Citrus Sinensis ID: 022964

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MTSLINSGPRSMVSFEDVHLANGSNNRPFFRPFDRDENGDEDFDEYFHQPEKKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKEKESKNTELPVVNKQEPPQISEPVADSAASEGKVCKASVVACKQEDISSAKSDIFDSDSPNYTDGVHSSLLETCDSSYVFEPEQSDLSQDEDDSLSKNVLLPPYVFPKLEETEYSDPPTNSCNFGFPIEDHAFWSWSF
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccccccccccccccccccccccccccccccccccccHcccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccHHccccccccccccccccccccccccccccccccc
mtslinsgprsmvsfedvhlangsnnrpffrpfdrdengdedfdeyfhqpekkrrltVDQVQFLEKSFEVENKLEPERKIQLAKdlglqprqVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKekeskntelpvvnkqeppqisepvadsaasegkvCKASVVACkqedissaksdifdsdspnytdgvhsslletcdssyvfepeqsdlsqdeddslsknvllppyvfpkleeteysdpptnscnfgfpiedhafwswsf
mtslinsgprsmVSFEDVHlangsnnrpffrpFDRDENGDEDFDEyfhqpekkrrltvDQVQFLEKSfevenklepeRKIQLakdlglqprqvAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKltdklqvkekeskntelpvvnkqeppqiSEPVADSAASEGKVCKASVVACKqedissaksdifdsdspNYTDGVHSSLLETCDSSYVFEPEQSDlsqdeddslskNVLLPPYVFPKLEETEYSDPPTNSCNFGFPIEDHAFWSWSF
MTSLINSGPRSMVSFEDVHLANGSNNRPFFRPFDRDENGDEDFDEYFHQPEKKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKADYDNLFkekeklkaevlklTDKLQVKEKESKNTELPVVNKQEPPQISEPVADSAASEGKVCKASVVACKQEDISSAKSDIFDSDSPNYTDGVHSSLLETCDSSYVFEPeqsdlsqdeddslsKNVLLPPYVFPKLEETEYSDPPTNSCNFGFPIEDHAFWSWSF
*********************************************************VDQVQFLEK*F***********IQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKADYDNLFKE*******VL***********************************************VV**********************************************************VLLPPYVFPKL**********NSCNFGFPIEDHAFWSW**
*********************************************************VDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRA****************************************************************************************************************************************************LLPPYVFPKLEETEYSDPPTNSCNFGFPIEDHAFWSWSF
********PRSMVSFEDVHLANGSNNRPFFRPFDRDENGDEDFDEYFHQPEKKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKLQVKE************************************SVVACKQEDISSAKSDIFDSDSPNYTDGVHSSLLETCDSSYVFE*************LSKNVLLPPYVFPKLEETEYSDPPTNSCNFGFPIEDHAFWSWSF
****************************************************KRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKADYDNLFKEKEKLKAEVLKLTDKL*******************************************************************************S***************DSLSKNVLLPPYVFPKLEETEYSDPPTNSCNFGFPIEDHAFWSWSF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSLINSGPRSMVSFEDVHLANGSNNRPFFRPFDRDENGDEDFDEYFHQPEKKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSKNTELPVVNKQEPPQISEPVADSAASEGKVCKASVVACKQEDISSAKSDIFDSDSPNYTDGVHSSLLETCDSSYVFEPEQSDLSQDEDDSLSKNVLLPPYVFPKLEETEYSDPPTNSCNFGFPIEDHAFWSWSF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
Q02283272 Homeobox-leucine zipper p yes no 0.813 0.863 0.418 7e-42
Q6YWR4343 Homeobox-leucine zipper p yes no 0.397 0.335 0.6 5e-36
A2X980345 Homeobox-leucine zipper p N/A no 0.397 0.333 0.6 5e-36
Q6Z248269 Homeobox-leucine zipper p no no 0.442 0.475 0.556 2e-35
A2YWC0269 Homeobox-leucine zipper p N/A no 0.442 0.475 0.556 2e-35
Q6ZA74349 Homeobox-leucine zipper p no no 0.356 0.295 0.650 5e-35
Q9XH36350 Homeobox-leucine zipper p N/A no 0.356 0.294 0.650 5e-35
Q940J1294 Homeobox-leucine zipper p no no 0.539 0.530 0.477 1e-34
Q6K498277 Homeobox-leucine zipper p no no 0.422 0.440 0.595 1e-34
Q9XH37277 Homeobox-leucine zipper p N/A no 0.422 0.440 0.595 1e-34
>sp|Q02283|HAT5_ARATH Homeobox-leucine zipper protein HAT5 OS=Arabidopsis thaliana GN=HAT5 PE=1 SV=1 Back     alignment and function desciption
 Score =  171 bits (432), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 121/289 (41%), Positives = 158/289 (54%), Gaps = 54/289 (18%)

Query: 6   NSGPRSMVSFEDVHLANGSNNRPFFRPFDRDENGDEDFDEYFHQPEKKRRLTVDQVQFLE 65
             G RSM++ E+      S  RPFF      E+  +D       PEKKRRLT +QV  LE
Sbjct: 30  GGGARSMMNMEET-----SKRRPFF---SSPEDLYDDDFYDDQLPEKKRRLTTEQVHLLE 81

Query: 66  KSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKA 125
           KSFE ENKLEPERK QLAK LGLQPRQVA+WFQNRRARWKTKQLE+DYD+L+++Y+ L +
Sbjct: 82  KSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLS 141

Query: 126 DYDNLFKEKEKLKAEVLKLTDKLQVKEKESKNTELPVVNKQEPPQISEPVADSAASEGKV 185
           +YD++  + +KL++EV  LT+KLQ K++ +     P     EP Q+ +PV  +AA     
Sbjct: 142 NYDSIVMDNDKLRSEVTSLTEKLQGKQETANE---PPGQVPEPNQL-DPVYINAA----- 192

Query: 186 CKASVVACKQED---ISSAKSDIFDSDSPNYTDGVHSSLLETCDS---SYVFEPEQSDLS 239
                 A K ED     S  S + D D+P         LL++CDS   S V   + S+ S
Sbjct: 193 ------AIKTEDRLSSGSVGSAVLDDDAPQ--------LLDSCDSYFPSIVPIQDNSNAS 238

Query: 240 -QDEDDSLSKNVLLPPYVFPKLEETEYSDPPTNSCNFGFPIEDHAFWSW 287
             D D S   +V +                PT S +     E  AFW W
Sbjct: 239 DHDNDRSCFADVFV----------------PTTSPSHDHHGESLAFWGW 271
Probable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'.
Arabidopsis thaliana (taxid: 3702)
>sp|Q6YWR4|HOX16_ORYSJ Homeobox-leucine zipper protein HOX16 OS=Oryza sativa subsp. japonica GN=HOX16 PE=2 SV=1 Back     alignment and function description
>sp|A2X980|HOX16_ORYSI Homeobox-leucine zipper protein HOX16 OS=Oryza sativa subsp. indica GN=HOX16 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z248|HOX20_ORYSJ Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. japonica GN=HOX20 PE=2 SV=1 Back     alignment and function description
>sp|A2YWC0|HOX20_ORYSI Homeobox-leucine zipper protein HOX20 OS=Oryza sativa subsp. indica GN=HOX20 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZA74|HOX5_ORYSJ Homeobox-leucine zipper protein HOX5 OS=Oryza sativa subsp. japonica GN=HOX5 PE=1 SV=1 Back     alignment and function description
>sp|Q9XH36|HOX5_ORYSI Homeobox-leucine zipper protein HOX5 OS=Oryza sativa subsp. indica GN=HOX5 PE=1 SV=1 Back     alignment and function description
>sp|Q940J1|ATB16_ARATH Homeobox-leucine zipper protein ATHB-16 OS=Arabidopsis thaliana GN=ATHB-16 PE=2 SV=2 Back     alignment and function description
>sp|Q6K498|HOX4_ORYSJ Homeobox-leucine zipper protein HOX4 OS=Oryza sativa subsp. japonica GN=HOX4 PE=1 SV=1 Back     alignment and function description
>sp|Q9XH37|HOX4_ORYSI Homeobox-leucine zipper protein HOX4 OS=Oryza sativa subsp. indica GN=HOX4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
118488004314 unknown [Populus trichocarpa] 0.934 0.859 0.774 1e-115
224133286268 predicted protein [Populus trichocarpa] 0.920 0.992 0.775 1e-113
255540907319 homeobox protein, putative [Ricinus comm 0.941 0.852 0.744 1e-110
224119128268 predicted protein [Populus trichocarpa] 0.920 0.992 0.746 1e-110
449469470339 PREDICTED: homeobox-leucine zipper prote 0.972 0.828 0.714 1e-109
302398829324 HD domain class transcription factor [Ma 0.958 0.854 0.700 1e-109
147860587333 hypothetical protein VITISV_039798 [Viti 0.961 0.834 0.707 1e-109
225456662317 PREDICTED: homeobox-leucine zipper prote 0.961 0.876 0.707 1e-109
449469472334 PREDICTED: homeobox-leucine zipper prote 0.951 0.823 0.719 1e-107
449487811334 PREDICTED: LOW QUALITY PROTEIN: homeobox 0.951 0.823 0.715 1e-107
>gi|118488004|gb|ABK95823.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 220/284 (77%), Positives = 241/284 (84%), Gaps = 14/284 (4%)

Query: 8   GPRSMVSFEDVHLANGSNNRPFFRPFDRDENGDEDFDEYFHQPEKKRRLTVDQVQFLEKS 67
           G RSM+SFEDVH ANGS  RPFFR FD ++NGD+D DEYFHQPEKKRRLTVDQVQFLEKS
Sbjct: 43  GSRSMMSFEDVHQANGST-RPFFRSFDHEDNGDDDLDEYFHQPEKKRRLTVDQVQFLEKS 101

Query: 68  FEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKADY 127
           FE+ENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQ+SYNSLKADY
Sbjct: 102 FELENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQSSYNSLKADY 161

Query: 128 DNLFKEKEKLKAEVLKLTDKLQVKEKESKNTELPVVN--KQEPPQISEPVADSAASEGKV 185
           DNL KEKEKLKAEV  LTDKL +KEKE   +EL   +   QEPP+    +ADS ASEG+V
Sbjct: 162 DNLLKEKEKLKAEVNLLTDKLLLKEKEKGISELSDKDALSQEPPK--RAIADS-ASEGEV 218

Query: 186 CKASVVACKQEDISSAKSDIFDSDSPNYTDGVHSSLLETCDSSYVFEPEQSDLSQDEDDS 245
            K S VACKQEDISSAKSDIFDSDSP+Y DGVHSSLLE  DSSYVFEP+QSDLSQDE+D+
Sbjct: 219 SKISTVACKQEDISSAKSDIFDSDSPHYADGVHSSLLEAGDSSYVFEPDQSDLSQDEEDN 278

Query: 246 LSKNVLLPPYVFPKLEETEYSDPPTNSCNFGFPIEDHAFWSWSF 289
            SK+ LLPPYVFPKLE+ +YSDPP +        EDHAFWSWS+
Sbjct: 279 FSKS-LLPPYVFPKLEDDDYSDPPAS-------FEDHAFWSWSY 314

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224133286|ref|XP_002321530.1| predicted protein [Populus trichocarpa] gi|222868526|gb|EEF05657.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255540907|ref|XP_002511518.1| homeobox protein, putative [Ricinus communis] gi|223550633|gb|EEF52120.1| homeobox protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224119128|ref|XP_002317992.1| predicted protein [Populus trichocarpa] gi|222858665|gb|EEE96212.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449469470|ref|XP_004152443.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|302398829|gb|ADL36709.1| HD domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|147860587|emb|CAN83969.1| hypothetical protein VITISV_039798 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225456662|ref|XP_002271692.1| PREDICTED: homeobox-leucine zipper protein HAT5-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|449469472|ref|XP_004152444.1| PREDICTED: homeobox-leucine zipper protein HAT5-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449487811|ref|XP_004157812.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein HAT5-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
TAIR|locus:2084228272 HB-1 "homeobox 1" [Arabidopsis 0.667 0.709 0.466 3.6e-40
TAIR|locus:2140055294 HB16 "homeobox protein 16" [Ar 0.539 0.530 0.459 3.3e-31
TAIR|locus:2041283311 HB6 "homeobox protein 6" [Arab 0.615 0.572 0.397 6.2e-30
TAIR|locus:2205075294 ATHB13 [Arabidopsis thaliana ( 0.321 0.316 0.670 1e-29
TAIR|locus:2150901314 HB-3 "homeobox 3" [Arabidopsis 0.335 0.308 0.643 2.7e-29
TAIR|locus:2168225312 HB5 "homeobox protein 5" [Arab 0.276 0.256 0.712 6.4e-28
TAIR|locus:2102107286 HB20 "homeobox protein 20" [Ar 0.387 0.391 0.552 1.3e-27
TAIR|locus:2202795255 AtHB23 "homeobox protein 23" [ 0.328 0.372 0.593 1.1e-25
TAIR|locus:2079542235 HB-12 "homeobox 12" [Arabidops 0.595 0.731 0.350 1.4e-23
TAIR|locus:2062754258 HB-7 "homeobox 7" [Arabidopsis 0.287 0.321 0.530 2.1e-22
TAIR|locus:2084228 HB-1 "homeobox 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 405 (147.6 bits), Expect = 3.6e-40, Sum P(2) = 3.6e-40
 Identities = 97/208 (46%), Positives = 128/208 (61%)

Query:     8 GPRSMVSFEDVHLANGSNNRPFFRPFDRDENGDEDFDEYFHQPEKKRRLTVDQVQFLEKS 67
             G RSM++ E+      S  RPFF     D   D+ +D+    PEKKRRLT +QV  LEKS
Sbjct:    32 GARSMMNMEET-----SKRRPFFSS-PEDLYDDDFYDDQL--PEKKRRLTTEQVHLLEKS 83

Query:    68 FEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKADY 127
             FE ENKLEPERK QLAK LGLQPRQVA+WFQNRRARWKTKQLE+DYD+L+++Y+ L ++Y
Sbjct:    84 FETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNY 143

Query:   128 DNLFXXXXXXXXXXXXXTDKLQVKEKESKNTELPVVNKQEPPQISEPVADSAAS---EGK 184
             D++              T+KLQ K+ E+ N   P     EP Q+ +PV  +AA+   E +
Sbjct:   144 DSIVMDNDKLRSEVTSLTEKLQGKQ-ETANE--PPGQVPEPNQL-DPVYINAAAIKTEDR 199

Query:   185 VCKASVVACKQEDISSAKSDIFDSDSPN 212
             +   SV +   +D +    D  DS  P+
Sbjct:   200 LSSGSVGSAVLDDDAPQLLDSCDSYFPS 227
GO:0000976 "transcription regulatory region sequence-specific DNA binding" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IEA;ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;ISS
GO:0043565 "sequence-specific DNA binding" evidence=IEA;IDA
GO:0009637 "response to blue light" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0010167 "response to nitrate" evidence=RCA
GO:0015706 "nitrate transport" evidence=RCA
GO:0015996 "chlorophyll catabolic process" evidence=RCA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0009965 "leaf morphogenesis" evidence=IMP
TAIR|locus:2140055 HB16 "homeobox protein 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041283 HB6 "homeobox protein 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2205075 ATHB13 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2150901 HB-3 "homeobox 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2168225 HB5 "homeobox protein 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102107 HB20 "homeobox protein 20" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2202795 AtHB23 "homeobox protein 23" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2079542 HB-12 "homeobox 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062754 HB-7 "homeobox 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q02283HAT5_ARATHNo assigned EC number0.41860.81310.8639yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
pfam0004657 pfam00046, Homeobox, Homeobox domain 6e-18
smart0038957 smart00389, HOX, Homeodomain 1e-17
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 4e-17
pfam0218345 pfam02183, HALZ, Homeobox associated leucine zippe 2e-15
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 9e-09
smart00787312 smart00787, Spc7, Spc7 kinetochore protein 0.003
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 75.6 bits (187), Expect = 6e-18
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 52  KKRR--LTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWK 105
           +++R   T +Q++ LEK FE       E + +LAK LGL  RQV +WFQNRRA+WK
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAKWK 56

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|202143 pfam02183, HALZ, Homeobox associated leucine zipper Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|197874 smart00787, Spc7, Spc7 kinetochore protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
KOG0483198 consensus Transcription factor HEX, contains HOX a 99.89
KOG0842307 consensus Transcription factor tinman/NKX2-3, cont 99.66
KOG0489261 consensus Transcription factor zerknullt and relat 99.64
KOG0843197 consensus Transcription factor EMX1 and related HO 99.62
KOG0488309 consensus Transcription factor BarH and related HO 99.61
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.6
KOG0487308 consensus Transcription factor Abd-B, contains HOX 99.57
KOG0850245 consensus Transcription factor DLX and related pro 99.57
KOG0485268 consensus Transcription factor NKX-5.1/HMX1, conta 99.55
KOG0484125 consensus Transcription factor PHOX2/ARIX, contain 99.55
KOG0492246 consensus Transcription factor MSH, contains HOX d 99.53
KOG4577383 consensus Transcription factor LIM3, contains LIM 99.49
KOG0848317 consensus Transcription factor Caudal, contains HO 99.48
KOG0494332 consensus Transcription factor CHX10 and related H 99.48
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.47
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.46
KOG0493342 consensus Transcription factor Engrailed, contains 99.45
COG5576156 Homeodomain-containing transcription factor [Trans 99.43
KOG2251228 consensus Homeobox transcription factor [Transcrip 99.42
KOG0844408 consensus Transcription factor EVX1, contains HOX 99.32
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.32
KOG3802398 consensus Transcription factor OCT-1, contains POU 99.26
KOG0847288 consensus Transcription factor, contains HOX domai 99.24
KOG0491194 consensus Transcription factor BSH, contains HOX d 99.21
KOG0486351 consensus Transcription factor PTX1, contains HOX 99.14
KOG0490235 consensus Transcription factor, contains HOX domai 99.02
KOG1168385 consensus Transcription factor ACJ6/BRN-3, contain 98.76
KOG0849354 consensus Transcription factor PRD and related pro 98.72
KOG0775304 consensus Transcription factor SIX and related HOX 98.67
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.31
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 98.3
KOG0774334 consensus Transcription factor PBX and related HOX 98.17
KOG2252558 consensus CCAAT displacement protein and related h 97.93
KOG0490235 consensus Transcription factor, contains HOX domai 97.75
KOG1146 1406 consensus Homeobox protein [General function predi 96.86
KOG0773342 consensus Transcription factor MEIS1 and related H 96.25
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.24
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 94.13
PRK09413121 IS2 repressor TnpA; Reviewed 94.07
KOG3623 1007 consensus Homeobox transcription factor SIP1 [Tran 93.3
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 92.39
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 92.2
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 87.18
smart0034044 HALZ homeobox associated leucin zipper. 86.57
KOG4196135 consensus bZIP transcription factor MafK [Transcri 85.83
smart0034044 HALZ homeobox associated leucin zipper. 85.14
PRK00888105 ftsB cell division protein FtsB; Reviewed 84.89
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 84.02
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 81.44
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 81.31
>KOG0483 consensus Transcription factor HEX, contains HOX and HALZ domains [Transcription] Back     alignment and domain information 
Probab=99.89  E-value=4.2e-23  Score=184.25  Aligned_cols=105  Identities=61%  Similarity=0.892  Sum_probs=95.5

Q ss_pred             cCCCCCCCCcCCHHHHHHHHhhhhccCCCCHHHHHHHHHHhCCChhhhhhHhhhhHHHHHHHHHHHHHHHHhhhhhhHHH
Q 022964           46 YFHQPEKKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQLEKDYDVLQNSYNSLKA  125 (289)
Q Consensus        46 ~~~~~rkR~R~T~eQl~~LE~~F~~~~~P~~~~r~~LA~~LgLs~rQVkvWFQNRRak~Krk~~e~e~~~l~~~~~~lk~  125 (289)
                      .....+|++|||.+|+..||..|+.+.++.+.+|..||++|||.+|||+|||||||||||.++++.+++.|+..++.|+.
T Consensus        47 ~~~~~~kk~Rlt~eQ~~~LE~~F~~~~~L~p~~K~~LAk~LgL~pRQVavWFQNRRARwK~kqlE~d~~~Lk~~~~~l~~  126 (198)
T KOG0483|consen   47 GSKGKGKKRRLTSEQVKFLEKSFESEKKLEPERKKKLAKELGLQPRQVAVWFQNRRARWKTKQLEKDYESLKRQLESLRS  126 (198)
T ss_pred             ccccccccccccHHHHHHhHHhhccccccChHHHHHHHHhhCCChhHHHHHHhhccccccchhhhhhHHHHHHHHHHHhh
Confidence            33456788899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhh
Q 022964          126 DYDNLFKEKEKLKAEVLKLTDKLQV  150 (289)
Q Consensus       126 ~~~~l~~ene~L~~e~~~l~~~l~~  150 (289)
                      ++..|+.++..|++++..++..++.
T Consensus       127 ~~~~Lq~e~~eL~~~~~~~~~~~~~  151 (198)
T KOG0483|consen  127 ENDRLQSEVQELVAELSSLKREMQK  151 (198)
T ss_pred             hhhHHHHHHHHHHHHHhhhhhhhcc
Confidence            8888888888888888777766554

>KOG0842 consensus Transcription factor tinman/NKX2-3, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0489 consensus Transcription factor zerknullt and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>KOG0843 consensus Transcription factor EMX1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG0488 consensus Transcription factor BarH and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0487 consensus Transcription factor Abd-B, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0850 consensus Transcription factor DLX and related proteins with LIM Zn-binding and HOX domains [Transcription] Back     alignment and domain information
>KOG0485 consensus Transcription factor NKX-5 Back     alignment and domain information
>KOG0484 consensus Transcription factor PHOX2/ARIX, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0492 consensus Transcription factor MSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG4577 consensus Transcription factor LIM3, contains LIM and HOX domains [Transcription] Back     alignment and domain information
>KOG0848 consensus Transcription factor Caudal, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only] Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0493 consensus Transcription factor Engrailed, contains HOX domain [General function prediction only] Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG2251 consensus Homeobox transcription factor [Transcription] Back     alignment and domain information
>KOG0844 consensus Transcription factor EVX1, contains HOX domain [Transcription] Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG3802 consensus Transcription factor OCT-1, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0847 consensus Transcription factor, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0491 consensus Transcription factor BSH, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG0486 consensus Transcription factor PTX1, contains HOX domain [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1168 consensus Transcription factor ACJ6/BRN-3, contains POU and HOX domains [Transcription] Back     alignment and domain information
>KOG0849 consensus Transcription factor PRD and related proteins, contain PAX and HOX domains [Transcription] Back     alignment and domain information
>KOG0775 consensus Transcription factor SIX and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>KOG0774 consensus Transcription factor PBX and related HOX domain proteins [Transcription] Back     alignment and domain information
>KOG2252 consensus CCAAT displacement protein and related homeoproteins [Transcription] Back     alignment and domain information
>KOG0490 consensus Transcription factor, contains HOX domain [General function prediction only] Back     alignment and domain information
>KOG1146 consensus Homeobox protein [General function prediction only] Back     alignment and domain information
>KOG0773 consensus Transcription factor MEIS1 and related HOX domain proteins [Transcription] Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>PRK09413 IS2 repressor TnpA; Reviewed Back     alignment and domain information
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription] Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>smart00340 HALZ homeobox associated leucin zipper Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
2e1o_A70 Solution Structure Of Rsgi Ruh-028, A Homeobox Doma 6e-07
2r5y_A88 Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HO 6e-06
1hom_A68 Determination Of The Three-Dimensional Structure Of 6e-06
9ant_A62 Antennapedia Homeodomain-Dna Complex Length = 62 7e-06
1ahd_P68 Determination Of The Nmr Solution Structure Of An A 7e-06
1san_A62 The Des(1-6)antennapedia Homeodomain: Comparison Of 7e-06
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 1e-05
1b8i_A81 Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX 3e-05
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 3e-05
2l9r_A69 Solution Nmr Structure Of Homeobox Domain Of Homeob 6e-05
2h1k_A63 Crystal Structure Of The Pdx1 Homeodomain In Comple 1e-04
1nk2_P77 VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES 2e-04
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 3e-04
3a01_A93 Crystal Structure Of Aristaless And Clawless Homeod 4e-04
1qry_A80 Homeobox Protein Vnd (Ventral Nervous System Defect 5e-04
1puf_A77 Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bo 6e-04
1ftz_A70 Nuclear Magnetic Resonance Solution Structure Of Th 7e-04
>pdb|2E1O|A Chain A, Solution Structure Of Rsgi Ruh-028, A Homeobox Domain From Human Cdna Length = 70 Back     alignment and structure 
Iteration: 1

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 32/51 (62%)
Query: 55  RLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWK 105
           R + DQ   LEK FE +  L P  + +LAK L L  RQV  WFQNRRA+W+
Sbjct: 13  RFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWR 63
>pdb|2R5Y|A Chain A, Structure Of ScrEXD COMPLEX BOUND TO A CONSENSUS HOX-Exd Site Length = 88 Back     alignment and structure
>pdb|1HOM|A Chain A, Determination Of The Three-Dimensional Structure Of The Antennapedia Homeodomain From Drosophila In Solution By 1h Nuclear Magnetic Resonance Spectroscopy Length = 68 Back     alignment and structure
>pdb|9ANT|A Chain A, Antennapedia Homeodomain-Dna Complex Length = 62 Back     alignment and structure
>pdb|1AHD|P Chain P, Determination Of The Nmr Solution Structure Of An Antennapedia Homeodomain-Dna Complex Length = 68 Back     alignment and structure
>pdb|1SAN|A Chain A, The Des(1-6)antennapedia Homeodomain: Comparison Of The Nmr Solution Structure And The Dna Binding Affinity With The Intact Antennapedia Homeodomain Length = 62 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1B8I|A Chain A, Structure Of The Homeotic UbxEXDDNA TERNARY COMPLEX Length = 81 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2L9R|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Homeobox Protein Nkx-3.1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr6470a Length = 69 Back     alignment and structure
>pdb|2H1K|A Chain A, Crystal Structure Of The Pdx1 Homeodomain In Complex With Dna Length = 63 Back     alignment and structure
>pdb|1NK2|P Chain P, VndNK-2 HomeodomainDNA COMPLEX, NMR, 20 STRUCTURES Length = 77 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|3A01|A Chain A, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 93 Back     alignment and structure
>pdb|1QRY|A Chain A, Homeobox Protein Vnd (Ventral Nervous System Defective Protein) Length = 80 Back     alignment and structure
>pdb|1PUF|A Chain A, Crystal Structure Of Hoxa9 And Pbx1 Homeodomains Bound To Dna Length = 77 Back     alignment and structure
>pdb|1FTZ|A Chain A, Nuclear Magnetic Resonance Solution Structure Of The Fushi Tarazu Homeodomain From Drosophila And Comparison With The Antennapedia Homeodomain Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 4e-30
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 6e-15
3a01_A93 Homeodomain-containing protein; homeodomain, prote 2e-14
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-14
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-14
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-14
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 5e-14
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 6e-14
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 7e-14
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 1e-13
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 1e-13
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 2e-13
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-13
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-13
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 4e-13
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-13
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 6e-13
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-12
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 1e-12
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-12
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 2e-12
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 2e-12
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-12
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-12
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-12
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 5e-12
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 9e-12
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-11
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-11
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-11
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 6e-11
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 7e-11
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 8e-11
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 1e-10
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 1e-10
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 1e-10
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-10
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 2e-10
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 2e-10
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 2e-10
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 3e-10
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-09
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 2e-08
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 3e-08
1uhs_A72 HOP, homeodomain only protein; structural genomics 9e-08
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 9e-08
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-07
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 9e-07
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-06
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-06
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 3e-06
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 4e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 4e-06
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-05
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 2e-05
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-05
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 1e-04
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 5e-04
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 5e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 9e-04
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
 Score =  106 bits (268), Expect = 4e-30
 Identities = 20/57 (35%), Positives = 31/57 (54%)

Query: 49  QPEKKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWK 105
            P+ K  ++     FLE+ F  +  L  + K ++AK  G+ P QV +WF N+R R K
Sbjct: 5   SPKGKSSISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK 61
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Length = 87 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Length = 83 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.75
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.75
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.74
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.74
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.74
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.74
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.74
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.74
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.74
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.74
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.74
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.73
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.73
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.73
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.73
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.73
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.72
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.72
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.72
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.72
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.72
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.72
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.72
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.71
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.71
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.71
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.71
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.71
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.71
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.71
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.71
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.71
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.71
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.71
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.71
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.7
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.7
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.7
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.7
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.7
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.69
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.69
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.69
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.69
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.69
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.68
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.68
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.68
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.67
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.67
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.67
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.67
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.66
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.66
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.66
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.65
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.65
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.65
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.63
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.62
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.62
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.61
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.61
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.61
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.6
2e19_A64 Transcription factor 8; homeobox domain, structura 99.59
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.59
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.58
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.58
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.57
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.56
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.55
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.35
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.35
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.33
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.23
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.15
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.79
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 93.5
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 90.94
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 89.54
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 88.37
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 88.26
2jn6_A97 Protein CGL2762, transposase; GFT PSI-2, protein s 87.53
2wt7_B90 Transcription factor MAFB; transcription, transcri 87.06
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 86.06
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 86.0
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 83.25
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
Probab=99.75  E-value=1.7e-18  Score=131.41  Aligned_cols=62  Identities=24%  Similarity=0.450  Sum_probs=57.7

Q ss_pred             CCCCCCCCcCCHHHHHHHHhhhhccCCCCHHHHHHHHHHhCCChhhhhhHhhhhHHHHHHHH
Q 022964           47 FHQPEKKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQ  108 (289)
Q Consensus        47 ~~~~rkR~R~T~eQl~~LE~~F~~~~~P~~~~r~~LA~~LgLs~rQVkvWFQNRRak~Krk~  108 (289)
                      ..++++|++||.+|+..||..|..++||+..++..||.+|||+++||++||||||+|+|+++
T Consensus        15 ~~~rr~Rt~ft~~Ql~~Le~~f~~~~yp~~~~r~~La~~l~l~~~qV~~WFqNrR~k~kk~~   76 (80)
T 2da3_A           15 QRDKRLRTTITPEQLEILYQKYLLDSNPTRKMLDHIAHEVGLKKRVVQVWFQNTRARERKSG   76 (80)
T ss_dssp             CCCTTCCSSCCTTTHHHHHHHHHHCSSCCHHHHHHHHHHHTSCHHHHHHHHHHHHHHHHSSC
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHCcCHHHhHHHhHHHHHhHhhhc
Confidence            35566777899999999999999999999999999999999999999999999999999864
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>2jn6_A Protein CGL2762, transposase; GFT PSI-2, protein structure, structural genomics, protein structure initiative; NMR {Corynebacterium glutamicum} SCOP: a.4.1.19 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 5e-17
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-16
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 1e-16
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-16
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-16
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 2e-16
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 3e-15
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 4e-15
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 4e-15
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 6e-15
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 9e-15
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 1e-14
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 1e-14
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-14
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-14
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 3e-14
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 4e-14
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 9e-14
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 1e-13
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-13
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 2e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 3e-13
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 5e-13
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 5e-13
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-12
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 5e-12
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 6e-12
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 7e-12
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-10
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 3e-10
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 8e-09
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Paired box protein pax6
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 71.7 bits (176), Expect = 5e-17
 Identities = 18/63 (28%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 52  KKRR--LTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKTKQL 109
           ++ R   T +Q++ LEK FE  +  +   + +LA  + L   ++ +WF NRRA+W+ ++ 
Sbjct: 2   QRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQVWFSNRRAKWRREEK 61

Query: 110 EKD 112
            ++
Sbjct: 62  LRN 64
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.79
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.79
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.78
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.78
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.77
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.77
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.77
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.76
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.75
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.74
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.74
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.74
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.74
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.73
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.73
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.71
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.71
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.7
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.7
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.7
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.68
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.67
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.66
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.64
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.63
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.61
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.6
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.58
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.56
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.52
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.48
d1hlva166 DNA-binding domain of centromere binding protein B 90.69
d2jn6a189 Uncharacterized protein Cgl2762 {Corynebacterium g 80.64
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein prh
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=7.3e-20  Score=130.51  Aligned_cols=57  Identities=46%  Similarity=0.715  Sum_probs=54.5

Q ss_pred             CCCCCcCCHHHHHHHHhhhhccCCCCHHHHHHHHHHhCCChhhhhhHhhhhHHHHHH
Q 022964           50 PEKKRRLTVDQVQFLEKSFEVENKLEPERKIQLAKDLGLQPRQVAIWFQNRRARWKT  106 (289)
Q Consensus        50 ~rkR~R~T~eQl~~LE~~F~~~~~P~~~~r~~LA~~LgLs~rQVkvWFQNRRak~Kr  106 (289)
                      ++.|++||..|+.+||..|..++||+..++..||..|||+++||++||||||+|+|+
T Consensus         1 k~~R~~ft~~Q~~~Le~~F~~n~yp~~~~r~~LA~~l~L~~~qV~~WFqNrR~k~kk   57 (57)
T d2e1oa1           1 KGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRR   57 (57)
T ss_dssp             CCCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCccCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCHHHhhHhhhhhhhhccC
Confidence            467888999999999999999999999999999999999999999999999999986
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jn6a1 a.4.1.19 (A:1-89) Uncharacterized protein Cgl2762 {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure