Citrus Sinensis ID: 022757

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--

MLMSLLTLLRLSFLTVMVIIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLTVTEEEIFASSFAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSGVTSLSMLQSPNNSIQPDFYTNKISDFLSLKAAAV

cHHHHHHcccEEEEEcccEEEEcccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHcccccccccEEcHHHHHHHHHHccccccccEEEEEccHHHHHHHHHcccEEEcccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHcccccEEEEEcccccccccccccccccHHHHHHHHHHHcccccEEccccHHHHHHHHHHHccccccEEEEcccHHHHHHHHHHccccEEEEccccccHHHHccccccccccEEEccHHHHHHHHHHcc

cHHHHHHcccEEEEEcccEEEccccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHcccEEEcccccccccccccccccccccccccEEEEEccccccHHHHHHHHHHHHHccccEEEEEccccccccccccccccccHHHHHHHHHcccccEEEccccHHHHHHHHHHccccHccEEEEcccccccHHHcccccccEEEEEcccccHHHHHcccccccccEEcccHHHHHHHHHccc

MLMSLLTLLRLSFLTVMVIIWKgdklidgvpETLDMLRSKGKRLVFVtnnstksrkQYGKKFETLGLTVTEEEIFASSFAAAAYLksidfpkdkkvyvvGEDGILKELELAgfqylggpedggkkielkpgflmehdkdvgavVVGFDRYFNYYKVQYGTlcirenpgclfiatnrDAVTHLtdaqewagggsmvgafvgstqreplvvgkpstFMMDYLANKFgiqksqicmvgdrldtdilfgqnggckTLLVLSGVtslsmlqspnnsiqpdfytnkisDFLSLKAAAV

MLMSLLTLLRLSFLTVMVIIWKGDKLIDGVPETLDmlrskgkrlvfvtnnstksrkqygkKFETLGLTVTEEEIFASSFAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSGVTSLSMLQSpnnsiqpdfytnKISDFLSLKAAAV

mlmslltllrlsfltVMVIIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLTVTEEEIfassfaaaaYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDILFGQNGGCKtllvlsgvtslsmlQSPNNSIQPDFYTNKISDFLSLKAAAV

***SLLTLLRLSFLTVMVIIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNS****KQYGKKFETLGLTVTEEEIFASSFAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSGVTSLSML*********DFYTNKISDF********

***SLLTLLRLSFLTVMVIIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLTVTEEEIFASSFAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSGVTSLSMLQSPNNSIQPDFYTNKISDFLSLKAAA*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		292	2.2.26 [Sep-21-2011]
Q2T9S4		321	Phosphoglycolate phosphat	yes	no	0.880	0.800	0.387	1e-47
Q8CHP8		321	Phosphoglycolate phosphat	yes	no	0.876	0.797	0.386	3e-45
A6NDG6		321	Phosphoglycolate phosphat	yes	no	0.893	0.813	0.375	4e-44
Q8VD52		309	Pyridoxal phosphate phosp	no	no	0.859	0.812	0.356	2e-43
Q3ZBF9		296	Pyridoxal phosphate phosp	no	no	0.869	0.858	0.344	9e-42
Q96GD0		296	Pyridoxal phosphate phosp	no	no	0.869	0.858	0.343	4e-41
Q00472		298	4-nitrophenylphosphatase	yes	no	0.876	0.859	0.358	5e-41
P60487		292	Pyridoxal phosphate phosp	no	no	0.859	0.859	0.338	6e-41
P19881		312	4-nitrophenylphosphatase	yes	no	0.893	0.836	0.372	2e-38
Q5F4B1		312	Phosphoglycolate phosphat	no	no	0.910	0.852	0.363	9e-37

>sp\|Q2T9S4\|PGP_BOVIN Phosphoglycolate phosphatase OS=Bos taurus GN=PGP PE=2 SV=1	Back alignment and function desciption

 Score =  190 bits (482), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 112/289 (38%), Positives = 163/289 (56%), Gaps = 32/289 (11%)

Query: 19  IIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLTVTE-----EE 73
           ++W+G+  + G PETL  LR++GKRL F+TNNS+K+R+ Y +K   LG           E
Sbjct: 38  VLWRGETAVPGAPETLTALRARGKRLAFITNNSSKTREAYAEKLRCLGFGAPAGPDAGRE 97

Query: 74  IFASSFAAAAYLKS-IDFPKDKKVYVVGEDGILKELELAGFQYLG-GPE----DGGKKIE 127
           +F +++  A YL+  +  P   K YV+G   +  ELE  G   +G GPE    DG     
Sbjct: 98  VFGTAYCTALYLRQRLTGPPAPKAYVLGSVALAAELEAVGVSCVGVGPEPLLGDG----- 152

Query: 128 LKPGFLMEH--DKDVGAVVVGFDRYFNYYKVQYGTLCIR--ENPGCLFIATNRDAVTHLT 183
             PG  ++   + DV AVVVGFD +F+Y K+   T  +R  + P CL + TN D    L 
Sbjct: 153 --PGAWLDAPLEPDVRAVVVGFDPHFSYMKL---TKAVRYLQQPDCLLVGTNMDNRLPLE 207

Query: 184 DAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDIL 243
           + +  AG G +V A   + QR+  ++GKPS F+ D ++ ++GI   +  MVGDRLDTDIL
Sbjct: 208 NGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGIHPERTVMVGDRLDTDIL 267

Query: 244 FGQNGGCKTLLVLSGVTSLSMLQSPNNS-------IQPDFYTNKISDFL 285
            G   G KT+L L+GV+SL  ++S   S       + PDFY + I+D L
Sbjct: 268 LGVTCGLKTILTLTGVSSLRDVKSNQESDCMAKKKMVPDFYVDSIADLL 316

Bos taurus (taxid: 9913)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 8

>sp\|Q8CHP8\|PGP_MOUSE Phosphoglycolate phosphatase OS=Mus musculus GN=Pgp PE=2 SV=1	Back alignment and function description

>sp\|A6NDG6\|PGP_HUMAN Phosphoglycolate phosphatase OS=Homo sapiens GN=PGP PE=1 SV=1	Back alignment and function description

>sp\|Q8VD52\|PLPP_RAT Pyridoxal phosphate phosphatase OS=Rattus norvegicus GN=Pdxp PE=1 SV=2	Back alignment and function description

>sp\|Q3ZBF9\|PLPP_BOVIN Pyridoxal phosphate phosphatase OS=Bos taurus GN=PDXP PE=1 SV=1	Back alignment and function description

>sp\|Q96GD0\|PLPP_HUMAN Pyridoxal phosphate phosphatase OS=Homo sapiens GN=PDXP PE=1 SV=2	Back alignment and function description

>sp\|Q00472\|PNPP_SCHPO 4-nitrophenylphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pho2 PE=4 SV=2	Back alignment and function description

>sp\|P60487\|PLPP_MOUSE Pyridoxal phosphate phosphatase OS=Mus musculus GN=Pdxp PE=1 SV=1	Back alignment and function description

>sp\|P19881\|PNPP_YEAST 4-nitrophenylphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO13 PE=1 SV=2	Back alignment and function description

>sp\|Q5F4B1\|PGP_CHICK Phosphoglycolate phosphatase OS=Gallus gallus GN=PGP PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		292
357507859		367	Phosphoglycolate phosphatase [Medicago t	0.938	0.746	0.937	1e-151
217072758		367	unknown [Medicago truncatula]	0.938	0.746	0.937	1e-151
224109186		308	predicted protein [Populus trichocarpa]	0.938	0.889	0.974	1e-149
118486367		371	unknown [Populus trichocarpa] gi\|1184876	0.938	0.738	0.970	1e-148
356531866		369	PREDICTED: phosphoglycolate phosphatase-	0.938	0.742	0.956	1e-148
449442663		376	PREDICTED: phosphoglycolate phosphatase-	0.938	0.728	0.956	1e-148
255547472		360	4-nitrophenylphosphatase, putative [Rici	0.938	0.761	0.956	1e-148
357507861		385	Phosphoglycolate phosphatase [Medicago t	0.938	0.711	0.880	1e-148
356568529		368	PREDICTED: phosphoglycolate phosphatase-	0.938	0.744	0.948	1e-147
255634458		369	unknown [Glycine max]	0.938	0.742	0.952	1e-147

>gi\|357507859\|ref\|XP_003624218.1\| Phosphoglycolate phosphatase [Medicago truncatula] gi\|355499233\|gb\|AES80436.1\| Phosphoglycolate phosphatase [Medicago truncatula]	Back alignment and taxonomy information

 Score =  541 bits (1393), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 257/274 (93%), Positives = 266/274 (97%)

Query: 19  IIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLTVTEEEIFASS 78
           +IWKGD LI+GVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGL V  EEIFASS
Sbjct: 94  VIWKGDSLIEGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLNVNAEEIFASS 153

Query: 79  FAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDK 138
           FA AAYLKSIDFPKDKKVYV+GEDGILKELELAG+QY+GGPEDGGKKIELKPGFLMEHD+
Sbjct: 154 FAVAAYLKSIDFPKDKKVYVIGEDGILKELELAGYQYVGGPEDGGKKIELKPGFLMEHDE 213

Query: 139 DVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAF 198
           DVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGA 
Sbjct: 214 DVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAL 273

Query: 199 VGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSG 258
           VGSTQREPLVVGKPSTFMMDYLAN+FGI KSQICMVGDRLDTDILFGQNGGCKTLLVLSG
Sbjct: 274 VGSTQREPLVVGKPSTFMMDYLANEFGISKSQICMVGDRLDTDILFGQNGGCKTLLVLSG 333

Query: 259 VTSLSMLQSPNNSIQPDFYTNKISDFLSLKAAAV 292
           VT+L +LQSPNNSIQPDFYTNKISDFLSLKAAAV
Sbjct: 334 VTTLPVLQSPNNSIQPDFYTNKISDFLSLKAAAV 367

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|217072758\|gb\|ACJ84739.1\| unknown [Medicago truncatula]	Back alignment and taxonomy information

>gi\|224109186\|ref\|XP_002315115.1\| predicted protein [Populus trichocarpa] gi\|222864155\|gb\|EEF01286.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|118486367\|gb\|ABK95024.1\| unknown [Populus trichocarpa] gi\|118487622\|gb\|ABK95636.1\| unknown [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356531866\|ref\|XP_003534497.1\| PREDICTED: phosphoglycolate phosphatase-like [Glycine max]	Back alignment and taxonomy information

>gi\|449442663\|ref\|XP_004139100.1\| PREDICTED: phosphoglycolate phosphatase-like [Cucumis sativus] gi\|449485338\|ref\|XP_004157138.1\| PREDICTED: phosphoglycolate phosphatase-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255547472\|ref\|XP_002514793.1\| 4-nitrophenylphosphatase, putative [Ricinus communis] gi\|223545844\|gb\|EEF47347.1\| 4-nitrophenylphosphatase, putative [Ricinus communis]	Back alignment and taxonomy information

>gi\|357507861\|ref\|XP_003624219.1\| Phosphoglycolate phosphatase [Medicago truncatula] gi\|355499234\|gb\|AES80437.1\| Phosphoglycolate phosphatase [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356568529\|ref\|XP_003552463.1\| PREDICTED: phosphoglycolate phosphatase-like [Glycine max]	Back alignment and taxonomy information

>gi\|255634458\|gb\|ACU17594.1\| unknown [Glycine max]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		292
TAIR\|locus:2147371		362	PGLP1 "2-phosphoglycolate phos	0.938	0.756	0.832	3.5e-123
TAIR\|locus:2149099		362	AT5G36790 [Arabidopsis thalian	0.938	0.756	0.832	3.5e-123
TAIR\|locus:2160937		301	PGLP2 "2-phosphoglycolate phos	0.921	0.893	0.618	3.5e-91
GENEDB_PFALCIPARUM\|PF07_0059		322	PF07_0059 "4-nitrophenylphosph	0.910	0.826	0.398	1.1e-48
UNIPROTKB\|Q8IBV0		322	PF07_0059 "4-nitrophenylphosph	0.910	0.826	0.398	1.1e-48
DICTYBASE\|DDB_G0284737		303	DDB_G0284737 "putative phospho	0.890	0.858	0.368	6.4e-44
ZFIN\|ZDB-GENE-030131-6240		306	pgp "phosphoglycolate phosphat	0.904	0.862	0.360	5.3e-40
ASPGD\|ASPL0000040358		308	AN2970 [Emericella nidulans (t	0.900	0.853	0.362	1.4e-39
ZFIN\|ZDB-GENE-080723-69		308	zgc:194409 "zgc:194409" [Danio	0.904	0.857	0.346	1.6e-38
CGD\|CAL0001845		308	PHO15 [Candida albicans (taxid	0.914	0.866	0.355	1.1e-37

TAIR\|locus:2147371 PGLP1 "2-phosphoglycolate phosphatase 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1211 (431.4 bits), Expect = 3.5e-123, P = 3.5e-123
 Identities = 228/274 (83%), Positives = 242/274 (88%)

Query:    19 IIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLTVTEEEIXXXX 78
             +IWKGDKLI+GVPETLDMLR+KGKRLVFVTNNSTKSRKQYGKKFETLGL V EEEI    
Sbjct:    89 VIWKGDKLIEGVPETLDMLRAKGKRLVFVTNNSTKSRKQYGKKFETLGLNVNEEEIFASS 148

Query:    79 XXXXXYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDK 138
                  YL+SI+FPKDKKVYV+GE+GILKELELAGFQYLGGP+DG ++IELKPGFLMEHD 
Sbjct:   149 FAAAAYLQSINFPKDKKVYVIGEEGILKELELAGFQYLGGPDDGKRQIELKPGFLMEHDH 208

Query:   139 DVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAF 198
             DVGAVVVGFDRYFNYYK+QYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGA 
Sbjct:   209 DVGAVVVGFDRYFNYYKIQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAL 268

Query:   199 VGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDILFGQNGGCKXXXXXXX 258
             VGSTQREPLVVGKPSTFMMDYLA+KFGIQKSQICMVGDRLDTDILFGQNGGCK       
Sbjct:   269 VGSTQREPLVVGKPSTFMMDYLADKFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSG 328

Query:   259 XXXXXXXQSPNNSIQPDFYTNKISDFLSLKAAAV 292
                    +SP N IQPDFYT+KISDFLS KAA V
Sbjct:   329 VTSISMLESPENKIQPDFYTSKISDFLSPKAATV 362

GO:0008152 "metabolic process" evidence=IEA

GO:0008967 "phosphoglycolate phosphatase activity" evidence=ISS;IMP

GO:0009507 "chloroplast" evidence=ISM;IDA

GO:0016787 "hydrolase activity" evidence=IEA

GO:0016791 "phosphatase activity" evidence=IEA

GO:0009570 "chloroplast stroma" evidence=IDA

GO:0005829 "cytosol" evidence=RCA

TAIR\|locus:2149099 AT5G36790 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2160937 PGLP2 "2-phosphoglycolate phosphatase 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

GENEDB_PFALCIPARUM\|PF07_0059 PF07_0059 "4-nitrophenylphosphatase, putative" [Plasmodium falciparum (taxid:5833)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8IBV0 PF07_0059 "4-nitrophenylphosphatase, putative" [Plasmodium falciparum 3D7 (taxid:36329)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0284737 DDB_G0284737 "putative phosphoric monoester hydrolase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-030131-6240 pgp "phosphoglycolate phosphatase" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

ASPGD\|ASPL0000040358 AN2970 [Emericella nidulans (taxid:162425)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-080723-69 zgc:194409 "zgc:194409" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

CGD\|CAL0001845 PHO15 [Candida albicans (taxid:5476)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q2T9S4	PGP_BOVIN	3, ., 1, ., 3, ., 1, 8	0.3875	0.8801	0.8006	yes	no
Q00472	PNPP_SCHPO	3, ., 1, ., 3, ., 4, 1	0.3589	0.8767	0.8590	yes	no
A6NDG6	PGP_HUMAN	3, ., 1, ., 3, ., 1, 8	0.3754	0.8938	0.8130	yes	no
P19881	PNPP_YEAST	3, ., 1, ., 3, ., 4, 1	0.3723	0.8938	0.8365	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.1.3	0.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	gw1.X.1500.1	SubName- Full=Putative uncharacterized protein; (303 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
	fgenesh4_pg.C_scaffold_120000092	hypothetical protein (308 aa)	•	0.461

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		292
PLN02645		311	PLN02645, PLN02645, phosphoglycolate phosphatase	0.0
TIGR01452		279	TIGR01452, PGP_euk, phosphoglycolate/pyridoxal pho	1e-119
COG0647		269	COG0647, NagD, Predicted sugar phosphatases of the	1e-66
TIGR01460		236	TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Super	3e-61
TIGR01457		249	TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfam	7e-39
pfam13344		101	pfam13344, Hydrolase_6, Haloacid dehalogenase-like	9e-36
PRK10444		248	PRK10444, PRK10444, UMP phosphatase; Provisional	2e-26
pfam13242		74	pfam13242, Hydrolase_like, HAD-hyrolase-like	3e-19
TIGR01458		257	TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfam	4e-13
cd01427		139	cd01427, HAD_like, Haloacid dehalogenase-like hydr	1e-11
cd01427		139	cd01427, HAD_like, Haloacid dehalogenase-like hydr	1e-10
COG0546		220	COG0546, Gph, Predicted phosphatases [General func	2e-07
COG0241		181	COG0241, HisB, Histidinol phosphatase and related	6e-06
TIGR01668		170	TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfam	9e-06
COG1011		229	COG1011, COG1011, Predicted hydrolase (HAD superfa	2e-05
TIGR01662		132	TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase,	2e-05
pfam00702		187	pfam00702, Hydrolase, haloacid dehalogenase-like h	3e-05
COG2179		175	COG2179, COG2179, Predicted hydrolase of the HAD s	7e-05
PRK06769		173	PRK06769, PRK06769, hypothetical protein; Validate	9e-05
PRK08942		181	PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate p	3e-04
PRK13222		226	PRK13222, PRK13222, phosphoglycolate phosphatase;	4e-04
PRK13288		214	PRK13288, PRK13288, pyrophosphatase PpaX; Provisio	4e-04
TIGR02253		221	TIGR02253, CTE7, HAD superfamily (subfamily IA) hy	0.002
pfam09419		166	pfam09419, PGP_phosphatase, Mitochondrial PGP phos	0.002

>gnl\|CDD\|178251 PLN02645, PLN02645, phosphoglycolate phosphatase	Back alignment and domain information

 Score =  595 bits (1535), Expect = 0.0
 Identities = 246/274 (89%), Positives = 260/274 (94%)

Query: 19  IIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFETLGLTVTEEEIFASS 78
           +IWKGDKLI+GVPETLDMLRS GK+LVFVTNNSTKSR QYGKKFE+LGL VTEEEIF+SS
Sbjct: 38  VIWKGDKLIEGVPETLDMLRSMGKKLVFVTNNSTKSRAQYGKKFESLGLNVTEEEIFSSS 97

Query: 79  FAAAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDK 138
           FAAAAYLKSI+FPKDKKVYV+GE+GIL+ELELAGFQYLGGPEDG KKIELKPGFLMEHDK
Sbjct: 98  FAAAAYLKSINFPKDKKVYVIGEEGILEELELAGFQYLGGPEDGDKKIELKPGFLMEHDK 157

Query: 139 DVGAVVVGFDRYFNYYKVQYGTLCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAF 198
           DVGAVVVGFDRY NYYK+QY TLCIRENPGCLFIATNRDAVTHLTDAQEWAG GSMVGA 
Sbjct: 158 DVGAVVVGFDRYINYYKIQYATLCIRENPGCLFIATNRDAVTHLTDAQEWAGAGSMVGAI 217

Query: 199 VGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDTDILFGQNGGCKTLLVLSG 258
            GST+REPLVVGKPSTFMMDYLANKFGI+KSQICMVGDRLDTDILFGQNGGCKTLLVLSG
Sbjct: 218 KGSTEREPLVVGKPSTFMMDYLANKFGIEKSQICMVGDRLDTDILFGQNGGCKTLLVLSG 277

Query: 259 VTSLSMLQSPNNSIQPDFYTNKISDFLSLKAAAV 292
           VTS SML SP N IQPDFYT+KISDFL+LKAA V
Sbjct: 278 VTSESMLLSPENKIQPDFYTSKISDFLTLKAATV 311

Length = 311

>gnl\|CDD\|233420 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal phosphate phosphatase family	Back alignment and domain information

>gnl\|CDD\|223720 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233422 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Superfamily Class (subfamily) IIA	Back alignment and domain information

>gnl\|CDD\|130524 TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfamily IIA hydrolase, TIGR01457	Back alignment and domain information

>gnl\|CDD\|205524 pfam13344, Hydrolase_6, Haloacid dehalogenase-like hydrolase	Back alignment and domain information

>gnl\|CDD\|182466 PRK10444, PRK10444, UMP phosphatase; Provisional	Back alignment and domain information

>gnl\|CDD\|222003 pfam13242, Hydrolase_like, HAD-hyrolase-like	Back alignment and domain information

>gnl\|CDD\|162372 TIGR01458, HAD-SF-IIA-hyp3, HAD-superfamily subfamily IIA hydrolase, TIGR01458	Back alignment and domain information

>gnl\|CDD\|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>gnl\|CDD\|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>gnl\|CDD\|223620 COG0546, Gph, Predicted phosphatases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223319 COG0241, HisB, Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|233519 TIGR01668, YqeG_hyp_ppase, HAD superfamily (subfamily IIIA) phosphatase, TIGR01668	Back alignment and domain information

>gnl\|CDD\|223943 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|233517 TIGR01662, HAD-SF-IIIA, HAD-superfamily hydrolase, subfamily IIIA	Back alignment and domain information

>gnl\|CDD\|216069 pfam00702, Hydrolase, haloacid dehalogenase-like hydrolase	Back alignment and domain information

>gnl\|CDD\|225090 COG2179, COG2179, Predicted hydrolase of the HAD superfamily [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|180686 PRK06769, PRK06769, hypothetical protein; Validated	Back alignment and domain information

>gnl\|CDD\|236354 PRK08942, PRK08942, D,D-heptose 1,7-bisphosphate phosphatase; Validated	Back alignment and domain information

>gnl\|CDD\|237310 PRK13222, PRK13222, phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>gnl\|CDD\|237336 PRK13288, PRK13288, pyrophosphatase PpaX; Provisional	Back alignment and domain information

>gnl\|CDD\|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253	Back alignment and domain information

>gnl\|CDD\|220230 pfam09419, PGP_phosphatase, Mitochondrial PGP phosphatase	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		292
COG0647		269	NagD Predicted sugar phosphatases of the HAD super	100.0
KOG2882		306	consensus p-Nitrophenyl phosphatase [Inorganic ion	100.0
PLN02645		311	phosphoglycolate phosphatase	100.0
PRK10444		248	UMP phosphatase; Provisional	100.0
TIGR01452		279	PGP_euk phosphoglycolate/pyridoxal phosphate phosp	100.0
TIGR01457		249	HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr	100.0
TIGR01458		257	HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr	100.0
KOG3040		262	consensus Predicted sugar phosphatase (HAD superfa	100.0
TIGR01456		321	CECR5 HAD-superfamily class IIA hydrolase, TIGR014	100.0
TIGR01460		236	HAD-SF-IIA Haloacid Dehalogenase Superfamily Class	100.0
TIGR01459		242	HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas	100.0
PF13344		101	Hydrolase_6: Haloacid dehalogenase-like hydrolase;	99.93
KOG1618		389	consensus Predicted phosphatase [General function	99.92
COG0546		220	Gph Predicted phosphatases [General function predi	99.87
PRK10748		238	flavin mononucleotide phosphatase; Provisional	99.86
PRK06769		173	hypothetical protein; Validated	99.86
PRK13226		229	phosphoglycolate phosphatase; Provisional	99.85
TIGR01422		253	phosphonatase phosphonoacetaldehyde hydrolase. Thi	99.85
TIGR02253		221	CTE7 HAD superfamily (subfamily IA) hydrolase, TIG	99.85
TIGR03351		220	PhnX-like phosphonatase-like hydrolase. This clade	99.85
PRK13288		214	pyrophosphatase PpaX; Provisional	99.84
PRK13478		267	phosphonoacetaldehyde hydrolase; Provisional	99.84
PLN03243		260	haloacid dehalogenase-like hydrolase; Provisional	99.84
TIGR00213		176	GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	99.84
PLN02770		248	haloacid dehalogenase-like hydrolase family protei	99.84
PRK10826		222	2-deoxyglucose-6-phosphatase; Provisional	99.83
TIGR01454		205	AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes	99.83
PRK08942		181	D,D-heptose 1,7-bisphosphate phosphatase; Validate	99.82
PRK13222		226	phosphoglycolate phosphatase; Provisional	99.82
PRK13223		272	phosphoglycolate phosphatase; Provisional	99.82
PF13242		75	Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OY	99.81
TIGR01449		213	PGP_bact 2-phosphoglycolate phosphatase, prokaryot	99.81
PLN02575		381	haloacid dehalogenase-like hydrolase	99.81
PRK11587		218	putative phosphatase; Provisional	99.8
PLN02940		382	riboflavin kinase	99.79
TIGR02254		224	YjjG/YfnB HAD superfamily (subfamily IA) hydrolase	99.79
COG1011		229	Predicted hydrolase (HAD superfamily) [General fun	99.79
COG0637		221	Predicted phosphatase/phosphohexomutase [General f	99.79
PLN02779		286	haloacid dehalogenase-like hydrolase family protei	99.79
PRK09449		224	dUMP phosphatase; Provisional	99.79
PRK10563		221	6-phosphogluconate phosphatase; Provisional	99.79
PRK13225		273	phosphoglycolate phosphatase; Provisional	99.78
PRK10530		272	pyridoxal phosphate (PLP) phosphatase; Provisional	99.78
TIGR01662		132	HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I	99.75
KOG3085		237	consensus Predicted hydrolase (HAD superfamily) [G	99.74
PRK10513		270	sugar phosphate phosphatase; Provisional	99.73
TIGR02252		203	DREG-2 REG-2-like, HAD superfamily (subfamily IA)	99.73
PRK10725		188	fructose-1-P/6-phosphogluconate phosphatase; Provi	99.73
PRK06698		459	bifunctional 5'-methylthioadenosine/S-adenosylhomo	99.73
PRK01158		230	phosphoglycolate phosphatase; Provisional	99.73
COG0561		264	Cof Predicted hydrolases of the HAD superfamily [G	99.73
PRK14988		224	GMP/IMP nucleotidase; Provisional	99.73
TIGR01656		147	Histidinol-ppas histidinol-phosphate phosphatase f	99.73
PRK10976		266	putative hydrolase; Provisional	99.72
PRK03669		271	mannosyl-3-phosphoglycerate phosphatase; Reviewed	99.7
TIGR01261		161	hisB_Nterm histidinol-phosphatase. This model desc	99.7
PRK15126		272	thiamin pyrimidine pyrophosphate hydrolase; Provis	99.7
TIGR01428		198	HAD_type_II 2-haloalkanoic acid dehalogenase, type	99.7
TIGR01668		170	YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph	99.69
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	99.69
PLN02887		580	hydrolase family protein	99.68
COG2179		175	Predicted hydrolase of the HAD superfamily [Genera	99.68
PRK09456		199	?-D-glucose-1-phosphatase; Provisional	99.68
TIGR01482		225	SPP-subfamily Sucrose-phosphate phosphatase subfam	99.67
TIGR01990		185	bPGM beta-phosphoglucomutase. The enzyme from L. l	99.67
TIGR01487		215	SPP-like sucrose-phosphate phosphatase-like hydrol	99.66
TIGR02009		185	PGMB-YQAB-SF beta-phosphoglucomutase family hydrol	99.66
TIGR01664		166	DNA-3'-Pase DNA 3'-phosphatase. The central phosph	99.66
TIGR02247		211	HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li	99.65
PHA02597		197	30.2 hypothetical protein; Provisional	99.64
COG0241		181	HisB Histidinol phosphatase and related phosphatas	99.63
PLN02811		220	hydrolase	99.63
cd01427		139	HAD_like Haloacid dehalogenase-like hydrolases. Th	99.63
TIGR00099		256	Cof-subfamily Cof subfamily of IIB subfamily of ha	99.61
PRK09484		183	3-deoxy-D-manno-octulosonate 8-phosphate phosphata	99.61
TIGR01993		184	Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These	99.61
TIGR01486		256	HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph	99.59
PRK00192		273	mannosyl-3-phosphoglycerate phosphatase; Reviewed	99.59
TIGR01670		154	YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho	99.57
TIGR01685		174	MDP-1 magnesium-dependent phosphatase-1. This mode	99.57
TIGR02726		169	phenyl_P_delta phenylphosphate carboxylase, delta	99.56
PF08282		254	Hydrolase_3: haloacid dehalogenase-like hydrolase;	99.56
TIGR01509		183	HAD-SF-IA-v3 haloacid dehalogenase superfamily, su	99.54
PRK05446		354	imidazole glycerol-phosphate dehydratase/histidino	99.52
TIGR02463		221	MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r	99.52
TIGR02471		236	sucr_syn_bact_C sucrose phosphate synthase, sucros	99.51
PHA02530		300	pseT polynucleotide kinase; Provisional	99.51
KOG2914		222	consensus Predicted haloacid-halidohydrolase and r	99.49
PLN02954		224	phosphoserine phosphatase	99.47
TIGR02461		225	osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat	99.46
TIGR00338		219	serB phosphoserine phosphatase SerB. Phosphoserine	99.44
TIGR01548		197	HAD-SF-IA-hyp1 haloacid dehalogenase superfamily,	99.43
TIGR01485		249	SPP_plant-cyano sucrose-6F-phosphate phosphohydrol	99.42
PRK10187		266	trehalose-6-phosphate phosphatase; Provisional	99.41
TIGR01493		175	HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su	99.41
TIGR01691		220	enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen	99.4
PF09419		168	PGP_phosphatase: Mitochondrial PGP phosphatase; In	99.38
TIGR01681		128	HAD-SF-IIIC HAD-superfamily phosphatase, subfamily	99.36
TIGR01672		237	AphA HAD superfamily (subfamily IIIB) phosphatase,	99.35
TIGR01484		204	HAD-SF-IIB HAD-superfamily hydrolase, subfamily II	99.33
TIGR01549		154	HAD-SF-IA-v1 haloacid dehalogenase superfamily, su	99.33
PRK11133		322	serB phosphoserine phosphatase; Provisional	99.29
PTZ00174		247	phosphomannomutase; Provisional	99.27
PRK11009		237	aphA acid phosphatase/phosphotransferase; Provisio	99.26
PRK12702		302	mannosyl-3-phosphoglycerate phosphatase; Reviewed	99.24
KOG3109		244	consensus Haloacid dehalogenase-like hydrolase [Ge	99.21
PRK14502		694	bifunctional mannosyl-3-phosphoglycerate synthase/	99.21
TIGR00685		244	T6PP trehalose-phosphatase. At least 18 distinct s	99.19
PF13419		176	HAD_2: Haloacid dehalogenase-like hydrolase; PDB:	99.18
PRK13582		205	thrH phosphoserine phosphatase; Provisional	99.18
TIGR01663		526	PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	99.17
PLN02382		413	probable sucrose-phosphatase	99.09
COG1778		170	Low specificity phosphatase (HAD superfamily) [Gen	99.08
PRK09552		219	mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp	99.03
TIGR01491		201	HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa	99.03
PF08645		159	PNK3P: Polynucleotide kinase 3 phosphatase; InterP	99.0
smart00577		148	CPDc catalytic domain of ctd-like phosphatases.	98.97
TIGR01686		320	FkbH FkbH-like domain. The C-terminal portion of t	98.97
PTZ00445		219	p36-lilke protein; Provisional	98.97
PLN02423		245	phosphomannomutase	98.95
PRK14501		726	putative bifunctional trehalose-6-phosphate syntha	98.93
PF05116		247	S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter	98.85
TIGR01684		301	viral_ppase viral phosphatase. These proteins also	98.84
TIGR03333		214	salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl	98.77
PLN02580		384	trehalose-phosphatase	98.76
TIGR01489		188	DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent	98.76
TIGR02137		203	HSK-PSP phosphoserine phosphatase/homoserine phosp	98.76
TIGR01689		126	EcbF-BcbF capsule biosynthesis phosphatase. Due to	98.71
PF00702		215	Hydrolase: haloacid dehalogenase-like hydrolase; I	98.7
PHA03398		303	viral phosphatase superfamily protein; Provisional	98.67
PLN02205		854	alpha,alpha-trehalose-phosphate synthase [UDP-form	98.67
smart00775		157	LNS2 LNS2 domain. This domain is found in Saccharo	98.66
COG4229		229	Predicted enolase-phosphatase [Energy production a	98.61
PLN03017		366	trehalose-phosphatase	98.49
TIGR01488		177	HAD-SF-IB Haloacid Dehalogenase superfamily, subfa	98.48
COG0560		212	SerB Phosphoserine phosphatase [Amino acid transpo	98.47
TIGR01533		266	lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil	98.4
PLN02151		354	trehalose-phosphatase	98.39
TIGR02244		343	HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd	98.32
PRK10671		834	copA copper exporting ATPase; Provisional	98.23
PF12689		169	Acid_PPase: Acid Phosphatase; InterPro: IPR010036	98.23
TIGR01511		562	ATPase-IB1_Cu copper-(or silver)-translocating P-t	98.23
KOG2961		190	consensus Predicted hydrolase (HAD superfamily) [G	98.21
TIGR01525		556	ATPase-IB_hvy heavy metal translocating P-type ATP	98.18
TIGR01512		536	ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo	98.18
PF06437		408	ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR0	98.08
COG3769		274	Predicted hydrolase (HAD superfamily) [General fun	97.98
TIGR01522		884	ATPase-IIA2_Ca golgi membrane calcium-translocatin	97.98
PF08235		157	LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209	97.97
TIGR01544		277	HAD-SF-IE haloacid dehalogenase superfamily, subfa	97.93
COG4087		152	Soluble P-type ATPase [General function prediction	97.93
PF03767		229	Acid_phosphat_B: HAD superfamily, subfamily IIIB (	97.79
TIGR01675		229	plant-AP plant acid phosphatase. This model explic	97.77
PRK08238		479	hypothetical protein; Validated	97.68
TIGR01680		275	Veg_Stor_Prot vegetative storage protein. The prot	97.65
TIGR01116		917	ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium	97.58
TIGR01490		202	HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol	97.58
PRK11590		211	hypothetical protein; Provisional	97.51
COG1877		266	OtsB Trehalose-6-phosphatase [Carbohydrate transpo	97.44
PRK11033		741	zntA zinc/cadmium/mercury/lead-transporting ATPase	97.38
COG2503		274	Predicted secreted acid phosphatase [General funct	97.29
KOG1615		227	consensus Phosphoserine phosphatase [Amino acid tr	97.22
PF02358		235	Trehalose_PPase: Trehalose-phosphatase; InterPro:	97.22
PLN03063		797	alpha,alpha-trehalose-phosphate synthase (UDP-form	97.19
PF13419		176	HAD_2: Haloacid dehalogenase-like hydrolase; PDB:	97.11
TIGR02468		1050	sucrsPsyn_pln sucrose phosphate synthase/possible	96.93
TIGR01428		198	HAD_type_II 2-haloalkanoic acid dehalogenase, type	96.87
PF06888		234	Put_Phosphatase: Putative Phosphatase; InterPro: I	96.84
TIGR01106		997	ATPase-IIC_X-K sodium or proton efflux -- potassiu	96.81
TIGR01454		205	AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes	96.61
TIGR02253		221	CTE7 HAD superfamily (subfamily IA) hydrolase, TIG	96.48
PLN02770		248	haloacid dehalogenase-like hydrolase family protei	96.48
PRK13288		214	pyrophosphatase PpaX; Provisional	96.45
PLN03243		260	haloacid dehalogenase-like hydrolase; Provisional	96.41
PRK10826		222	2-deoxyglucose-6-phosphatase; Provisional	96.4
TIGR01523		1053	ATPase-IID_K-Na potassium and/or sodium efflux P-t	96.37
TIGR01509		183	HAD-SF-IA-v3 haloacid dehalogenase superfamily, su	96.28
TIGR01449		213	PGP_bact 2-phosphoglycolate phosphatase, prokaryot	96.27
PRK14988		224	GMP/IMP nucleotidase; Provisional	96.25
PF03031		159	NIF: NLI interacting factor-like phosphatase; Inte	96.2
TIGR01517		941	ATPase-IIB_Ca plasma-membrane calcium-translocatin	96.15
COG4996		164	Predicted phosphatase [General function prediction	96.11
TIGR02252		203	DREG-2 REG-2-like, HAD superfamily (subfamily IA)	96.09
PLN02575		381	haloacid dehalogenase-like hydrolase	96.08
PRK11587		218	putative phosphatase; Provisional	96.04
PRK15122		903	magnesium-transporting ATPase; Provisional	96.03
TIGR01524		867	ATPase-IIIB_Mg magnesium-translocating P-type ATPa	96.01
PRK13225		273	phosphoglycolate phosphatase; Provisional	95.98
TIGR03351		220	PhnX-like phosphonatase-like hydrolase. This clade	95.95
PRK10517		902	magnesium-transporting ATPase MgtA; Provisional	95.95
TIGR01652		1057	ATPase-Plipid phospholipid-translocating P-type AT	95.94
TIGR02009		185	PGMB-YQAB-SF beta-phosphoglucomutase family hydrol	95.88
PF05152		297	DUF705: Protein of unknown function (DUF705); Inte	95.87
TIGR01422		253	phosphonatase phosphonoacetaldehyde hydrolase. Thi	95.81
PRK13222		226	phosphoglycolate phosphatase; Provisional	95.79
TIGR02251		162	HIF-SF_euk Dullard-like phosphatase domain. This d	95.7
PRK09449		224	dUMP phosphatase; Provisional	95.66
TIGR01990		185	bPGM beta-phosphoglucomutase. The enzyme from L. l	95.63
COG4030		315	Uncharacterized protein conserved in archaea [Func	95.59
PRK13226		229	phosphoglycolate phosphatase; Provisional	95.48
COG0546		220	Gph Predicted phosphatases [General function predi	95.4
PRK13223		272	phosphoglycolate phosphatase; Provisional	95.37
PLN03190		1178	aminophospholipid translocase; Provisional	95.36
PLN02940		382	riboflavin kinase	95.27
TIGR01497		675	kdpB K+-transporting ATPase, B subunit. One sequen	95.21
TIGR02250		156	FCP1_euk FCP1-like phosphatase, phosphatase domain	95.17
PRK14010		673	potassium-transporting ATPase subunit B; Provision	95.07
PLN03064		934	alpha,alpha-trehalose-phosphate synthase (UDP-form	95.06
COG0637		221	Predicted phosphatase/phosphohexomutase [General f	95.02
TIGR01491		201	HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa	94.99
PRK13478		267	phosphonoacetaldehyde hydrolase; Provisional	94.93
TIGR01691		220	enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen	94.73
TIGR02247		211	HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li	94.62
TIGR01647		755	ATPase-IIIA_H plasma-membrane proton-efflux P-type	94.62
PRK09456		199	?-D-glucose-1-phosphatase; Provisional	94.59
COG4359		220	Uncharacterized conserved protein [Function unknow	94.59
TIGR02254		224	YjjG/YfnB HAD superfamily (subfamily IA) hydrolase	94.59
TIGR01657		1054	P-ATPase-V P-type ATPase of unknown pump specifici	94.49
TIGR01459		242	HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas	94.43
TIGR02245		195	HAD_IIID1 HAD-superfamily subfamily IIID hydrolase	94.4
TIGR00338		219	serB phosphoserine phosphatase SerB. Phosphoserine	94.31
KOG0210		1051	consensus P-type ATPase [Inorganic ion transport a	94.29
TIGR02251		162	HIF-SF_euk Dullard-like phosphatase domain. This d	94.16
PF00702		215	Hydrolase: haloacid dehalogenase-like hydrolase; I	94.01
TIGR01548		197	HAD-SF-IA-hyp1 haloacid dehalogenase superfamily,	93.88
PLN02811		220	hydrolase	93.47
TIGR01549		154	HAD-SF-IA-v1 haloacid dehalogenase superfamily, su	93.33
PLN02919		1057	haloacid dehalogenase-like hydrolase family protei	93.0
KOG2116		738	consensus Protein involved in plasmid maintenance/	92.82
PLN02779		286	haloacid dehalogenase-like hydrolase family protei	92.81
KOG3189		252	consensus Phosphomannomutase [Lipid transport and	92.79
KOG2630		254	consensus Enolase-phosphatase E-1 [Amino acid tran	92.44
PLN02954		224	phosphoserine phosphatase	92.33
COG4850		373	Uncharacterized conserved protein [Function unknow	92.23
KOG2961		190	consensus Predicted hydrolase (HAD superfamily) [G	92.08
COG1011		229	Predicted hydrolase (HAD superfamily) [General fun	91.91
TIGR01489		188	DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent	91.45
COG0474		917	MgtA Cation transport ATPase [Inorganic ion transp	91.4
KOG0203		1019	consensus Na+/K+ ATPase, alpha subunit [Inorganic	91.3
TIGR01993		184	Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These	91.23
PF11019		252	DUF2608: Protein of unknown function (DUF2608); In	91.15
PRK10725		188	fructose-1-P/6-phosphogluconate phosphatase; Provi	91.07
COG3882		574	FkbH Predicted enzyme involved in methoxymalonyl-A	90.99
PRK06698		459	bifunctional 5'-methylthioadenosine/S-adenosylhomo	90.99
KOG0202		972	consensus Ca2+ transporting ATPase [Inorganic ion	89.86
PRK10563		221	6-phosphogluconate phosphatase; Provisional	89.82
KOG2134		422	consensus Polynucleotide kinase 3' phosphatase [Re	89.67
TIGR01488		177	HAD-SF-IB Haloacid Dehalogenase superfamily, subfa	89.61
TIGR01533		266	lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil	89.31
KOG3120		256	consensus Predicted haloacid dehalogenase-like hyd	89.29
COG3700		237	AphA Acid phosphatase (class B) [General function	89.29
PF05761		448	5_nucleotid: 5' nucleotidase family; InterPro: IPR	89.28
COG0560		212	SerB Phosphoserine phosphatase [Amino acid transpo	89.13
COG2217		713	ZntA Cation transport ATPase [Inorganic ion transp	89.13
PF04312		138	DUF460: Protein of unknown function (DUF460); Inte	89.04
TIGR01545		210	YfhB_g-proteo haloacid dehalogenase superfamily, s	89.04
PRK11133		322	serB phosphoserine phosphatase; Provisional	88.8
KOG0206		1151	consensus P-type ATPase [General function predicti	88.59
COG5083		580	SMP2 Uncharacterized protein involved in plasmid m	88.34
PRK09552		219	mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp	88.05
TIGR01490		202	HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol	87.97
PF12710		192	HAD: haloacid dehalogenase-like hydrolase; PDB: 3P	87.96
TIGR02137		203	HSK-PSP phosphoserine phosphatase/homoserine phosp	87.77
TIGR02990		239	ectoine_eutA ectoine utilization protein EutA. Mem	87.67
PRK10748		238	flavin mononucleotide phosphatase; Provisional	87.38
PRK13582		205	thrH phosphoserine phosphatase; Provisional	87.2
PRK11590		211	hypothetical protein; Provisional	87.11
KOG2914		222	consensus Predicted haloacid-halidohydrolase and r	86.21
PF06189		264	5-nucleotidase: 5'-nucleotidase; InterPro: IPR0103	86.14
PF06941		191	NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol	84.59
COG5610		635	Predicted hydrolase (HAD superfamily) [General fun	84.28
KOG4549		144	consensus Magnesium-dependent phosphatase [General	84.04
PF01740		117	STAS: STAS domain; InterPro: IPR002645 The STAS (S	84.02
TIGR03333		214	salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl	83.77
PRK01122		679	potassium-transporting ATPase subunit B; Provision	83.56
TIGR01545		210	YfhB_g-proteo haloacid dehalogenase superfamily, s	82.96
PF12710		192	HAD: haloacid dehalogenase-like hydrolase; PDB: 3P	81.44
KOG1615		227	consensus Phosphoserine phosphatase [Amino acid tr	81.4
PHA02597		197	30.2 hypothetical protein; Provisional	81.02
PRK10671		834	copA copper exporting ATPase; Provisional	80.84
PRK01122		679	potassium-transporting ATPase subunit B; Provision	80.72
PRK08238		479	hypothetical protein; Validated	80.72
KOG2470		510	consensus Similar to IMP-GMP specific 5'-nucleotid	80.36
TIGR01658		274	EYA-cons_domain eyes absent protein conserved doma	80.07

>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism]	Back alignment and domain information

Probab=100.00  E-value=3.9e-54  Score=353.49  Aligned_cols=265  Identities=36%  Similarity=0.589  Sum_probs=241.4

Q ss_pred             hhhhhhhhceeEEEeeeeeeeCCccCCCHHHHHHHHHHCCCcEEEEeCCCCCCHHHHHHHHHc-CCCCCCCCceechHHH
Q 022757            2 LMSLLTLLRLSFLTVMVIIWKGDKLIDGVPETLDMLRSKGKRLVFVTNNSTKSRKQYGKKFET-LGLTVTEEEIFASSFA   80 (292)
Q Consensus         2 ~m~~~~~~k~i~fDiDGtL~~~~~~i~~a~eal~~L~~~G~~~~~~Tn~s~r~~~~~~~~l~~-lG~~~~~~~i~~~~~~   80 (292)
                      +|.+|+++++++||+||||++|.+++|||.++|++|+++|++++|+|||++|+++.+.++|.. +|+++.+++|+||+.+
T Consensus         1 ~~~~~~~y~~~l~DlDGvl~~G~~~ipga~e~l~~L~~~g~~~iflTNn~~~s~~~~~~~L~~~~~~~~~~~~i~TS~~a   80 (269)
T COG0647           1 LFDVMDKYDGFLFDLDGVLYRGNEAIPGAAEALKRLKAAGKPVIFLTNNSTRSREVVAARLSSLGGVDVTPDDIVTSGDA   80 (269)
T ss_pred             CcchhhhcCEEEEcCcCceEeCCccCchHHHHHHHHHHcCCeEEEEeCCCCCCHHHHHHHHHhhcCCCCCHHHeecHHHH
Confidence            356678899999999999999999999999999999999999999999999999999999999 7777999999999999


Q ss_pred             HHHHHHhcCCCCCCeEEEEcChhHHHHHHHcCCeecCCCCCCCCccccCCCCccCCCCCccEEEEeccCCcCHHHHHHHH
Q 022757           81 AAAYLKSIDFPKDKKVYVVGEDGILKELELAGFQYLGGPEDGGKKIELKPGFLMEHDKDVGAVVVGFDRYFNYYKVQYGT  160 (292)
Q Consensus        81 ~~~~l~~~~~~~~~~~~~~g~~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~  160 (292)
                      +++|+++..  +.+++|++|.+++.++++..|+..+...+                +..+++|++|.++...|+++.+++
T Consensus        81 t~~~l~~~~--~~~kv~viG~~~l~~~l~~~G~~~~~~~~----------------~~~~d~Vv~g~d~~~~~e~l~~a~  142 (269)
T COG0647          81 TADYLAKQK--PGKKVYVIGEEGLKEELEGAGFELVDEEE----------------PARVDAVVVGLDRTLTYEKLAEAL  142 (269)
T ss_pred             HHHHHHhhC--CCCEEEEECCcchHHHHHhCCcEEeccCC----------------CCcccEEEEecCCCCCHHHHHHHH
Confidence            999999763  34799999999999999999999864211                123689999999999999999999


Q ss_pred             HHHHcCCCcEEEEecCCcccccCCCCcccCcchHHHHHHhccCCCceeecCCcHHHHHHHHHHcCCCCCcEEEECCCchh
Q 022757          161 LCIRENPGCLFIATNRDAVTHLTDAQEWAGGGSMVGAFVGSTQREPLVVGKPSTFMMDYLANKFGIQKSQICMVGDRLDT  240 (292)
Q Consensus       161 ~~l~~~~~~~~i~tn~d~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~gKP~~~~~~~~~~~lgi~~~~~~~iGD~l~~  240 (292)
                      ..++  +|++||+||+|..+|.+.+ ..++.|++...++.+++.++...|||++.+|+.+++.++.++++++||||++.+
T Consensus       143 ~~i~--~g~~fI~tNpD~~~p~~~g-~~pgaGai~~~~~~~tg~~~~~~GKP~~~i~~~al~~~~~~~~~~~mVGD~~~T  219 (269)
T COG0647         143 LAIA--AGAPFIATNPDLTVPTERG-LRPGAGAIAALLEQATGREPTVIGKPSPAIYEAALEKLGLDRSEVLMVGDRLDT  219 (269)
T ss_pred             HHHH--cCCcEEEeCCCccccCCCC-CccCcHHHHHHHHHhhCCcccccCCCCHHHHHHHHHHhCCCcccEEEEcCCchh
Confidence            9997  5799999999999987666 789999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHHhcCCeEEEEecCCCChhhccCCCCCCCCcEEeCCHhhHHHhHH
Q 022757          241 DILFGQNGGCKTLLVLSGVTSLSMLQSPNNSIQPDFYTNKISDFLSLKA  289 (292)
Q Consensus       241 Di~~a~~aG~~~i~V~~G~~~~~~~~~~~~~~~pd~~~~~l~~l~~~~~  289 (292)
                      ||.+|+++||+|++|+||.++.+++..  .+.+|+|+.+|+.++...+.
T Consensus       220 DI~~a~~~G~~t~LV~TGv~~~~~~~~--~~~~p~~v~~sl~~~~~~~~  266 (269)
T COG0647         220 DILGAKAAGLDTLLVLTGVSSAEDLDR--AEVKPTYVVDSLAELITALK  266 (269)
T ss_pred             hHHHHHHcCCCEEEEccCCCChhhhhh--hccCCcchHhhHHHHHhhhh
Confidence            999999999999999999999888653  36799999999999986653

>KOG2882 consensus p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN02645 phosphoglycolate phosphatase	Back alignment and domain information

>PRK10444 UMP phosphatase; Provisional	Back alignment and domain information

>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family	Back alignment and domain information

>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457	Back alignment and domain information

>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458	Back alignment and domain information

>KOG3040 consensus Predicted sugar phosphatase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5	Back alignment and domain information

>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA	Back alignment and domain information

>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459	Back alignment and domain information

>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A	Back alignment and domain information

>KOG1618 consensus Predicted phosphatase [General function prediction only]	Back alignment and domain information

>COG0546 Gph Predicted phosphatases [General function prediction only]	Back alignment and domain information

>PRK10748 flavin mononucleotide phosphatase; Provisional	Back alignment and domain information

>PRK06769 hypothetical protein; Validated	Back alignment and domain information

>PRK13226 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase	Back alignment and domain information

>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253	Back alignment and domain information

>TIGR03351 PhnX-like phosphonatase-like hydrolase	Back alignment and domain information

>PRK13288 pyrophosphatase PpaX; Provisional	Back alignment and domain information

>PRK13478 phosphonoacetaldehyde hydrolase; Provisional	Back alignment and domain information

>PLN03243 haloacid dehalogenase-like hydrolase; Provisional	Back alignment and domain information

>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase	Back alignment and domain information

>PLN02770 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK10826 2-deoxyglucose-6-phosphatase; Provisional	Back alignment and domain information

>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein	Back alignment and domain information

>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated	Back alignment and domain information

>PRK13222 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK13223 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PF13242 Hydrolase_like: HAD-hyrolase-like; PDB: 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A 2HX1_D 2X4D_A 3HLT_C 3L1U_B	Back alignment and domain information

>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic	Back alignment and domain information

>PLN02575 haloacid dehalogenase-like hydrolase	Back alignment and domain information

>PRK11587 putative phosphatase; Provisional	Back alignment and domain information

>PLN02940 riboflavin kinase	Back alignment and domain information

>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254	Back alignment and domain information

>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only]	Back alignment and domain information

>PLN02779 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK09449 dUMP phosphatase; Provisional	Back alignment and domain information

>PRK10563 6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>PRK13225 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional	Back alignment and domain information

>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA	Back alignment and domain information

>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PRK10513 sugar phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase	Back alignment and domain information

>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated	Back alignment and domain information

>PRK01158 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only]	Back alignment and domain information

>PRK14988 GMP/IMP nucleotidase; Provisional	Back alignment and domain information

>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain	Back alignment and domain information

>PRK10976 putative hydrolase; Provisional	Back alignment and domain information

>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>TIGR01261 hisB_Nterm histidinol-phosphatase	Back alignment and domain information

>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional	Back alignment and domain information

>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II	Back alignment and domain information

>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PLN02887 hydrolase family protein	Back alignment and domain information

>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only]	Back alignment and domain information

>PRK09456 ?-D-glucose-1-phosphatase; Provisional	Back alignment and domain information

>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily	Back alignment and domain information

>TIGR01990 bPGM beta-phosphoglucomutase	Back alignment and domain information

>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal	Back alignment and domain information

>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase	Back alignment and domain information

>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase	Back alignment and domain information

>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase	Back alignment and domain information

>PHA02597 30	Back alignment and domain information

>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02811 hydrolase	Back alignment and domain information

>cd01427 HAD_like Haloacid dehalogenase-like hydrolases	Back alignment and domain information

>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily	Back alignment and domain information

>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase	Back alignment and domain information

>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family	Back alignment and domain information

>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family	Back alignment and domain information

>TIGR01685 MDP-1 magnesium-dependent phosphatase-1	Back alignment and domain information

>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit	Back alignment and domain information

>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification []	Back alignment and domain information

>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED	Back alignment and domain information

>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional	Back alignment and domain information

>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein	Back alignment and domain information

>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial	Back alignment and domain information

>PHA02530 pseT polynucleotide kinase; Provisional	Back alignment and domain information

>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only]	Back alignment and domain information

>PLN02954 phosphoserine phosphatase	Back alignment and domain information

>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase	Back alignment and domain information

>TIGR00338 serB phosphoserine phosphatase SerB	Back alignment and domain information

>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548	Back alignment and domain information

>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase	Back alignment and domain information

>PRK10187 trehalose-6-phosphate phosphatase; Provisional	Back alignment and domain information

>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase	Back alignment and domain information

>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases	Back alignment and domain information

>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC	Back alignment and domain information

>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672	Back alignment and domain information

>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB	Back alignment and domain information

>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E	Back alignment and domain information

>PRK11133 serB phosphoserine phosphatase; Provisional	Back alignment and domain information

>PTZ00174 phosphomannomutase; Provisional	Back alignment and domain information

>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional	Back alignment and domain information

>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed	Back alignment and domain information

>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional	Back alignment and domain information

>TIGR00685 T6PP trehalose-phosphatase	Back alignment and domain information

>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A	Back alignment and domain information

>PRK13582 thrH phosphoserine phosphatase; Provisional	Back alignment and domain information

>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase	Back alignment and domain information

>PLN02382 probable sucrose-phosphatase	Back alignment and domain information

>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed	Back alignment and domain information

>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal	Back alignment and domain information

>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin []	Back alignment and domain information

>smart00577 CPDc catalytic domain of ctd-like phosphatases	Back alignment and domain information

>TIGR01686 FkbH FkbH-like domain	Back alignment and domain information

>PTZ00445 p36-lilke protein; Provisional	Back alignment and domain information

>PLN02423 phosphomannomutase	Back alignment and domain information

>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional	Back alignment and domain information

>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria []	Back alignment and domain information

>TIGR01684 viral_ppase viral phosphatase	Back alignment and domain information

>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase	Back alignment and domain information

>PLN02580 trehalose-phosphatase	Back alignment and domain information

>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein	Back alignment and domain information

>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase	Back alignment and domain information

>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase)	Back alignment and domain information

>PHA03398 viral phosphatase superfamily protein; Provisional	Back alignment and domain information

>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming]	Back alignment and domain information

>smart00775 LNS2 LNS2 domain	Back alignment and domain information

>COG4229 Predicted enolase-phosphatase [Energy production and conversion]	Back alignment and domain information

>PLN03017 trehalose-phosphatase	Back alignment and domain information

>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like	Back alignment and domain information

>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family	Back alignment and domain information

>PLN02151 trehalose-phosphatase	Back alignment and domain information

>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea	Back alignment and domain information

>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase	Back alignment and domain information

>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase	Back alignment and domain information

>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase	Back alignment and domain information

>PF06437 ISN1: IMP-specific 5'-nucleotidase; InterPro: IPR009453 The Saccharomyces cerevisiae ISN1 (YOR155c) gene encodes an IMP-specific 5'-nucleotidase, which catalyses degradation of IMP to inosine as part of the purine salvage pathway	Back alignment and domain information

>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase	Back alignment and domain information

>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins []	Back alignment and domain information

>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544	Back alignment and domain information

>COG4087 Soluble P-type ATPase [General function prediction only]	Back alignment and domain information

>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25)	Back alignment and domain information

>TIGR01675 plant-AP plant acid phosphatase	Back alignment and domain information

>PRK08238 hypothetical protein; Validated	Back alignment and domain information

>TIGR01680 Veg_Stor_Prot vegetative storage protein	Back alignment and domain information

>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase	Back alignment and domain information

>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

>PRK11590 hypothetical protein; Provisional	Back alignment and domain information

>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional	Back alignment and domain information

>COG2503 Predicted secreted acid phosphatase [General function prediction only]	Back alignment and domain information

>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>PF02358 Trehalose_PPase: Trehalose-phosphatase; InterPro: IPR003337 Trehalose-phosphatases 3	Back alignment and domain information

>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A	Back alignment and domain information

>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant	Back alignment and domain information

>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II	Back alignment and domain information

>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 []	Back alignment and domain information

>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit	Back alignment and domain information

>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein	Back alignment and domain information

>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253	Back alignment and domain information

>PLN02770 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>PRK13288 pyrophosphatase PpaX; Provisional	Back alignment and domain information

>PLN03243 haloacid dehalogenase-like hydrolase; Provisional	Back alignment and domain information

>PRK10826 2-deoxyglucose-6-phosphatase; Provisional	Back alignment and domain information

>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type	Back alignment and domain information

>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED	Back alignment and domain information

>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic	Back alignment and domain information

>PRK14988 GMP/IMP nucleotidase; Provisional	Back alignment and domain information

>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear	Back alignment and domain information

>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase	Back alignment and domain information

>COG4996 Predicted phosphatase [General function prediction only]	Back alignment and domain information

>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase	Back alignment and domain information

>PLN02575 haloacid dehalogenase-like hydrolase	Back alignment and domain information

>PRK11587 putative phosphatase; Provisional	Back alignment and domain information

>PRK15122 magnesium-transporting ATPase; Provisional	Back alignment and domain information

>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase	Back alignment and domain information

>PRK13225 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR03351 PhnX-like phosphonatase-like hydrolase	Back alignment and domain information

>PRK10517 magnesium-transporting ATPase MgtA; Provisional	Back alignment and domain information

>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase	Back alignment and domain information

>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase	Back alignment and domain information

>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins	Back alignment and domain information

>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase	Back alignment and domain information

>PRK13222 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain	Back alignment and domain information

>PRK09449 dUMP phosphatase; Provisional	Back alignment and domain information

>TIGR01990 bPGM beta-phosphoglucomutase	Back alignment and domain information

>COG4030 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>PRK13226 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>COG0546 Gph Predicted phosphatases [General function prediction only]	Back alignment and domain information

>PRK13223 phosphoglycolate phosphatase; Provisional	Back alignment and domain information

>PLN03190 aminophospholipid translocase; Provisional	Back alignment and domain information

>PLN02940 riboflavin kinase	Back alignment and domain information

>TIGR01497 kdpB K+-transporting ATPase, B subunit	Back alignment and domain information

>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain	Back alignment and domain information

>PRK14010 potassium-transporting ATPase subunit B; Provisional	Back alignment and domain information

>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional	Back alignment and domain information

>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only]	Back alignment and domain information

>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal	Back alignment and domain information

>PRK13478 phosphonoacetaldehyde hydrolase; Provisional	Back alignment and domain information

>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase	Back alignment and domain information

>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase	Back alignment and domain information

>PRK09456 ?-D-glucose-1-phosphatase; Provisional	Back alignment and domain information

>COG4359 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254	Back alignment and domain information

>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V)	Back alignment and domain information

>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459	Back alignment and domain information

>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245	Back alignment and domain information

>TIGR00338 serB phosphoserine phosphatase SerB	Back alignment and domain information

>KOG0210 consensus P-type ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain	Back alignment and domain information

>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase)	Back alignment and domain information

>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548	Back alignment and domain information

>PLN02811 hydrolase	Back alignment and domain information

>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E	Back alignment and domain information

>PLN02919 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG2116 consensus Protein involved in plasmid maintenance/nuclear protein involved in lipid metabolism [Cell motility; Lipid transport and metabolism]	Back alignment and domain information

>PLN02779 haloacid dehalogenase-like hydrolase family protein	Back alignment and domain information

>KOG3189 consensus Phosphomannomutase [Lipid transport and metabolism]	Back alignment and domain information

>KOG2630 consensus Enolase-phosphatase E-1 [Amino acid transport and metabolism]	Back alignment and domain information

>PLN02954 phosphoserine phosphatase	Back alignment and domain information

>COG4850 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2961 consensus Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase	Back alignment and domain information

>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0203 consensus Na+/K+ ATPase, alpha subunit [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase	Back alignment and domain information

>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria	Back alignment and domain information

>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated	Back alignment and domain information

>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10563 6-phosphogluconate phosphatase; Provisional	Back alignment and domain information

>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair]	Back alignment and domain information

>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like	Back alignment and domain information

>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family	Back alignment and domain information

>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only]	Back alignment and domain information

>COG3700 AphA Acid phosphatase (class B) [General function prediction only]	Back alignment and domain information

>PF05761 5_nucleotid: 5' nucleotidase family; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3	Back alignment and domain information

>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF04312 DUF460: Protein of unknown function (DUF460); InterPro: IPR007408 This is an archaeal protein of unknown function	Back alignment and domain information

>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB	Back alignment and domain information

>PRK11133 serB phosphoserine phosphatase; Provisional	Back alignment and domain information

>KOG0206 consensus P-type ATPase [General function prediction only]	Back alignment and domain information

>COG5083 SMP2 Uncharacterized protein involved in plasmid maintenance [General function prediction only]	Back alignment and domain information

>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed	Back alignment and domain information

>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490	Back alignment and domain information

>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B	Back alignment and domain information

>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein	Back alignment and domain information

>TIGR02990 ectoine_eutA ectoine utilization protein EutA	Back alignment and domain information

>PRK10748 flavin mononucleotide phosphatase; Provisional	Back alignment and domain information

>PRK13582 thrH phosphoserine phosphatase; Provisional	Back alignment and domain information

>PRK11590 hypothetical protein; Provisional	Back alignment and domain information

>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only]	Back alignment and domain information

>PF06189 5-nucleotidase: 5'-nucleotidase; InterPro: IPR010394 This family consists of both eukaryotic and prokaryotic 5'-nucleotidase sequences (3	Back alignment and domain information

>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins	Back alignment and domain information

>COG5610 Predicted hydrolase (HAD superfamily) [General function prediction only]	Back alignment and domain information

>KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only]	Back alignment and domain information

>PF01740 STAS: STAS domain; InterPro: IPR002645 The STAS (Sulphate Transporter and AntiSigma factor antagonist) domain is found in the C-terminal region of sulphate transporters and bacterial anti-sigma factor antagonists	Back alignment and domain information

>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase	Back alignment and domain information

>PRK01122 potassium-transporting ATPase subunit B; Provisional	Back alignment and domain information

>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB	Back alignment and domain information

>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B	Back alignment and domain information

>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism]	Back alignment and domain information

>PHA02597 30	Back alignment and domain information

>PRK10671 copA copper exporting ATPase; Provisional	Back alignment and domain information

>PRK01122 potassium-transporting ATPase subunit B; Provisional	Back alignment and domain information

>PRK08238 hypothetical protein; Validated	Back alignment and domain information

>KOG2470 consensus Similar to IMP-GMP specific 5'-nucleotidase [Nucleotide transport and metabolism]	Back alignment and domain information

>TIGR01658 EYA-cons_domain eyes absent protein conserved domain	Back alignment and domain information

Homologous Structure Templates