Citrus Sinensis ID: 022898


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
MDTRKRTKPETGINANGVFKKSKHESESGVGSKSKPCTKFFSTAGCPFGESCHFLHYFPGGYNAVAQMMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKPIAISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRIGPAHAKNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI
ccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccHHHHHHHcccEEEEccccccccccEEEEEccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccc
cccccccccccccccccccccccccccccccccccccHHEccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccEcccHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHcccccccHHHHHHcccEEEEEcccccccccEEEEEccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEHHHHcccccccccccccccccHHHHHcccc
mdtrkrtkpetginangvfkkskhesesgvgskskpctkffstagcpfgeschflhyfpggyNAVAQMMnlpqavpapsrnmavpppasngptvvKSRMCNrlnsaegckfgdkchfahgewelgkpiaishddprafgavpgrmggryepppapgpaasfgasaTAKISVDASLAGaiigkggvnskQICRQtgaklsirdheadpnlrnielegSFEQIKQASAMVRELIVRIgpahaknpatagsaahplssnfktklcgnfakgsctfgdrchfahGAAELRKTAI
mdtrkrtkpetginangvfkkskhesesgvgskskpcTKFFSTAGCPFGESCHFLHYFPGGYNAVAQMMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKpiaishddpRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAIigkggvnskqICRQTGaklsirdheadpnlrnIELEGSFEQIKQASAMVRELIVRIGPAHAKNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI
MDTRKRTKPETGINANGVFKKSKHESESGVGSKSKPCTKFFSTAGCPFGESCHFLHYFPGGYNAVAQMMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKPIAISHDDPRAFGAVPGRMGGRYEpppapgpaasfgasaTAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRIGPAHAKNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI
************************************CTKFFSTAGCPFGESCHFLHYFPGGYNAVAQMMN****************************MCNRLNSAEGCKFGDKCHFAHGEWELGKPIAISH************************************ISVDASLAGAIIGKGGVNSKQICRQTGAKL*******************FEQIKQASAMVRELIVRIGP******************NFKTKLCGNFAKGSCTFGDRCHFAHGA********
*************************************TKFFSTAGCPFGESCHFLHYF************************************************************HGEWELGKPIAISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTG****************IELEGSFEQIKQASAMVRELIVRIGPAHAKNPATAGSA***L***FKTKLCGNFAKGSCTFGDRCHFAHGAA*L*****
*********ETGINANGVFK**************KPCTKFFSTAGCPFGESCHFLHYFPGGYNAVAQMMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKPIAISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRIGPAHA**********HPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI
*******************************SKSKPCTKFFSTAGCPFGESCHFLHYFPGGYNAVAQMMNLPQAVPAPSRNMA*******GPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKPIAI*******************EPPPAP*******ASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRIGP******************NFKTKLCGNFAKGSCTFGDRCHFAHG*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTRKRTKPETGINANGVFKKSKHESESGVGSKSKPCTKFFSTAGCPFGESCHFLHYFPGGYNAVAQMMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKPIAISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRIGPAHAKNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query290 2.2.26 [Sep-21-2011]
Q7F8R0300 Zinc finger CCCH domain-c yes no 0.972 0.94 0.632 1e-90
Q69XQ3295 Zinc finger CCCH domain-c no no 0.948 0.932 0.616 2e-89
Q7XPK1309 Zinc finger CCCH domain-c no no 0.955 0.896 0.564 3e-80
Q9C7C3248 Zinc finger CCCH domain-c yes no 0.803 0.939 0.523 2e-71
Q9FG30240 Zinc finger CCCH domain-c no no 0.796 0.962 0.526 1e-70
Q9LT81386 Zinc finger CCCH domain-c no no 0.665 0.5 0.271 5e-08
Q84UQ3367 Zinc finger CCCH domain-c no no 0.324 0.256 0.355 7e-07
Q5PP65252 Zinc finger CCCH domain-c no no 0.313 0.361 0.333 4e-05
Q9LQM3384 Zinc finger CCCH domain-c no no 0.113 0.085 0.558 0.0007
>sp|Q7F8R0|C3H14_ORYSJ Zinc finger CCCH domain-containing protein 14 OS=Oryza sativa subsp. japonica GN=Os02g0194200 PE=2 SV=1 Back     alignment and function desciption
 Score =  332 bits (852), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 209/297 (70%), Gaps = 15/297 (5%)

Query: 4   RKRTKPETGINANGVFKKSKHESES---GVGSKSKPCTKFFSTAGCPFGESCHFLHYFPG 60
           RKR KP+    ANG   K   ESES   GVGSKSKPCTKFFST+GCPFGE CHFLH+FPG
Sbjct: 6   RKRGKPD---GANGAGGKRARESESFQTGVGSKSKPCTKFFSTSGCPFGEGCHFLHHFPG 62

Query: 61  GYNAVAQMMNL--PQAVPAPSRNMAVPPPASNGPTV--VKSRMCNRLNSAEGCKFGDKCH 116
           GY AVA+M NL  P   P P R M +     +GP    VK+R+CN+ N+AEGCK+GDKCH
Sbjct: 63  GYQAVAKMTNLGGPAIAPPPGR-MPMGNAVPDGPPTPTVKTRLCNKYNTAEGCKWGDKCH 121

Query: 117 FAHGEWELGKPIAISHDDPRAFGAVP-GRMGGRYEPPPAPGPAASFGASATAKISVDASL 175
           FAHGE ELGKP+ +    P   G  P G       P PA    ASFGASATAKISVDASL
Sbjct: 122 FAHGERELGKPMLMDSSMPPPMGPRPTGHFAPPPMPSPAMSTPASFGASATAKISVDASL 181

Query: 176 AGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRI 235
           AG IIG+GGVN+KQI R TGAKL+IRDHE+D NL+NIELEG+F+QIK ASAMVRELIV I
Sbjct: 182 AGGIIGRGGVNTKQISRVTGAKLAIRDHESDTNLKNIELEGTFDQIKNASAMVRELIVSI 241

Query: 236 G---PAHAKNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTA 289
           G   P   K P           SNFKTKLC NF KGSCTFGDRCHFAHG  ELRK+A
Sbjct: 242 GGGAPPQGKKPVGGSHRGGGPGSNFKTKLCENFTKGSCTFGDRCHFAHGENELRKSA 298





Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q69XQ3|C3H44_ORYSJ Zinc finger CCCH domain-containing protein 44 OS=Oryza sativa subsp. japonica GN=Os06g0618100 PE=2 SV=1 Back     alignment and function description
>sp|Q7XPK1|C3H31_ORYSJ Zinc finger CCCH domain-containing protein 31 OS=Oryza sativa subsp. japonica GN=Os04g0665700 PE=2 SV=1 Back     alignment and function description
>sp|Q9C7C3|C3H36_ARATH Zinc finger CCCH domain-containing protein 36 OS=Arabidopsis thaliana GN=At3g12130 PE=2 SV=1 Back     alignment and function description
>sp|Q9FG30|C3H52_ARATH Zinc finger CCCH domain-containing protein 52 OS=Arabidopsis thaliana GN=At5g06770 PE=2 SV=1 Back     alignment and function description
>sp|Q9LT81|C3H39_ARATH Zinc finger CCCH domain-containing protein 39 OS=Arabidopsis thaliana GN=At3g19360 PE=2 SV=1 Back     alignment and function description
>sp|Q84UQ3|C3H56_ORYSJ Zinc finger CCCH domain-containing protein 56 OS=Oryza sativa subsp. japonica GN=Os08g0159800 PE=2 SV=1 Back     alignment and function description
>sp|Q5PP65|C3H28_ARATH Zinc finger CCCH domain-containing protein 28 OS=Arabidopsis thaliana GN=At2g35430 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQM3|C3H12_ARATH Zinc finger CCCH domain-containing protein 12 OS=Arabidopsis thaliana GN=At1g32360 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
225441425297 PREDICTED: zinc finger CCCH domain-conta 0.996 0.973 0.748 1e-121
255585533295 conserved hypothetical protein [Ricinus 0.986 0.969 0.755 1e-119
255585535295 conserved hypothetical protein [Ricinus 0.986 0.969 0.744 1e-115
449457299305 PREDICTED: zinc finger CCCH domain-conta 0.989 0.940 0.704 1e-114
449437587296 PREDICTED: zinc finger CCCH domain-conta 0.989 0.969 0.722 1e-113
363807948295 uncharacterized protein LOC100803981 [Gl 0.989 0.972 0.724 1e-112
356504857295 PREDICTED: zinc finger CCCH domain-conta 0.986 0.969 0.712 1e-109
356504859295 PREDICTED: zinc finger CCCH domain-conta 0.986 0.969 0.712 1e-109
255634442295 unknown [Glycine max] 0.986 0.969 0.709 1e-109
224139806285 predicted protein [Populus trichocarpa] 0.965 0.982 0.693 1e-106
>gi|225441425|ref|XP_002279071.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  442 bits (1136), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 223/298 (74%), Positives = 247/298 (82%), Gaps = 9/298 (3%)

Query: 1   MDTRKRTKPETGINANGVFKKSKHESES---GVGSKSKPCTKFFSTAGCPFGESCHFLHY 57
           MDTRKR +P   +NANG FKKSK E ES   G+GSKSKPCTKFFST+GCPFGESCHFLHY
Sbjct: 1   MDTRKRGRPGGALNANGGFKKSKQEVESLSTGIGSKSKPCTKFFSTSGCPFGESCHFLHY 60

Query: 58  FPGGYNAVAQMMNLPQAVPAPSRNMA-VPPPASNGPTV--VKSRMCNRLNSAEGCKFGDK 114
            PGGYNAVAQM N    +P  SRNMA  PPP  NG ++  VKS+MCN+ N+AEGCKFGDK
Sbjct: 61  VPGGYNAVAQMTNQAPILPPASRNMAGPPPPVPNGSSMPAVKSKMCNKFNTAEGCKFGDK 120

Query: 115 CHFAHGEWELGKPIAISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDAS 174
           CHFAHGEWELGKP+A  HDDPRA G++PGR+ GR EP P  GPAASFGASATAKISVDAS
Sbjct: 121 CHFAHGEWELGKPLAPYHDDPRAMGSIPGRLAGRIEPSPT-GPAASFGASATAKISVDAS 179

Query: 175 LAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVR 234
           LAGAIIGKGGVNSKQICRQTGAKLSIR+H++DPNLRNIELEG+FEQIK+ASAMVRELIV 
Sbjct: 180 LAGAIIGKGGVNSKQICRQTGAKLSIREHDSDPNLRNIELEGTFEQIKEASAMVRELIVN 239

Query: 235 IG--PAHAKNPATAGSAAHPLSSNFKTKLCGNFAKGSCTFGDRCHFAHGAAELRKTAI 290
           I   P HA+  A  G    P +SN+KTKLC NF KGSCTFG+RCHFAHGA ELRK+AI
Sbjct: 240 ISAMPGHARTTAMPGGGQAPPASNYKTKLCDNFTKGSCTFGERCHFAHGAGELRKSAI 297




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255585533|ref|XP_002533457.1| conserved hypothetical protein [Ricinus communis] gi|223526690|gb|EEF28926.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|255585535|ref|XP_002533458.1| conserved hypothetical protein [Ricinus communis] gi|223526691|gb|EEF28927.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|449457299|ref|XP_004146386.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Cucumis sativus] gi|449480828|ref|XP_004156007.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449437587|ref|XP_004136573.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|363807948|ref|NP_001242454.1| uncharacterized protein LOC100803981 [Glycine max] gi|255636900|gb|ACU18783.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356504857|ref|XP_003521211.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] Back     alignment and taxonomy information
>gi|356504859|ref|XP_003521212.1| PREDICTED: zinc finger CCCH domain-containing protein 14-like [Glycine max] Back     alignment and taxonomy information
>gi|255634442|gb|ACU17586.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|224139806|ref|XP_002323285.1| predicted protein [Populus trichocarpa] gi|222867915|gb|EEF05046.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query290
TAIR|locus:2170169240 AT5G06770 [Arabidopsis thalian 0.651 0.787 0.509 2.3e-46
TAIR|locus:2099292248 AT3G12130 [Arabidopsis thalian 0.658 0.770 0.518 6.2e-46
TAIR|locus:2028306384 AT1G32360 [Arabidopsis thalian 0.144 0.109 0.5 3.8e-10
UNIPROTKB|P26651 326 ZFP36 "Tristetraprolin" [Homo 0.193 0.171 0.413 0.00013
TAIR|locus:2090669386 AT3G19360 [Arabidopsis thalian 0.151 0.113 0.458 9.1e-07
RGD|620722 320 Zfp36 "zinc finger protein 36" 0.193 0.175 0.413 0.00036
UNIPROTKB|P47973 320 Zfp36 "Tristetraprolin" [Rattu 0.193 0.175 0.413 0.00036
WB|WBGene00009532460 ccch-1 [Caenorhabditis elegans 0.334 0.210 0.291 2.3e-07
UNIPROTKB|Q6S9E0 325 ZFP36 "Tristetraprolin" [Ovis 0.175 0.156 0.415 0.00082
MGI|MGI:99180 319 Zfp36 "zinc finger protein 36" 0.193 0.175 0.413 0.00036
TAIR|locus:2170169 AT5G06770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 486 (176.1 bits), Expect = 2.3e-46, P = 2.3e-46
 Identities = 106/208 (50%), Positives = 131/208 (62%)

Query:    96 KSRMCNRLNSAEGCKFGDKCHFAH---GEWE-------LGKPIAISHDDPRAFGAVPGRM 145
             KS+ C +  S  GC FGD CHF H   G +        L  P++    + +  G   GR 
Sbjct:    38 KSKPCTKFFSTSGCPFGDNCHFLHYVPGGYNAAAQMTNLRPPVSQVSRNMQGSGGPGGRF 97

Query:   146 GGRYEXXXXXXXXXXXXXXXTAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEA 205
              GR +               T+KISVDASLAGAIIGKGG++SKQICR+TGAKLSI+DHE 
Sbjct:    98 SGRGDPGSGPVSIFGAS---TSKISVDASLAGAIIGKGGIHSKQICRETGAKLSIKDHER 154

Query:   206 DPNLRNIELEGSFEQIKQASAMVRELIVRIGPAHAKNPATAGSAA---HPLSSNFKTKLC 262
             DPNL+ IELEG+FEQI  AS MVRELI R+G    K P   G      HP  SN+KTK+C
Sbjct:   155 DPNLKIIELEGTFEQINVASGMVRELIGRLGSV--KKPQGIGGPEGKPHP-GSNYKTKIC 211

Query:   263 GNFAKGSCTFGDRCHFAHGAAELRKTAI 290
               ++KG+CT+GDRCHFAHG +ELR++ I
Sbjct:   212 DRYSKGNCTYGDRCHFAHGESELRRSGI 239


GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0003723 "RNA binding" evidence=IEA
GO:0005737 "cytoplasm" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=TAS
TAIR|locus:2099292 AT3G12130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028306 AT1G32360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|P26651 ZFP36 "Tristetraprolin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2090669 AT3G19360 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|620722 Zfp36 "zinc finger protein 36" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P47973 Zfp36 "Tristetraprolin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00009532 ccch-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q6S9E0 ZFP36 "Tristetraprolin" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
MGI|MGI:99180 Zfp36 "zinc finger protein 36" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7F8R0C3H14_ORYSJNo assigned EC number0.63290.97240.94yesno
Q9C7C3C3H36_ARATHNo assigned EC number0.52300.80340.9395yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 8e-15
pfam0001359 pfam00013, KH_1, KH domain 2e-12
smart0032268 smart00322, KH, K homology RNA-binding domain 2e-12
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 4e-09
pfam1301442 pfam13014, KH_3, KH domain 3e-08
smart0035627 smart00356, ZnF_C3H1, zinc finger 9e-07
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 2e-06
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 8e-06
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 3e-04
PRK13764602 PRK13764, PRK13764, ATPase; Provisional 3e-04
PRK11824693 PRK11824, PRK11824, polynucleotide phosphorylase/p 0.001
TIGR03591684 TIGR03591, polynuc_phos, polyribonucleotide nucleo 0.002
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
 Score = 67.2 bits (165), Expect = 8e-15
 Identities = 23/63 (36%), Positives = 38/63 (60%)

Query: 166 TAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQAS 225
           T ++ V +SL G IIGKGG   K+I  +TGAK+ I D  +    R + + G+ E +++A 
Sbjct: 1   TERVLVPSSLVGRIIGKGGSTIKEIREETGAKIKIPDSGSGSEERIVTITGTPEAVEKAK 60

Query: 226 AMV 228
            ++
Sbjct: 61  ELI 63


KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that belong to different protein folds, but they share a single KH motif. The KH motif is folded into a beta alpha alpha beta unit. In addition to the core, type II KH domains (e.g. ribosomal protein S3) include N-terminal extension and type I KH domains (e.g. hnRNP K) contain C-terminal extension. Length = 64

>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|184311 PRK13764, PRK13764, ATPase; Provisional Back     alignment and domain information
>gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>gnl|CDD|234271 TIGR03591, polynuc_phos, polyribonucleotide nucleotidyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 290
KOG2191 402 consensus RNA-binding protein NOVA1/PASILLA and re 99.74
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 99.6
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 99.43
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.29
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 99.19
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 99.13
KOG1676 600 consensus K-homology type RNA binding proteins [RN 99.1
KOG2192390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 99.08
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.02
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.98
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.97
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 98.94
KOG1676 600 consensus K-homology type RNA binding proteins [RN 98.92
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 98.8
KOG2190 485 consensus PolyC-binding proteins alphaCP-1 and rel 98.72
KOG1040325 consensus Polyadenylation factor I complex, subuni 98.66
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 98.64
KOG2191 402 consensus RNA-binding protein NOVA1/PASILLA and re 98.62
KOG2193584 consensus IGF-II mRNA-binding protein IMP, contain 98.6
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 98.57
PF1301443 KH_3: KH domain 98.55
smart0032269 KH K homology RNA-binding domain. 98.51
KOG1595 528 consensus CCCH-type Zn-finger protein [General fun 98.37
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 98.35
smart0035627 ZnF_C3H1 zinc finger. 98.27
smart0035627 ZnF_C3H1 zinc finger. 98.22
KOG2333 614 consensus Uncharacterized conserved protein [Gener 98.11
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 98.04
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.02
PRK13763180 putative RNA-processing protein; Provisional 97.96
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 97.91
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 97.76
KOG2190 485 consensus PolyC-binding proteins alphaCP-1 and rel 97.74
PRK13763180 putative RNA-processing protein; Provisional 97.57
KOG1040325 consensus Polyadenylation factor I complex, subuni 97.45
KOG2192 390 consensus PolyC-binding hnRNP-K protein HRB57A/hnR 97.44
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 97.42
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.2
KOG1763343 consensus Uncharacterized conserved protein, conta 97.18
COG5252299 Uncharacterized conserved protein, contains CCCH-t 97.06
KOG0336 629 consensus ATP-dependent RNA helicase [RNA processi 96.96
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 96.9
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 96.72
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 96.64
KOG0119 554 consensus Splicing factor 1/branch point binding p 96.55
KOG4791 667 consensus Uncharacterized conserved protein [Funct 96.52
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.22
KOG2185 486 consensus Predicted RNA-processing protein, contai 96.14
KOG2185486 consensus Predicted RNA-processing protein, contai 96.11
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 96.07
KOG2494 331 consensus C3H1-type Zn-finger protein [Transcripti 96.01
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 95.93
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 95.74
KOG2113 394 consensus Predicted RNA binding protein, contains 95.37
COG5152259 Uncharacterized conserved protein, contains RING a 95.29
KOG2333 614 consensus Uncharacterized conserved protein [Gener 95.18
COG1094194 Predicted RNA-binding protein (contains KH domains 94.73
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 94.48
KOG1492377 consensus C3H1-type Zn-finger protein [General fun 94.44
COG5152259 Uncharacterized conserved protein, contains RING a 94.06
KOG2279 608 consensus Kinase anchor protein AKAP149, contains 93.62
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 93.22
KOG1763 343 consensus Uncharacterized conserved protein, conta 93.08
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 92.95
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 92.45
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 92.32
COG5176269 MSL5 Splicing factor (branch point binding protein 92.25
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 92.05
COG5084285 YTH1 Cleavage and polyadenylation specificity fact 91.12
COG5252 299 Uncharacterized conserved protein, contains CCCH-t 91.05
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 89.62
PRK08406140 transcription elongation factor NusA-like protein; 89.32
KOG2814 345 consensus Transcription coactivator complex, P50 c 89.08
KOG1588259 consensus RNA-binding protein Sam68 and related KH 88.34
PRK0046875 hypothetical protein; Provisional 87.7
COG183776 Predicted RNA-binding protein (contains KH domain) 87.5
PRK0106478 hypothetical protein; Provisional 87.39
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 87.38
PRK0282177 hypothetical protein; Provisional 87.37
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 86.96
PRK12704 520 phosphodiesterase; Provisional 86.73
PRK00106 535 hypothetical protein; Provisional 86.21
PRK08406140 transcription elongation factor NusA-like protein; 85.8
PF1065023 zf-C3H1: Putative zinc-finger domain; InterPro: IP 84.76
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 83.99
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 82.74
KOG0153 377 consensus Predicted RNA-binding protein (RRM super 82.04
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 81.7
KOG3273252 consensus Predicted RNA-binding protein Pno1p inte 81.51
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 81.4
COG1094194 Predicted RNA-binding protein (contains KH domains 81.13
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
Probab=99.74  E-value=2.1e-18  Score=154.11  Aligned_cols=164  Identities=21%  Similarity=0.194  Sum_probs=127.9

Q ss_pred             eEecccCCCchhhhhhccCCCCCCCCCCCCCC---CCCCCCCCCcccccccccccccccCCCCCcccccccccccCCCcc
Q 022898           53 HFLHYFPGGYNAVAQMMNLPQAVPAPSRNMAV---PPPASNGPTVVKSRMCNRLNSAEGCKFGDKCHFAHGEWELGKPIA  129 (290)
Q Consensus        53 ~F~H~~~~~~~~~~~~~~~g~~~~~~~~~~~~---~s~~~~~~~~~ktr~C~~~~~~g~C~~G~~C~f~H~~~el~~~~~  129 (290)
                      .|+..|+|+|+++++|+++|++|.++|+++++   +|.+.+++|++.+|+|.+.++.....   ..+-...+        
T Consensus        39 y~ikvLips~AaGsIIGKGG~ti~~lqk~tgariklSks~dfyPGTTeRvcli~Gt~eai~---av~efI~d--------  107 (402)
T KOG2191|consen   39 YFLKVLIPSYAAGSIIGKGGQTIVQLQKETGARIKLSKSKDFYPGTTERVCLIQGTVEALN---AVHEFIAD--------  107 (402)
T ss_pred             eEEEEEeecccccceeccchHHHHHHHhccCcEEEeccccccCCCccceEEEEeccHHHHH---HHHHHHHH--------
Confidence            88999999999999999999999999999998   78999999999999999988876444   11211212        


Q ss_pred             cCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcCCCCceEEEEecccccceeeCCCCCchhhHHHhhCCceeecc-CCC--C
Q 022898          130 ISHDDPRAFGAVPGRMGGRYEPPPAPGPAASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRD-HEA--D  206 (290)
Q Consensus       130 ~~~~~~~~~~p~~~~~~~~~~~~~~p~~~~s~~~~~t~~i~VP~~~vg~iIGkgG~~Ik~i~~~sga~i~v~~-~~~--~  206 (290)
                          +++..+..........++..       -....++++.||++.+|+||||+|.+||.|+++++++|+|++ .+.  .
T Consensus       108 ----Kire~p~~~~k~v~~~~pqt-------~~r~kqikivvPNstag~iigkggAtiK~~~Eqsga~iqisPqkpt~~s  176 (402)
T KOG2191|consen  108 ----KIREKPQAVAKPVDILQPQT-------PDRIKQIKIVVPNSTAGMIIGKGGATIKAIQEQSGAWIQISPQKPTGIS  176 (402)
T ss_pred             ----HHHHhHHhhcCCccccCCCC-------ccccceeEEeccCCcccceecCCcchHHHHHHhhCcceEecccCCCCcc
Confidence                12222222222222222211       123577999999999999999999999999999999999984 333  3


Q ss_pred             CCcceeEEcCCHHHHHHHHHHHHHHHHhcCCC
Q 022898          207 PNLRNIELEGSFEQIKQASAMVRELIVRIGPA  238 (290)
Q Consensus       207 ~~~r~v~i~G~~~~i~~A~~~I~~~i~~~~~~  238 (290)
                      ..+|+++++|++++..+|..+|.++|.|++..
T Consensus       177 Lqervvt~sge~e~~~~A~~~IL~Ki~eDpqs  208 (402)
T KOG2191|consen  177 LQERVVTVSGEPEQNMKAVSLILQKIQEDPQS  208 (402)
T ss_pred             ceeEEEEecCCHHHHHHHHHHHHHHhhcCCcc
Confidence            34899999999999999999999999988765



>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG1676 consensus K-homology type RNA binding proteins [RNA processing and modification] Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2191 consensus RNA-binding protein NOVA1/PASILLA and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>KOG2190 consensus PolyC-binding proteins alphaCP-1 and related KH domain proteins [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>KOG2192 consensus PolyC-binding hnRNP-K protein HRB57A/hnRNP, contains KH domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4791 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification] Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2279 consensus Kinase anchor protein AKAP149, contains KH and Tudor RNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>COG5084 YTH1 Cleavage and polyadenylation specificity factor (CPSF) Clipper subunit and related makorin family Zn-finger proteins [General function prediction only] Back     alignment and domain information
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>KOG2814 consensus Transcription coactivator complex, P50 component (LigT RNA ligase/phosphodiesterase family) [Transcription] Back     alignment and domain information
>KOG1588 consensus RNA-binding protein Sam68 and related KH domain proteins [RNA processing and modification] Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PF10650 zf-C3H1: Putative zinc-finger domain; InterPro: IPR019607 This domain is conserved in fungi and might be a zinc-finger domain as it contains three conserved Cs and an H in the C-x8-C-x5-C-x3-H conformation typical of a zinc-finger Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>KOG3273 consensus Predicted RNA-binding protein Pno1p interacting with Nob1p and involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
1j4w_A174 Complex Of The Kh3 And Kh4 Domains Of Fbp With A Si 2e-04
1zzi_A82 Crystal Structure Analysis Of The Third Kh Domain O 3e-04
1j5k_A89 Complex Of The Kh3 Domain Of Hnrnp K With A Single_ 3e-04
2hh2_A107 Solution Structure Of The Fourth Kh Domain Of Ksrp 6e-04
>pdb|1J4W|A Chain A, Complex Of The Kh3 And Kh4 Domains Of Fbp With A Single_stranded 29mer Dna Oligonucleotide From The Fuse Element Of The C-Myc Oncogene Length = 174 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 3/60 (5%) Query: 176 AGAIIGKGGVNSKQICRQTGAKLSIRDH---EADPNLRNIELEGSFEQIKQASAMVRELI 232 G IIGKGG K I +Q+GA++ ++ + ADPN++ + G+ +QI A ++ E I Sbjct: 115 TGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKI 174
>pdb|1ZZI|A Chain A, Crystal Structure Analysis Of The Third Kh Domain Of Hnrnp K In Complex With Ssdna Length = 82 Back     alignment and structure
>pdb|1J5K|A Chain A, Complex Of The Kh3 Domain Of Hnrnp K With A Single_stranded 10mer Dna Oligonucleotide Length = 89 Back     alignment and structure
>pdb|2HH2|A Chain A, Solution Structure Of The Fourth Kh Domain Of Ksrp Length = 107 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query290
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 6e-23
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 2e-21
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 2e-21
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 4e-20
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 2e-19
1x4n_A92 FAR upstream element binding protein 1; KH domain, 2e-17
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 3e-17
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 6e-17
1x4m_A94 FAR upstream element binding protein 1; KH domain, 1e-16
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 4e-15
1j4w_A174 FUSE binding protein; single-stranded DNA binding 8e-15
1j4w_A174 FUSE binding protein; single-stranded DNA binding 5e-13
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 1e-14
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 7e-12
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 1e-14
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-13
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 4e-12
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 2e-13
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 7e-12
1we8_A104 Tudor and KH domain containing protein; structural 3e-13
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 9e-13
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-12
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 1e-12
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 1e-07
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 6e-06
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 9e-06
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 3e-11
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 5e-11
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 2e-10
2dgr_A83 Ring finger and KH domain-containing protein 1; st 4e-09
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 6e-09
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 2e-08
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 2e-07
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 5e-07
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 5e-05
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 9e-07
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 9e-06
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-05
1tua_A191 Hypothetical protein APE0754; structural genomics, 3e-05
1tua_A191 Hypothetical protein APE0754; structural genomics, 3e-04
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 2e-04
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 3e-04
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 5e-04
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 5e-04
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 7e-04
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
 Score = 88.9 bits (221), Expect = 6e-23
 Identities = 23/74 (31%), Positives = 41/74 (55%)

Query: 159 ASFGASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSF 218
            + G   T ++++   LAG+IIGKGG   KQI  ++GA + I +       R I + G+ 
Sbjct: 1   GAMGPIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQ 60

Query: 219 EQIKQASAMVRELI 232
           +QI+ A  +++  +
Sbjct: 61  DQIQNAQYLLQNSV 74


>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.66
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 99.55
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.45
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.44
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.42
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.41
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.4
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.36
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.35
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.35
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.34
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.34
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.34
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.3
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.29
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 99.26
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 99.21
1we8_A104 Tudor and KH domain containing protein; structural 99.2
2rhk_C72 Cleavage and polyadenylation specificity factor su 99.14
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.14
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.07
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.05
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.04
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.03
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.99
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.98
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 98.98
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.97
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 98.96
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.95
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.94
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.94
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.92
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.91
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 98.84
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.81
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 98.76
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 98.75
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 98.69
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.68
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 98.65
2rhk_C72 Cleavage and polyadenylation specificity factor su 98.58
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 98.54
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 98.52
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 98.51
2cpq_A91 FragIle X mental retardation syndrome related prot 98.47
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 98.33
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.3
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 98.27
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.25
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 98.18
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 97.86
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 97.81
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 97.78
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.76
3n89_A376 Defective in GERM LINE development protein 3, ISO; 97.75
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 97.72
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 97.67
1tua_A191 Hypothetical protein APE0754; structural genomics, 97.66
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 97.44
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 97.32
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 97.27
1tua_A191 Hypothetical protein APE0754; structural genomics, 97.23
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.11
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 96.54
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 96.51
2fc6_A50 Nuclear, target of EGR1, member 1; structure genom 94.94
3u9g_A229 Zinc finger CCCH-type antiviral protein 1; zinc fi 94.79
3u1l_A 240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 93.68
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 92.15
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 91.39
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 90.53
3v33_A223 Ribonuclease ZC3H12A; rossmann-like sandwich fold, 82.86
3v33_A223 Ribonuclease ZC3H12A; rossmann-like sandwich fold, 82.75
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 82.39
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
Probab=99.66  E-value=1.8e-17  Score=120.89  Aligned_cols=70  Identities=29%  Similarity=0.677  Sum_probs=29.0

Q ss_pred             CCccccccccccccCCCCCCCCCceEecccCCCchhhhhhccCCCCCCCCCCCCCCCCCCCCCCCccccccccccccccc
Q 022898           29 GVGSKSKPCTKFFSTAGCPFGESCHFLHYFPGGYNAVAQMMNLPQAVPAPSRNMAVPPPASNGPTVVKSRMCNRLNSAEG  108 (290)
Q Consensus        29 ~~~~Kt~lC~~~~~~g~C~~G~~C~F~H~~~~~~~~~~~~~~~g~~~~~~~~~~~~~s~~~~~~~~~ktr~C~~~~~~g~  108 (290)
                      +..|||+||++|+.+|.|+||++|+|+|++.+          +...               ...+.+++++|..|...|.
T Consensus         7 ~~~~kt~~C~~f~~~G~C~~G~~C~f~H~~~e----------~~~~---------------~~~~~~k~~~C~~f~~~G~   61 (77)
T 1m9o_A            7 SSRYKTELCRTYSESGRCRYGAKCQFAHGLGE----------LRQA---------------NRHPKYKTELCHKFKLQGR   61 (77)
T ss_dssp             SSCCCSCCCSGGGGTSCCTTTTTCSSCSSSCC----------GGGT---------------C------------------
T ss_pred             CCCccchhCHHhhhCCCcCCCCCccCCCCChh----------hccc---------------cccccccCCcccchhhCcC
Confidence            67899999999988899999999999998621          1100               1236788999999999999


Q ss_pred             CCCCCcccccccccc
Q 022898          109 CKFGDKCHFAHGEWE  123 (290)
Q Consensus       109 C~~G~~C~f~H~~~e  123 (290)
                      |+||.+|+|+|...|
T Consensus        62 C~~G~~C~f~H~~~e   76 (77)
T 1m9o_A           62 CPYGSRCHFIHNPTE   76 (77)
T ss_dssp             ---------------
T ss_pred             CCCcCcCCCCCCCCC
Confidence            999999999997644



>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2fc6_A Nuclear, target of EGR1, member 1; structure genomics, ZF-CCCH domain, member 1(nuclear), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.66.1.1 Back     alignment and structure
>3u9g_A Zinc finger CCCH-type antiviral protein 1; zinc finger protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>3v33_A Ribonuclease ZC3H12A; rossmann-like sandwich fold, RNAse, cytoplastic, hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 290
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 1e-17
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 6e-16
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 8e-16
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 2e-15
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 2e-15
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 4e-15
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 4e-15
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 8e-15
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 3e-13
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 3e-13
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 3e-13
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 4e-13
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 1e-12
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 5e-12
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 2e-08
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 2e-04
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 8e-12
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 9e-12
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 5e-08
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 1e-04
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 5e-11
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 3e-09
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 5e-09
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 2e-07
d1rgoa234 g.66.1.1 (A:187-220) Butyrate response factor 2 (T 4e-05
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 4e-08
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 2e-07
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 5e-06
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 1e-05
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 5e-05
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 2e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 3e-04
d2bl5a1134 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {Afric 0.003
d1k1ga_122 d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo s 0.004
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Far upstream binding element, FBP
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 73.7 bits (181), Expect = 1e-17
 Identities = 17/70 (24%), Positives = 35/70 (50%)

Query: 163 ASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIK 222
           +  T +  V   + G IIG+GG    +I +++G K+ I         R+  L G+ E ++
Sbjct: 6   SVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQ 65

Query: 223 QASAMVRELI 232
            A  ++ +++
Sbjct: 66  SAKRLLDQIV 75


>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 34 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 134 Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query290
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.47
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.46
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 99.45
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.43
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.38
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.37
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.37
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.36
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.32
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 99.28
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.25
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.22
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.2
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 99.14
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.08
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.03
d2cpqa178 Fragile X mental retardation syndrome related prot 98.99
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 98.95
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.77
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.7
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.47
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.42
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.16
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.05
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 98.01
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.66
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 97.47
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 96.81
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 96.35
d2cqea156 Zinc finger CCCH domain-containing protein C19orf7 95.28
d2asba367 Transcription factor NusA, C-terminal domains {Myc 94.75
d1hh2p368 Transcription factor NusA, C-terminal domains {The 93.37
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 89.1
d2fc6a137 Target of EGR1 protein 1, TOE1 {Human (Homo sapien 85.8
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: HnRNP K, KH3
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.49  E-value=1.2e-14  Score=103.61  Aligned_cols=73  Identities=30%  Similarity=0.494  Sum_probs=68.2

Q ss_pred             CCceEEEEecccccceeeCCCCCchhhHHHhhCCceeeccCCCCCCcceeEEcCCHHHHHHHHHHHHHHHHhc
Q 022898          163 ASATAKISVDASLAGAIIGKGGVNSKQICRQTGAKLSIRDHEADPNLRNIELEGSFEQIKQASAMVRELIVRI  235 (290)
Q Consensus       163 ~~~t~~i~VP~~~vg~iIGkgG~~Ik~i~~~sga~i~v~~~~~~~~~r~v~i~G~~~~i~~A~~~I~~~i~~~  235 (290)
                      +..|.+|.||.+.+|.|||++|++|+.|++.||+.|+|.+...+..+|.+.|+|++++++.|+.+|.+.+.+.
T Consensus         2 p~~t~~i~VP~~~vg~iIG~~G~~I~~I~~~sga~I~i~~~~~~~~~r~i~I~G~~~~v~~A~~~I~~~i~e~   74 (75)
T d1zzka1           2 PIITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQY   74 (75)
T ss_dssp             CCEEEEEEEETTTGGGGTCGGGHHHHHHHHHHCCEEEECCTTSCSSEEEEEEEECHHHHHHHHHHHHHHHHHH
T ss_pred             CcEEEEEEEChHhcCeeECCCCchHHHHHhhcCCeEEEccCCCCCCceEEEEEeCHHHHHHHHHHHHHHHHhc
Confidence            4568899999999999999999999999999999999988777788999999999999999999999999874



>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fc6a1 g.66.1.1 (A:8-44) Target of EGR1 protein 1, TOE1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure