Citrus Sinensis ID: 022783


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASETEAQASPEAESGSEEQEEKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLREGLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIYGS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHccccccccccHHHHccccEEEEEEccccEEEEEEEccccEEEEEEccccccccccccccccEEEEEEEccccEEEEccccHHHHHHHHcccccEEEEEEcccccHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHcc
ccccccccHHHcccccccccccccccccccccccccccEEEcccccccccccccccEEEEEEEccccccccccccccccccccEEEEEEEEccccEEEEEccccccEEEEEEcccccHHHcccEEcccEEEEEEcccccccccHHHccHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccc
mslapssyaslysppplprtnqnpflfsqnshvwfkkncflsasgcscntllvkpSVFVAKAseteaqaspeaesgseeqeEKYEEYEVEIeqpyglkfakgrdggtyidaiapggsadktgmfqvGDKVLATSAVfgteiwpaaeygrtMYTIRQRVGPLLMKMQKRYgkmeqtgelSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLREGLQLYRTGKYEVAREKFEsvlgskptpeessvasYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIYGS
MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASeteaqaspeaesgseeqeEKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGteiwpaaeygrtmYTIRQRVGPLLMKMQKRYGKmeqtgelsekeiiraernsgvisnrvreiqmqnymkkkeqkerreqdlreglqlyrtgkyevAREKFesvlgskptpeesSVASYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIYGS
MslapssyaslysppplpRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASETeaqaspeaesgseeqeekyeeyeveieqpyGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMkkkeqkerreqDLREGLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIYGS
************************FLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVA****************************VEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKM***********************************************************LYRTGKY**********************ASYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIY**
*************************************************************************************EYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQK**************EIIR********************************DLREGLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIY**
MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKAS*************************VEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYM***********DLREGLQLYRTGKYEVAREKFE***************SYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIYGS
************SPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASE*****************EKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLREGLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIYGS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLAPSSYASLYSPPPLPRTNQNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPSVFVAKASETEAQASPEAESGSEEQEEKYEEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRVREIQxxxxxxxxxxxxxxxxxxxxxLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIYGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query292 2.2.26 [Sep-21-2011]
F4J117 591 Phosphoglucan phosphatase no no 0.291 0.143 0.270 0.0001
>sp|F4J117|LSF1_ARATH Phosphoglucan phosphatase LSF1, chloroplastic OS=Arabidopsis thaliana GN=LSF1 PE=1 SV=1 Back     alignment and function desciption
 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 44/85 (51%)

Query: 85  EEYEVEIEQPYGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPA 144
            EY V +E+P G++FA   DG  ++ AI  G +A+K  +  VGD +   S   G  +   
Sbjct: 75  NEYMVTLEKPLGIRFALSADGKIFVHAIKKGSNAEKARIIMVGDTLKKASDSSGGTLVEI 134

Query: 145 AEYGRTMYTIRQRVGPLLMKMQKRY 169
            ++G T   + ++ G   + +++ +
Sbjct: 135 KDFGDTKKMLVEKTGSFSLVLERPF 159




Starch granule-associated phosphoglucan phosphatase involved in the control of starch accumulation. Participates to the regulation of the initial steps of starch degradation at the granule surface. May release a different set of phosphate groups from those removed by DSP4.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: -

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
224073126344 predicted protein [Populus trichocarpa] 0.989 0.840 0.716 1e-113
225435790329 PREDICTED: uncharacterized protein LOC10 0.941 0.835 0.758 1e-112
255564826337 protein binding protein, putative [Ricin 0.982 0.851 0.732 1e-110
357519275335 hypothetical protein MTR_8g088420 [Medic 0.969 0.844 0.670 1e-105
297847910335 binding protein [Arabidopsis lyrata subs 0.924 0.805 0.715 1e-103
449463844337 PREDICTED: uncharacterized protein LOC10 0.976 0.845 0.656 1e-102
357519277332 hypothetical protein MTR_8g088420 [Medic 0.958 0.843 0.663 1e-102
147789082 1051 hypothetical protein VITISV_041015 [Viti 0.815 0.226 0.793 1e-101
18405391335 ZKT protein containing PDZ, K-box and a 0.921 0.802 0.727 1e-100
21595827335 unknown [Arabidopsis thaliana] 0.921 0.802 0.724 6e-99
>gi|224073126|ref|XP_002303984.1| predicted protein [Populus trichocarpa] gi|222841416|gb|EEE78963.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 215/300 (71%), Positives = 241/300 (80%), Gaps = 11/300 (3%)

Query: 1   MSLAPSSYASLYSPPPLPRTN----QNPFLFSQNSHVWFKKNCFLSASGCSCNTLLVKPS 56
           MSLAPS Y +LYS  PLP ++    Q P LFSQN+H   K   FLS S    NTLL+KPS
Sbjct: 1   MSLAPSRYPALYSSSPLPTSSVQAKQIPLLFSQNTHFLSKNYSFLSTSTAFSNTLLLKPS 60

Query: 57  VFVAKASETEAQASPEAESGSEEQEEKYEEYEVEIE-------QPYGLKFAKGRDGGTYI 109
             + KASETE+Q S  AESGS  + E   E E + E       QPYG+KFAKGRDG TYI
Sbjct: 61  NSILKASETESQTSKSAESGSGGEGEGEGEGEEKYEEYEVEIEQPYGIKFAKGRDGSTYI 120

Query: 110 DAIAPGGSADKTGMFQVGDKVLATSAVFGTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRY 169
           DAIAPGGSADK G F VGDKV+ATSAVFGTEIWPAAEYGRTMYTIRQR+GPL MKMQKRY
Sbjct: 121 DAIAPGGSADKNGKFSVGDKVIATSAVFGTEIWPAAEYGRTMYTIRQRIGPLFMKMQKRY 180

Query: 170 GKMEQTGELSEKEIIRAERNSGVISNRVREIQMQNYMKKKEQKERREQDLREGLQLYRTG 229
           G M+ TGEL+EKEIIRAERNSGVISNRVREIQMQNY++KKEQKE+RE+DLREGLQLY+  
Sbjct: 181 GNMDYTGELTEKEIIRAERNSGVISNRVREIQMQNYLRKKEQKEQREKDLREGLQLYKNA 240

Query: 230 KYEVAREKFESVLGSKPTPEESSVASYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVI 289
           KYE A EKFES+LGSKP P E++VASYNVACCYSKLNQ++AGLSALEDA+ AG+EDFK I
Sbjct: 241 KYEEALEKFESMLGSKPDPTEAAVASYNVACCYSKLNQLQAGLSALEDAMKAGFEDFKRI 300




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225435790|ref|XP_002285744.1| PREDICTED: uncharacterized protein LOC100241562 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255564826|ref|XP_002523407.1| protein binding protein, putative [Ricinus communis] gi|223537357|gb|EEF38986.1| protein binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357519275|ref|XP_003629926.1| hypothetical protein MTR_8g088420 [Medicago truncatula] gi|217073920|gb|ACJ85320.1| unknown [Medicago truncatula] gi|355523948|gb|AET04402.1| hypothetical protein MTR_8g088420 [Medicago truncatula] gi|388505444|gb|AFK40788.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|297847910|ref|XP_002891836.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297337678|gb|EFH68095.1| binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449463844|ref|XP_004149641.1| PREDICTED: uncharacterized protein LOC101217229 [Cucumis sativus] gi|449522778|ref|XP_004168403.1| PREDICTED: uncharacterized LOC101217229 [Cucumis sativus] Back     alignment and taxonomy information
>gi|357519277|ref|XP_003629927.1| hypothetical protein MTR_8g088420 [Medicago truncatula] gi|355523949|gb|AET04403.1| hypothetical protein MTR_8g088420 [Medicago truncatula] Back     alignment and taxonomy information
>gi|147789082|emb|CAN75787.1| hypothetical protein VITISV_041015 [Vitis vinifera] Back     alignment and taxonomy information
>gi|18405391|ref|NP_564691.1| ZKT protein containing PDZ, K-box and a TPR region [Arabidopsis thaliana] gi|14532604|gb|AAK64030.1| unknown protein [Arabidopsis thaliana] gi|19310719|gb|AAL85090.1| unknown protein [Arabidopsis thaliana] gi|65329373|gb|AAY42135.1| GAN [Arabidopsis thaliana] gi|66766206|dbj|BAD99102.1| hypothetical protein [Arabidopsis thaliana] gi|332195129|gb|AEE33250.1| ZKT protein containing PDZ, K-box and a TPR region [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|21595827|gb|AAM66135.1| unknown [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
TAIR|locus:2193844335 ZKT "protein containing PDZ do 0.921 0.802 0.636 8.2e-83
TAIR|locus:2167150271 ENH1 "enhancer of sos3-1" [Ara 0.208 0.225 0.387 0.00022
TAIR|locus:2193844 ZKT "protein containing PDZ domain, a K-box domain, and a TPR region" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 830 (297.2 bits), Expect = 8.2e-83, P = 8.2e-83
 Identities = 173/272 (63%), Positives = 197/272 (72%)

Query:    19 RTNQNPFLFSQNSHVWFKKNCFLSASGCS-CNTLLVKPSVFVAKASETXXXXXXXXXXXX 77
             +T QNP L +Q+S +   K+ FLS++  S CNT + K      KASET            
Sbjct:    22 QTKQNPSLITQSSFI-SAKSLFLSSNSASLCNTHVAKRRNLALKASETESSAKAEAGGDG 80

Query:    78 XXXXXXXXXXXXXXXXXXGLKFAKGRDGGTYIDAIAPGGSADKTGMFQVGDKVLATSAVF 137
                               GLKF KGRDGGTYIDAI PGGSADKTG F VGD+V+ATSAVF
Sbjct:    81 EEEEKYETYEIEVEQPY-GLKFRKGRDGGTYIDAILPGGSADKTGKFTVGDRVIATSAVF 139

Query:   138 GTEIWPAAEYGRTMYTIRQRVGPLLMKMQKRYGKMEQTGELSEKEIIRAERNSGVISNRV 197
             GTEIWPAAEYGRTMYTIRQR+GPLLM+M+KR GK E TGEL+EKEIIRAERN+G IS+R+
Sbjct:   140 GTEIWPAAEYGRTMYTIRQRIGPLLMQMEKRNGKAEDTGELTEKEIIRAERNAGYISSRL 199

Query:   198 REIQMQNYMXXXXXXXXXXXDLREGLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYN 257
             REIQMQNY+           DLREGLQ  + GKYE A E+FESVLGSKPTPEE+SVASYN
Sbjct:   200 REIQMQNYLKKKEQKAQREKDLREGLQFSKNGKYEEALERFESVLGSKPTPEEASVASYN 259

Query:   258 VACCYSKLNQVKAGLSALEDALLAGYEDFKVI 289
             VACCYSKLNQV+AGLSALE+AL +GYEDFK I
Sbjct:   260 VACCYSKLNQVQAGLSALEEALKSGYEDFKRI 291




GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009611 "response to wounding" evidence=IEP
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0010264 "myo-inositol hexakisphosphate biosynthetic process" evidence=RCA
GO:0015979 "photosynthesis" evidence=RCA
GO:0016117 "carotenoid biosynthetic process" evidence=RCA
TAIR|locus:2167150 ENH1 "enhancer of sos3-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00024835001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (329 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00024719001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (396 aa)
      0.607
GSVIVG00037015001
SubName- Full=Chromosome chr1 scaffold_84, whole genome shotgun sequence; (198 aa)
      0.590
GSVIVG00037209001
SubName- Full=Chromosome chr16 scaffold_86, whole genome shotgun sequence; (233 aa)
      0.567
GSVIVG00017365001
SubName- Full=Chromosome chr6 scaffold_15, whole genome shotgun sequence; (208 aa)
      0.517
GSVIVG00027006001
SubName- Full=Chromosome chr15 scaffold_40, whole genome shotgun sequence; (440 aa)
      0.505
GSVIVG00025354001
SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (213 aa)
      0.493
GSVIVG00014438001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (180 aa)
      0.487
GSVIVG00034383001
SubName- Full=Putative uncharacterized protein (Chromosome chr9 scaffold_7, whole genome shotgu [...] (144 aa)
       0.472
GSVIVG00015393001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (270 aa)
       0.470
GSVIVG00003851001
SubName- Full=Chromosome chr8 scaffold_150, whole genome shotgun sequence; (518 aa)
       0.466

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
PLN03098 453 PLN03098, LPA1, LOW PSII ACCUMULATION1; Provisiona 2e-05
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 1e-04
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 4e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 5e-04
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 9e-04
>gnl|CDD|215573 PLN03098, LPA1, LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
 Score = 44.9 bits (106), Expect = 2e-05
 Identities = 21/58 (36%), Positives = 31/58 (53%)

Query: 222 GLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYNVACCYSKLNQVKAGLSALEDAL 279
           GL L+  G+ + A  +FE+ L   P P+E+  A YN ACC++   + K     L  AL
Sbjct: 82  GLSLFSKGRVKDALAQFETALELNPNPDEAQAAYYNKACCHAYREEGKKAADCLRTAL 139


Length = 453

>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 292
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 99.31
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.19
KOG0553 304 consensus TPR repeat-containing protein [General f 99.07
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.93
PRK15359144 type III secretion system chaperone protein SscB; 98.92
KOG4234271 consensus TPR repeat-containing protein [General f 98.83
PRK11189 296 lipoprotein NlpI; Provisional 98.82
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.77
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 98.74
PF1337173 TPR_9: Tetratricopeptide repeat 98.7
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 98.67
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 98.62
PRK15359144 type III secretion system chaperone protein SscB; 98.59
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.59
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.58
KOG0547 606 consensus Translocase of outer mitochondrial membr 98.57
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.55
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.52
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.51
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.5
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.45
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.43
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.43
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.42
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.42
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.4
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.4
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.38
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.35
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.35
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.34
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.33
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 98.33
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.28
PRK10370198 formate-dependent nitrite reductase complex subuni 98.27
KOG1125579 consensus TPR repeat-containing protein [General f 98.27
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.26
KOG0553 304 consensus TPR repeat-containing protein [General f 98.26
PRK11189 296 lipoprotein NlpI; Provisional 98.23
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.16
PRK12370 553 invasion protein regulator; Provisional 98.13
KOG4555175 consensus TPR repeat-containing protein [Function 98.12
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.07
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.06
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.04
TIGR03302 235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.03
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.03
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.01
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 98.0
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.0
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.99
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.99
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.93
PRK10370198 formate-dependent nitrite reductase complex subuni 97.91
PLN02789 320 farnesyltranstransferase 97.9
PRK12370 553 invasion protein regulator; Provisional 97.88
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.85
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.85
PRK10803263 tol-pal system protein YbgF; Provisional 97.85
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.85
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 97.82
KOG1125579 consensus TPR repeat-containing protein [General f 97.81
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 97.8
PF1343134 TPR_17: Tetratricopeptide repeat 97.79
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.77
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.76
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 97.73
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 97.73
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.73
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 97.72
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.71
KOG3571 626 consensus Dishevelled 3 and related proteins [Gene 97.71
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.69
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.65
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.64
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.64
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.63
PF12688120 TPR_5: Tetratrico peptide repeat 97.63
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 97.61
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.59
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.59
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.58
PRK11788 389 tetratricopeptide repeat protein; Provisional 97.58
PF13512142 TPR_18: Tetratricopeptide repeat 97.57
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.57
KOG1126638 consensus DNA-binding cell division cycle control 97.56
PF12688120 TPR_5: Tetratrico peptide repeat 97.52
KOG1126638 consensus DNA-binding cell division cycle control 97.51
KOG4234271 consensus TPR repeat-containing protein [General f 97.5
PRK11788389 tetratricopeptide repeat protein; Provisional 97.48
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.48
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 97.47
PLN02789 320 farnesyltranstransferase 97.45
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.44
PRK10803263 tol-pal system protein YbgF; Provisional 97.41
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.38
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.38
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.36
COG3063 250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.36
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 97.31
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.31
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 97.3
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 97.3
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 97.27
KOG1128 777 consensus Uncharacterized conserved protein, conta 97.25
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 97.19
PRK15331165 chaperone protein SicA; Provisional 97.14
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.13
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 97.09
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.09
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.05
PF13512142 TPR_18: Tetratricopeptide repeat 97.02
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.99
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 96.97
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.97
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 96.97
KOG0547 606 consensus Translocase of outer mitochondrial membr 96.95
PRK15331165 chaperone protein SicA; Provisional 96.9
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 96.89
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 96.86
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 96.86
PF1342844 TPR_14: Tetratricopeptide repeat 96.85
KOG2076 895 consensus RNA polymerase III transcription factor 96.83
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 96.83
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.82
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.78
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 96.77
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.77
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.73
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 96.72
KOG1840 508 consensus Kinesin light chain [Cytoskeleton] 96.71
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.64
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.64
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.61
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.61
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.6
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 96.43
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.34
PRK11906458 transcriptional regulator; Provisional 96.29
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 96.29
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 96.28
KOG4162799 consensus Predicted calmodulin-binding protein [Si 96.27
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.27
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.23
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.16
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.15
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 96.13
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.12
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 96.11
PF14938 282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.09
KOG3785 557 consensus Uncharacterized conserved protein [Funct 96.09
PRK11186 667 carboxy-terminal protease; Provisional 96.08
KOG1128 777 consensus Uncharacterized conserved protein, conta 96.04
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 96.03
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 95.89
KOG1129478 consensus TPR repeat-containing protein [General f 95.88
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 95.83
COG4105 254 ComL DNA uptake lipoprotein [General function pred 95.83
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 95.77
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 95.76
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 95.74
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 95.7
PRK14574 822 hmsH outer membrane protein; Provisional 95.69
KOG2076 895 consensus RNA polymerase III transcription factor 95.64
COG0793 406 Prc Periplasmic protease [Cell envelope biogenesis 95.63
KOG2003 840 consensus TPR repeat-containing protein [General f 95.63
PF1342844 TPR_14: Tetratricopeptide repeat 95.57
KOG0609 542 consensus Calcium/calmodulin-dependent serine prot 95.51
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.47
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 95.46
COG1729262 Uncharacterized protein conserved in bacteria [Fun 95.44
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.43
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 95.42
KOG4814 872 consensus Uncharacterized conserved protein [Funct 95.39
PLN00049 389 carboxyl-terminal processing protease; Provisional 95.37
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.34
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.29
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 95.26
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.26
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.23
KOG2003 840 consensus TPR repeat-containing protein [General f 95.22
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 95.18
KOG3550207 consensus Receptor targeting protein Lin-7 [Extrac 95.17
PRK14574 822 hmsH outer membrane protein; Provisional 95.16
KOG4555175 consensus TPR repeat-containing protein [Function 95.12
PF1337173 TPR_9: Tetratricopeptide repeat 95.11
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 95.01
PRK10139455 serine endoprotease; Provisional 94.92
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 94.88
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.71
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 94.7
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 94.68
PRK10898353 serine endoprotease; Provisional 94.64
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 94.55
COG0457291 NrfG FOG: TPR repeat [General function prediction 94.52
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.43
PRK10942473 serine endoprotease; Provisional 94.42
PRK10139455 serine endoprotease; Provisional 94.39
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 94.38
COG4783484 Putative Zn-dependent protease, contains TPR repea 94.35
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 94.34
KOG3209984 consensus WW domain-containing protein [General fu 94.33
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 94.31
KOG1892 1629 consensus Actin filament-binding protein Afadin [C 94.25
KOG3532 1051 consensus Predicted protein kinase [General functi 94.22
PRK10942473 serine endoprotease; Provisional 94.08
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.92
KOG3060289 consensus Uncharacterized conserved protein [Funct 93.85
PRK10779449 zinc metallopeptidase RseP; Provisional 93.84
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 93.83
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 93.72
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 93.71
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 93.7
KOG3553124 consensus Tax interaction protein TIP1 [Cell wall/ 93.64
PRK14720 906 transcript cleavage factor/unknown domain fusion p 93.59
COG0457291 NrfG FOG: TPR repeat [General function prediction 93.58
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 93.51
KOG4648 536 consensus Uncharacterized conserved protein, conta 93.48
KOG3580 1027 consensus Tight junction proteins [Signal transduc 93.42
TIGR01713259 typeII_sec_gspC general secretion pathway protein 93.18
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 93.12
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 93.08
COG3975558 Predicted protease with the C-terminal PDZ domain 93.03
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 92.88
PF06552186 TOM20_plant: Plant specific mitochondrial import r 92.88
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 92.86
PRK10941269 hypothetical protein; Provisional 92.82
KOG3060289 consensus Uncharacterized conserved protein [Funct 92.76
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 92.7
COG4235287 Cytochrome c biogenesis factor [Posttranslational 92.51
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 92.48
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 92.47
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 92.42
PLN03218 1060 maturation of RBCL 1; Provisional 92.36
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 92.25
PLN03218 1060 maturation of RBCL 1; Provisional 92.02
PRK04841 903 transcriptional regulator MalT; Provisional 92.0
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 91.78
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 91.64
COG4976 287 Predicted methyltransferase (contains TPR repeat) 91.55
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 91.41
KOG2796366 consensus Uncharacterized conserved protein [Funct 91.25
KOG3364149 consensus Membrane protein involved in organellar 90.78
PF1343134 TPR_17: Tetratricopeptide repeat 90.51
KOG3785 557 consensus Uncharacterized conserved protein [Funct 90.4
TIGR00054 420 RIP metalloprotease RseP. A model that detects fra 90.39
KOG1129 478 consensus TPR repeat-containing protein [General f 90.33
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 90.19
KOG1941 518 consensus Acetylcholine receptor-associated protei 90.11
PRK10779 449 zinc metallopeptidase RseP; Provisional 89.97
PRK10153517 DNA-binding transcriptional activator CadC; Provis 89.94
COG0265347 DegQ Trypsin-like serine proteases, typically peri 89.88
KOG3606358 consensus Cell polarity protein PAR6 [Signal trans 89.87
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 89.7
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 89.47
KOG3209 984 consensus WW domain-containing protein [General fu 89.37
KOG2376 652 consensus Signal recognition particle, subunit Srp 89.14
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.98
KOG0495 913 consensus HAT repeat protein [RNA processing and m 88.76
PF09986214 DUF2225: Uncharacterized protein conserved in bact 88.67
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 88.34
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 88.08
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 87.98
PRK04841 903 transcriptional regulator MalT; Provisional 87.93
KOG3605829 consensus Beta amyloid precursor-binding protein [ 87.55
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 87.4
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 86.71
KOG3580 1027 consensus Tight junction proteins [Signal transduc 86.6
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 86.47
PF0421269 MIT: MIT (microtubule interacting and transport) d 86.07
KOG3129231 consensus 26S proteasome regulatory complex, subun 86.04
PLN03077 857 Protein ECB2; Provisional 86.0
KOG1174 564 consensus Anaphase-promoting complex (APC), subuni 85.78
smart0074577 MIT Microtubule Interacting and Trafficking molecu 84.71
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.35
COG2976207 Uncharacterized protein conserved in bacteria [Fun 84.23
KOG4162 799 consensus Predicted calmodulin-binding protein [Si 84.18
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 84.08
PLN03077 857 Protein ECB2; Provisional 83.75
COG3118304 Thioredoxin domain-containing protein [Posttransla 83.32
COG4105 254 ComL DNA uptake lipoprotein [General function pred 82.77
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.74
KOG4507 886 consensus Uncharacterized conserved protein, conta 82.61
COG4700251 Uncharacterized protein conserved in bacteria cont 82.25
TIGR02860 402 spore_IV_B stage IV sporulation protein B. SpoIVB, 82.14
KOG2471 696 consensus TPR repeat-containing protein [General f 82.1
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 81.87
KOG3938334 consensus RGS-GAIP interacting protein GIPC, conta 81.64
PF03704146 BTAD: Bacterial transcriptional activator domain; 81.45
TIGR03279 433 cyano_FeS_chp putative FeS-containing Cyanobacteri 81.26
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 81.22
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.97
COG2912269 Uncharacterized conserved protein [Function unknow 80.56
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
Probab=99.31  E-value=6e-12  Score=124.99  Aligned_cols=75  Identities=32%  Similarity=0.505  Sum_probs=67.1

Q ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHcCCCCccchhHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCccChhhhh
Q 022783          216 EQDLREGLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYNVACCYSKLNQVKAGLSALEDALLAGYEDFKVIY  290 (292)
Q Consensus       216 ~~~~n~G~~L~k~gdYeeAIe~fekALeldP~~~d~a~a~YN~AccyakLgq~eeALe~LekAIelG~~Df~~Ir  290 (292)
                      ..++|+|++|+++|+|++|+.+|++||+++|++.+...+|||+||||.++|++++|+++|++||+++...|+.|+
T Consensus        76 ~a~~NLG~AL~~lGryeEAIa~f~rALeL~Pd~aeA~~A~yNLAcaya~LGr~dEAla~LrrALelsn~~f~~i~  150 (453)
T PLN03098         76 EDAVNLGLSLFSKGRVKDALAQFETALELNPNPDEAQAAYYNKACCHAYREEGKKAADCLRTALRDYNLKFSTIL  150 (453)
T ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCchHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhcchhHHHHH
Confidence            456799999999999999999999999999996555568999999999999999999999999999777776554



>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3571 consensus Dishevelled 3 and related proteins [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0609 consensus Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3550 consensus Receptor targeting protein Lin-7 [Extracellular structures] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1892 consensus Actin filament-binding protein Afadin [Cytoskeleton] Back     alignment and domain information
>KOG3532 consensus Predicted protein kinase [General function prediction only] Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG3553 consensus Tax interaction protein TIP1 [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG3209 consensus WW domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3605 consensus Beta amyloid precursor-binding protein [General function prediction only] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG3580 consensus Tight junction proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>KOG3129 consensus 26S proteasome regulatory complex, subunit PSMD9 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 2e-08
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 2e-08
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-08
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 9e-08
2djt_A104 Unnamed protein product; PDZ domain, structural ge 1e-07
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 2e-07
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 2e-07
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 2e-07
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 2e-07
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 2e-07
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 2e-07
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 5e-07
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 5e-07
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 6e-07
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 6e-07
2opg_A98 Multiple PDZ domain protein; structural protein, s 8e-07
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 8e-07
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 9e-07
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 1e-06
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 1e-06
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 1e-06
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-06
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-06
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 2e-06
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 2e-06
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 2e-06
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 2e-06
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-06
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 2e-06
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-06
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-05
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 2e-06
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 3e-06
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 3e-06
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 3e-06
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 4e-06
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 5e-05
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 4e-06
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 5e-06
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 6e-06
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 6e-06
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 7e-06
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 7e-06
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 7e-06
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 7e-06
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 8e-06
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 9e-06
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 9e-06
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 9e-06
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 9e-06
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 1e-05
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 3e-05
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 1e-05
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 1e-05
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 1e-05
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 1e-05
2byg_A117 Channel associated protein of synapse-110; DLG2, P 1e-05
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 1e-05
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 2e-05
2fne_A117 Multiple PDZ domain protein; structural protein, s 2e-05
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 2e-05
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 2e-05
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 2e-05
2o2t_A117 Multiple PDZ domain protein; structural protein, s 2e-05
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 2e-05
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 2e-05
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 2e-05
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 2e-05
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 3e-05
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 3e-05
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 3e-05
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 3e-05
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 4e-05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 4e-05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-04
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 4e-05
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 4e-05
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 4e-05
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 4e-05
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 4e-05
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 5e-05
2awx_A105 Synapse associated protein 97; membrane protein, s 5e-05
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 5e-05
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 6e-05
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 7e-05
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 7e-05
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 8e-05
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 1e-04
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 1e-04
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 6e-04
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-04
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 1e-04
2eaq_A90 LIM domain only protein 7; conserved hypothetical 1e-04
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 1e-04
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 1e-04
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 1e-04
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 1e-04
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 1e-04
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 1e-04
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 1e-04
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 2e-04
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 2e-04
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 2e-04
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 2e-04
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 2e-04
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 2e-04
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 2e-04
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 3e-04
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 3e-04
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 3e-04
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 3e-04
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 4e-04
3k1r_A192 Harmonin; protein-protein complex, alternative spl 4e-04
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 5e-04
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 6e-04
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 6e-04
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 7e-04
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 7e-04
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 7e-04
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 8e-04
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
 Score = 50.8 bits (122), Expect = 2e-08
 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 6/75 (8%)

Query: 64  ETEAQASPEAESGSEEQE-EKYEEYEVEIE-QPYGLKF--AKGRDGGT--YIDAIAPGGS 117
                 S   + G+E    +  + Y VE+E    G  F    GR+     Y+  +A  G 
Sbjct: 2   HHHHHHSSGVDLGTENLYFQSMDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGP 61

Query: 118 ADKTGMFQVGDKVLA 132
           A+++G  ++GD++L 
Sbjct: 62  AERSGKMRIGDEILE 76


>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Length = 170 Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Length = 108 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Length = 102 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Length = 97 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Length = 127 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Length = 124 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 108 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Length = 94 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Length = 105 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 111 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Length = 103 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Length = 91 Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.32
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.24
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.24
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.23
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.21
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.19
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.19
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.16
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.16
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.11
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.09
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.07
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.04
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.04
3k9i_A117 BH0479 protein; putative protein binding protein, 98.97
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.96
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.95
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.94
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.94
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.94
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.93
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.93
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.9
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.9
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.9
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.9
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.9
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 98.89
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.89
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.88
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.87
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.87
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.87
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.86
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.86
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.86
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.85
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.85
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.85
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.85
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.85
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.84
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.84
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.83
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.82
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.81
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.81
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.81
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.79
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.79
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.79
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.77
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.76
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.75
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.74
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.73
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.72
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.72
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.7
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.7
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.69
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.69
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.68
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.67
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 98.66
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.63
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.62
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 98.61
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.61
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.6
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.6
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.6
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.59
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.58
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.58
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 98.58
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 98.58
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.58
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 98.57
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.57
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.57
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.57
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.55
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.55
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.54
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.54
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.54
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.53
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.53
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 98.52
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 98.52
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 98.52
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.52
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.52
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.52
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.51
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.5
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.5
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 98.5
3u4t_A272 TPR repeat-containing protein; structural genomics 98.49
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 98.49
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.49
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.49
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 98.48
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.48
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.48
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 98.47
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 98.46
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.45
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.45
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.45
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 98.45
2opg_A98 Multiple PDZ domain protein; structural protein, s 98.45
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.45
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.44
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 98.44
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.44
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.44
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.43
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.43
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.43
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.43
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 98.43
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 98.43
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.43
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.42
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.42
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 98.42
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 98.42
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.42
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 98.41
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.41
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.41
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 98.41
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.4
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.4
3k9i_A117 BH0479 protein; putative protein binding protein, 98.4
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 98.4
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.38
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 98.38
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 98.38
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 98.38
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.38
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 98.38
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.38
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 98.37
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.37
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 98.36
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.36
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 98.36
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 98.36
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 98.35
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.35
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 98.35
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 98.34
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 98.34
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.34
2awx_A105 Synapse associated protein 97; membrane protein, s 98.34
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.33
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 98.33
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 98.32
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 98.32
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.31
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 98.31
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 98.31
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.31
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.31
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 98.3
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 98.3
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 98.3
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.3
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.29
2byg_A117 Channel associated protein of synapse-110; DLG2, P 98.29
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 98.29
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 98.29
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 98.29
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.29
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.29
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 98.29
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 98.29
2o2t_A117 Multiple PDZ domain protein; structural protein, s 98.28
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.28
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.28
2djt_A104 Unnamed protein product; PDZ domain, structural ge 98.27
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 98.27
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.26
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 98.26
2d90_A102 PDZ domain containing protein 1; structural genomi 98.26
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 98.26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.26
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 98.26
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 98.26
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 98.26
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 98.25
2fne_A117 Multiple PDZ domain protein; structural protein, s 98.25
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 98.25
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.24
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.24
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 98.23
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 98.23
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 98.23
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.22
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.22
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.22
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 98.21
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 98.21
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 98.21
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 98.21
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 98.2
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 98.2
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 98.2
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.19
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 98.19
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.19
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 98.18
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.17
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.17
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.16
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 98.16
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 98.16
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 98.16
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.16
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.15
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 98.15
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.15
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 98.15
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.15
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.14
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.14
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 98.13
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.13
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 98.12
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.12
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.12
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.12
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 98.1
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.1
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 98.1
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.09
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.09
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 98.09
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.09
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 98.09
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 98.09
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.09
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.08
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.08
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.07
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 98.07
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 98.07
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 98.07
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 98.06
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.06
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.06
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 98.06
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.06
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 98.05
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.05
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 98.05
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 98.05
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 98.04
2ego_A96 General receptor for phosphoinositides 1- associat 98.04
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 98.04
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 98.03
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 98.03
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 98.03
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.02
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.02
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.02
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.02
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 98.01
4amh_A106 Disks large homolog 1; permutation, protein foldin 98.01
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 98.01
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.99
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 97.98
2v90_A96 PDZ domain-containing protein 3; membrane, protein 97.97
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 97.95
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 97.95
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 97.94
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 97.94
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 97.93
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.93
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 97.92
2eei_A106 PDZ domain-containing protein 1; regulatory factor 97.92
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 97.92
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 97.92
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 97.91
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.91
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.9
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.9
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 97.9
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 97.9
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 97.9
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 97.89
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 97.88
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 97.88
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 97.88
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 97.87
3k1r_A192 Harmonin; protein-protein complex, alternative spl 97.87
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 97.87
2eaq_A90 LIM domain only protein 7; conserved hypothetical 97.86
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 97.86
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 97.85
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 97.85
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 97.84
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.84
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 97.84
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 97.8
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.79
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 97.79
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 97.76
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 97.76
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.76
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 97.76
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 97.76
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.72
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 97.71
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 97.71
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 97.7
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 97.69
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 97.67
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 97.66
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 97.65
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 97.64
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.64
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 97.63
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 97.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.6
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 97.6
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 97.6
3khf_A99 Microtubule-associated serine/threonine-protein ki 97.57
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 97.57
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.56
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 97.54
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 97.54
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 97.52
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 97.51
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.5
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 97.5
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.48
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 97.47
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 97.47
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 97.45
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 97.41
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.41
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 97.38
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 97.38
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.38
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 97.35
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.35
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 97.3
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 96.36
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.25
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.25
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 97.25
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 97.22
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 97.19
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 97.18
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 97.17
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 97.06
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.03
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 96.98
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 96.96
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 96.94
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 96.93
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 96.92
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 96.91
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.81
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 96.78
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.76
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 96.76
2kl1_A94 YLBL protein; structure genomics, structural genom 96.74
4fgm_A597 Aminopeptidase N family protein; structural genomi 96.72
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.72
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.65
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 96.6
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 96.6
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 96.58
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 96.52
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.42
1fc6_A 388 Photosystem II D1 protease; D1 C-terminal processi 96.39
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.33
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.31
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 96.26
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 96.26
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.22
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 96.21
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.2
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 96.17
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 96.16
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 96.09
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 95.98
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.93
2hga_A125 Conserved protein MTH1368; GFT structural genomics 95.67
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 95.64
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 95.51
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 95.37
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 95.21
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 95.17
3k50_A 403 Putative S41 protease; structural genomics, joint 95.16
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 95.09
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 94.88
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.72
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 94.7
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 94.55
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.39
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 94.33
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 94.29
3mv2_B 310 Coatomer subunit epsilon; vesicular membrane coat 94.09
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.55
1k32_A 1045 Tricorn protease; protein degradation, substrate g 93.31
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.31
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 92.33
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.95
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 91.93
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 91.82
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 91.77
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 89.56
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 88.66
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 88.64
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 87.48
2ijq_A161 Hypothetical protein; structural genomics, PSI, pr 86.52
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 85.78
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 85.68
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 84.7
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 84.0
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 83.6
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 82.77
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 81.98
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 81.93
2vkj_A106 TM1634; membrane protein, TPR motif joint center f 81.5
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 81.14
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 80.67
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 80.58
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 80.21
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.32  E-value=6.7e-12  Score=99.61  Aligned_cols=100  Identities=13%  Similarity=0.121  Sum_probs=79.8

Q ss_pred             HHhhccccchhhHHHHHHH--hhHHHHHhhHhH-HHHHHHHHHHHHcCCHHHHHHHHHHHHcCCCCccchhHHHHHHHHH
Q 022783          185 RAERNSGVISNRVREIQMQ--NYMKKKEQKERR-EQDLREGLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYNVACC  261 (292)
Q Consensus       185 ~a~rN~GvI~~~l~eiqea--~Y~kkk~lk~~~-~~~~n~G~~L~k~gdYeeAIe~fekALeldP~~~d~a~a~YN~Acc  261 (292)
                      .+.+|.|+..-..++.+++  .|.+..++.+.. .-++++|..++++|+|++|++.|++||+++|++   ..+|+|+|.|
T Consensus        14 ~~~~~~G~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~~~~~A~~~~~~al~~~p~~---~~a~~~lg~~   90 (126)
T 4gco_A           14 QEEKNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRLDSKF---IKGYIRKAAC   90 (126)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC---HHHHHHHHHH
T ss_pred             HHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHhhHHHhhccHHHHHHHHHHHHHhhhhh---hHHHHHHHHH
Confidence            3445666666555555554  555555555544 344699999999999999999999999999974   5679999999


Q ss_pred             HHhcCCHHHHHHHHHHHHHhCccChh
Q 022783          262 YSKLNQVKAGLSALEDALLAGYEDFK  287 (292)
Q Consensus       262 yakLgq~eeALe~LekAIelG~~Df~  287 (292)
                      |..+|++++|++++++||++.+++..
T Consensus        91 ~~~~~~~~~A~~~~~~al~l~P~~~~  116 (126)
T 4gco_A           91 LVAMREWSKAQRAYEDALQVDPSNEE  116 (126)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHCTTCHH
T ss_pred             HHHCCCHHHHHHHHHHHHHHCcCCHH
Confidence            99999999999999999999877654



>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2ijq_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.88A {Haloarcula marismortui} SCOP: a.246.2.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>2vkj_A TM1634; membrane protein, TPR motif joint center for structural GENO JCSG, structural genomics; 1.65A {Thermotoga maritima} PDB: 2vko_A* Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 292
d1wfva_103 b.36.1.1 (A:) Membrane associated guanylate kinase 3e-06
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 8e-06
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 4e-05
d1uepa_103 b.36.1.1 (A:) Membrane associated guanylate kinase 6e-05
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 6e-05
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 2e-04
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 2e-04
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 2e-04
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-04
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-04
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 4e-04
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 4e-04
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 5e-04
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 5e-04
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 8e-04
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 8e-04
d1wf8a194 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens 0.001
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 0.001
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 0.002
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 0.002
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.002
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 0.002
d1p1da299 b.36.1.1 (A:115-213) Glutamate receptor interactin 0.003
d1rgra_93 b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus 0.003
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 0.004
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: All beta proteins
fold: PDZ domain-like
superfamily: PDZ domain-like
family: PDZ domain
domain: Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.0 bits (101), Expect = 3e-06
 Identities = 17/64 (26%), Positives = 33/64 (51%), Gaps = 7/64 (10%)

Query: 73  AESGSEEQEEKYEEYEVEIE---QPYGLKFAKGRD--GGTYIDAIAPGGSADKTGMFQVG 127
             SGS  Q+  ++ + V++E   + +G     GR+     Y+  +A  G A + G  +VG
Sbjct: 1   GSSGSSGQD--FDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVG 58

Query: 128 DKVL 131
           D+++
Sbjct: 59  DQII 62


>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 99 Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.24
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 99.22
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.18
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.16
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.14
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.13
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.11
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.09
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.09
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.04
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.02
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.97
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.94
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.92
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.91
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.91
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.87
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.87
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.84
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.84
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.83
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.82
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 98.82
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.81
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 98.8
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.76
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.76
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 98.73
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 98.72
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 98.71
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.68
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 98.67
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 98.67
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 98.66
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 98.66
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 98.63
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 98.61
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 98.61
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 98.6
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.6
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.59
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 98.58
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 98.58
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 98.57
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.54
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.53
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 98.53
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.53
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.52
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 98.52
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 98.51
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.49
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 98.49
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 98.44
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 98.44
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 98.42
d1x45a185 Amyloid beta A4 precursor protein-binding family A 98.41
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 98.4
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.39
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 98.39
d1rzxa_98 GTPase-binding domain of the cell polarity protein 98.34
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 98.31
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 98.3
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 98.29
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 98.29
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 98.28
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 98.27
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 98.26
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 98.25
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 98.25
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 98.23
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 98.23
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 98.18
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 98.18
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 98.17
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 98.17
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 98.17
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 98.16
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 98.15
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.14
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.14
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 98.09
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.03
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 98.0
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.99
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 97.99
d1fc6a392 Photosystem II D1 C-terminal processing protease { 97.98
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.97
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 97.96
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 97.93
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 97.91
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 97.9
d1y7na179 Amyloid beta A4 precursor protein-binding family A 97.86
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.84
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.83
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.83
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 97.8
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.78
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.77
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.73
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 97.72
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 97.52
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.46
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.41
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 97.28
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.27
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 97.19
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.14
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.1
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 96.98
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 96.91
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 96.76
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 96.7
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 96.32
d2onda1 308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 96.19
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.86
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 95.72
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 94.42
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 94.15
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 83.76
d2ijqa1145 Hypothetical protein rrnAC1037 {Haloarcula marismo 83.31
d1wr0a177 Vacuolar sorting protein 4b (VPS4B, SKD1 protein) 82.42
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.24  E-value=7.4e-12  Score=101.09  Aligned_cols=93  Identities=11%  Similarity=0.033  Sum_probs=72.7

Q ss_pred             HHHhhccccchhhHHHHHHHhhHHHHHhhHhHHH-HHHHHHHHHHcCCHHHHHHHHHHHHcCCCCccchhHHHHHHHHHH
Q 022783          184 IRAERNSGVISNRVREIQMQNYMKKKEQKERREQ-DLREGLQLYRTGKYEVAREKFESVLGSKPTPEESSVASYNVACCY  262 (292)
Q Consensus       184 ~~a~rN~GvI~~~l~eiqea~Y~kkk~lk~~~~~-~~n~G~~L~k~gdYeeAIe~fekALeldP~~~d~a~a~YN~Accy  262 (292)
                      -..++..|++..++     ..|.++-.+.+.... +.++|..|.+.|+|++|+..|++||+++|++   ..+|+|+|.||
T Consensus        11 Gn~~~~~g~~~~Ai-----~~~~kal~~~p~~~~~~~~lg~~y~~~~~~~~Ai~~~~~al~l~p~~---~~a~~~lg~~~   82 (201)
T d2c2la1          11 GNRLFVGRKYPEAA-----ACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQS---VKAHFFLGQCQ   82 (201)
T ss_dssp             HHHHHHTTCHHHHH-----HHHHHHHHHCSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHTTSCTTC---HHHHHHHHHHH
T ss_pred             HHHHHHcCCHHHHH-----HHHHHHHHhCCCCHHHHHhHHHHHhhhhhhhhhhHHHHHHHHhCCCc---HHHHHHHHHHH
Confidence            34455555544432     245555555555444 4599999999999999999999999999974   45799999999


Q ss_pred             HhcCCHHHHHHHHHHHHHhCcc
Q 022783          263 SKLNQVKAGLSALEDALLAGYE  284 (292)
Q Consensus       263 akLgq~eeALe~LekAIelG~~  284 (292)
                      ..+|++++|+.++++|+++..+
T Consensus        83 ~~l~~~~~A~~~~~~al~l~p~  104 (201)
T d2c2la1          83 LEMESYDEAIANLQRAYSLAKE  104 (201)
T ss_dssp             HHTTCHHHHHHHHHHHHHHHHH
T ss_pred             HHCCCHHHHHHHHHHHHHhCcc
Confidence            9999999999999999988643



>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ijqa1 a.246.2.1 (A:14-158) Hypothetical protein rrnAC1037 {Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1wr0a1 a.7.14.1 (A:5-81) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure