthase alpha-subunit {Archaeon Pyrococcus fu 80.71
d2hbva1331 2-amino-3-carboxymuconate 6-semialdehyde decarboxy 80.61
d1gzga_ 329 5-aminolaevulinate dehydratase, ALAD (porphobilino 80.59
d1u83a_249 (2r)-phospho-3-sulfolactate synthase ComA {Bacillu 80.56
d1igwa_416 Isocitrate lyase {Escherichia coli [TaxId: 562]} 80.3
d1ps9a1330 2,4-dienoyl-CoA reductase, N-terminal domain {Esch 80.25
>d1oy0a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: Phosphoenolpyruvate/pyruvate domain
family: Ketopantoate hydroxymethyltransferase PanB
domain: Ketopantoate hydroxymethyltransferase PanB
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=2.9e-75  Score=537.13  Aligned_cols=216  Identities=47%  Similarity=0.794  Sum_probs=195.8

Q ss_pred             CCcCCHHHHHHhhhCCCcEEEEecCCHHHHHHHHHcCCcEEEECchhhhhhccCCCCccCCHHHHHHHHHHHHcccCCCe
Q 022677           76 NQRVTLTHLRQKHKNGEPITMVTAYDYPSAVHLDSAGIDICLVGDSAAMVVHGHDTTLPITLEEMLVHCRAVARGAKRPL  155 (293)
Q Consensus        76 ~~~~t~~~Lr~l~~~g~pi~m~tayD~~SAriae~AG~DailvGdSla~~~lG~~dt~~vtl~eml~h~raV~Ra~~~p~  155 (293)
                      +||+|+.+|++++++|+||+|+||||+++|+++|++|+|+||||||++|+.+||++|.++|+|||++|+++|+|+++++|
T Consensus         1 r~k~ti~~l~~~K~~g~ki~~lTaYD~~~A~~~~~agiDiiLVGDSlgmv~~G~~~T~~Vt~d~m~~H~~aV~rga~~~~   80 (262)
T d1oy0a_           1 RTKIRTHHLQRWKADGHKWAMLTAYDYSTARIFDEAGIPVLLVGDSAANVVYGYDTTVPISIDELIPLVRGVVRGAPHAL   80 (262)
T ss_dssp             CCCCCHHHHHHHHHHTCCEEEEECCSHHHHHHHHTTTCCEEEECTTHHHHTTCCSSSSSCCGGGTHHHHHHHHHHCTTSE
T ss_pred             CCcccHHHHHHHHhCCCcEEEEeCCCHHHHHHHHHcCCCEEEEcCchhhhhcCCCCcceeeHHHHHHHHHHHHhccccce
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeCCCCCCCCCHHHHHHHHHHHHHHhCCCEEEeCCCCCCcHHHHHHHHHcCCcEEEeccccceeeeecCCcccccCCH
Q 022677          156 LVGDLPFGTYESSTNQAVDTAVRILKEGGMDAIKLEGGSPSRITAARGIVEAGIAVMGHVGLTPQAISVLGGFRPQGKNV  235 (293)
Q Consensus       156 vvaDmpfGsy~~s~e~av~~A~rl~keaGa~gVkiEgg~~~~~~~ikal~~~GIpV~GHiGLtPq~~~~lgGf~vqGrt~  235 (293)
                      +++|||||+|+.|.+++++||.|+++++||++|||||+.+ ..++|++|+++|||||||+||+||+.+++||||+|||++
T Consensus        81 iv~DmPf~s~~~s~~~a~~nA~r~~~~~ga~avkleg~~~-~~~~I~~L~~~gIPV~gHiGLtPQ~~~~~Gg~r~~Gk~~  159 (262)
T d1oy0a_          81 VVADLPFGSYEAGPTAALAAATRFLKDGGAHAVKLEGGER-VAEQIACLTAAGIPVMAHIGFTPQSVNTLGGFRVQGRGD  159 (262)
T ss_dssp             EEEECCTTSSTTCHHHHHHHHHHHHHTTCCSEEEEEBSGG-GHHHHHHHHHHTCCEEEEEECCC--------------CH
T ss_pred             eEecchhhhcccchHHHHHHHHHHHhccccceeeechhhh-hHHHHHHHHhcCCceEEeeeecceeeeecCccceeccch
Confidence            9999999999999999999999999999999999999875 578899999999999999999999999999999999986


Q ss_pred             HHHHHHHHHHHHHHHcCCcEEEecCCCHHHHHHHHHhcCCCEEEeCCCCCCCceeeeC
Q 022677          236 TSAVKVVETALALQEVGCFSVVLECVPPPVAAAATSALQIPTIGIGAGPFCSGQVSFF  293 (293)
Q Consensus       236 ~~a~e~l~rA~a~eeAGA~~IvlE~vp~e~a~~It~~l~iPtIGIGaG~~~dGQvLV~  293 (293)
                      + +.+++++|+++|+||||+|++||||+++++.|+++++|||||||||++|||||||+
T Consensus       160 ~-~~~l~~da~~le~AGa~~ivlE~Vp~~la~~It~~~~IPtIGIGAG~~cDGQvLV~  216 (262)
T d1oy0a_         160 A-AEQTIADAIAVAEAGAFAVVMEMVPAELATQITGKLTIPTVGIGAGPNCDGQVLVW  216 (262)
T ss_dssp             H-HHHHHHHHHHHHHHTCSEEEEESCCHHHHHHHHHHCSSCEEEESSCSCSSEEEECH
T ss_pred             h-hhHhHHHHHHHHhCCcEEEecccccHhHHHHHHhhCCceEEEeccCCCCCeeEEeH
Confidence            5 57999999999999999999999999999999999999999999999999999984
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o66a_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1f61a_ c.1.12.7 (A:) Isocitrate lyase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p10a1 c.1.12.9 (A:8-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1dqua_ c.1.12.7 (A:) Isocitrate lyase {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1jfla1 c.78.2.1 (A:1-115) Aspartate racemase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1muma_ c.1.12.7 (A:) 2-methylisocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s2wa_ c.1.12.7 (A:) Phosphoenolpyruvate mutase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1gvfa_ c.1.10.2 (A:) Tagatose-1,6-bisphosphate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkya1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z41a1 c.1.4.1 (A:2-338) NADPH dehydrogenase NamA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1izca_ c.1.12.5 (A:) Macrophomate synthase {Macrophoma commelinae [TaxId: 108330]} Back     information, alignment and structure
>d1o5ka_ c.1.10.1 (A:) Dihydrodipicolinate synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xxxa1 c.1.10.1 (A:5-300) Dihydrodipicolinate synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1f74a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Back     information, alignment and structure
>d1lt7a_ c.1.26.1 (A:) Betaine-homocysteine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dxea_ c.1.12.5 (A:) 2-dehydro-3-deoxy-galactarate aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2tpsa_ c.1.3.1 (A:) Thiamin phosphate synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2dvta1 c.1.9.15 (A:1-325) Thermophilic reversible gamma-resorcylate decarboxylase {Rhizobium sp. MTP-10005 [TaxId: 267998]} Back     information, alignment and structure
>d2a6na1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ia_ c.1.10.1 (A:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ojxa_ c.1.10.1 (A:) Archaeal fructose 1,6-bisphosphate aldolase {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d2f6ka1 c.1.9.15 (A:2-307) Putative amidohydrolase LP2961 {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1rvga_ c.1.10.2 (A:) Fructose-bisphosphate aldolase (FBP aldolase) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1to3a_ c.1.10.1 (A:) Putative aldolase YihT {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1jr1a1 c.1.5.1 (A:17-112,A:233-514) Inosine monophosphate dehydrogenase (IMPDH) {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2c1ha1 c.1.10.3 (A:10-328) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Prosthecochloris vibrioformis [TaxId: 1098]} Back     information, alignment and structure
>d1geha1 c.1.14.1 (A:137-443) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1sfla_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ykwa1 c.1.14.1 (A:146-428) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2cu0a1 c.1.5.1 (A:3-96,A:207-480) Inosine monophosphate dehydrogenase (IMPDH) {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pv8a_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hl2a_ c.1.10.1 (A:) N-acetylneuraminate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l6sa_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d69a1 c.1.14.1 (A:134-424) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gwga1 c.1.9.15 (A:1-342) 4-oxalomesaconate hydratase LigJ {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1h7na_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhna_ c.1.4.1 (A:) Putative flavin oxidoreducatase TM0096 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rvka1 c.1.11.2 (A:127-381) Hypothetical protein Atu3453 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1wdda1 c.1.14.1 (A:151-475) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1gqna_ c.1.10.1 (A:) Type I 3-dehydroquinate dehydratase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1twda_ c.1.30.1 (A:) Copper homeostasis protein CutC {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2hbva1 c.1.9.15 (A:3-333) 2-amino-3-carboxymuconate 6-semialdehyde decarboxylase NbaD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1gzga_ c.1.10.3 (A:) 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u83a_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1igwa_ c.1.12.7 (A:) Isocitrate lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a1 c.1.4.1 (A:1-330) 2,4-dienoyl-CoA reductase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure