Citrus Sinensis ID: 022972

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MGSHYFLCSLFLLSLFVSRENQGKWGERKLRLVVFCFFSMFFFLKNLGGIRMQAGGEEYELKQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFAGIGGLSEFLGYTSQLCYPFLHISYPSTSFSKMTYVIIHAMDSLYVGNLRNWWNILEIIKDIEE
ccccHHHHHHHHHHHHHcccccccccccEEEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEcHHHHHHHHHccccEEEEEccHHHHHHccccccEEEccccccccccccccccHHHHHHccccccccccccccHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHccccccEEccccHHHHHHcccccccccccEEEEcccccEEEccHHHccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
cccHHHHHHHHHHHHHHHHHccccccccHEEEEEEcHHHHHHHHHccccEEEEEccccHHHHHHHHHcHHHHHHHHHHHHccccEccHHHHHHHHHHcccEEEEcccHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHcccccEEEHccHHHHHHHccccccccHHHHHHccccHEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
MGSHYFLCSLFLLSLFVSRenqgkwgerkLRLVVFCFFSMFFFLKNlggirmqaggeeYELKQMRDMAAAKKRWDALIrdgkvkvltpreagyavqlssktlldvrpsterkkawikgsiwipifdiddtfdagslpqkvtnfvmggwwsgvptlsynKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNlfwvqggleaaeeedlvregpqplkfagigglseflgytsqlcypflhisypstsfsKMTYVIIHAMDSLYVGNLRNWWNILEIIKDIEE
MGSHYFLCSLFLLSLFVSRENQGKWGERKLRLVVFCFFSMFFFLKNLGGIRMQAGGEEYELKQMRDMAAAKKRWDALirdgkvkvltpreagyavqlssktlldvrpsterkkawikgsiwiPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFAGIGGLSEFLGYTSQLCYPFLHISYPSTSFSKMTYVIIHAMDSLYVGNLRNWWNILEIIKDIEE
MGSHYflcslfllslfvsRENQGKWGERKLRLVVfcffsmfffLKNLGGIRMQAGGEEYELKQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFAGIGGLSEFLGYTSQLCYPFLHISYPSTSFSKMTYVIIHAMDSLYVGNLRNWWNILEIIKDIEE
***HYFLCSLFLLSLFVSRENQGKWGERKLRLVVFCFFSMFFFLKNLGGIRMQAGGEEYELKQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFAGIGGLSEFLGYTSQLCYPFLHISYPSTSFSKMTYVIIHAMDSLYVGNLRNWWNILEIIKD***
**SHYFLCSLFLLSLFVSRENQ*KWGERKLRLVVFCFFSMFFFLKNL*********************************GKVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFAGIGGLSEFLGYTSQLCYPFLHISYPSTSFSKMTYVIIHAMDSLYVGNLRNWWNILEIIKD***
MGSHYFLCSLFLLSLFVSRENQGKWGERKLRLVVFCFFSMFFFLKNLGGIRMQAGGEEYELKQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFAGIGGLSEFLGYTSQLCYPFLHISYPSTSFSKMTYVIIHAMDSLYVGNLRNWWNILEIIKDIEE
**SHYFLCSLFLLSLFVSRENQGKWGERKLRLVVFCFFSMFFFLKNLGGIRMQAGGEEYELKQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFAGIGGLSEFLGYTSQLCYPFLHISYPSTSFSKMTYVIIHAMDSLYVGNLRNWWNILEIIKDIEE
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSHYFLCSLFLLSLFVSRENQGKWGERKLRLVVFCFFSMFFFLKNLGGIRMQAGGEEYELKQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFAGIGGLSEFLGYTSQLCYPFLHISYPSTSFSKMTYVIIHAMDSLYVGNLRNWWNILEIIKDIEE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query289 2.2.26 [Sep-21-2011]
Q0WWT7292 Rhodanese-like domain-con yes no 0.782 0.773 0.674 3e-86
Q9SR92214 Rhodanese-like domain-con no no 0.539 0.728 0.398 3e-22
O48529234 Rhodanese-like domain-con no no 0.705 0.871 0.274 3e-17
Q94A65224 Rhodanese-like domain-con no no 0.439 0.566 0.282 9e-07
>sp|Q0WWT7|STR11_ARATH Rhodanese-like domain-containing protein 11, chloroplastic OS=Arabidopsis thaliana GN=STR11 PE=2 SV=1 Back     alignment and function desciption
 Score =  318 bits (815), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 153/227 (67%), Positives = 184/227 (81%), Gaps = 1/227 (0%)

Query: 47  LGGIRMQAGGEEYELKQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVR 106
           +G +RMQA  E+ +LKQMRD+AAAKKRWD L+R+GKVK+LTPREAGYA+ LS+K LLDVR
Sbjct: 52  VGVVRMQAVDEDIDLKQMRDIAAAKKRWDGLLREGKVKLLTPREAGYAISLSNKPLLDVR 111

Query: 107 PSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVE 166
           PS+ER KAWIKGS W+PIFD DD  DAG+L +KVT+F MGGWWSG PTLS+N+ FLSKVE
Sbjct: 112 PSSERNKAWIKGSTWVPIFDNDDNLDAGTLSKKVTSFAMGGWWSGAPTLSFNRLFLSKVE 171

Query: 167 EKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFA 226
           EK PKD++LIVACQKGLRSLAACELLYNAGY NLFWVQGGLE+A++EDLV EG QPLK A
Sbjct: 172 EKFPKDSELIVACQKGLRSLAACELLYNAGYENLFWVQGGLESAQDEDLVTEGVQPLKLA 231

Query: 227 GIGGLSEFLGYTSQLCYPFLHISYP-STSFSKMTYVIIHAMDSLYVG 272
           GIGG SEFLG+T Q         +     ++   + ++ A D+L+VG
Sbjct: 232 GIGGFSEFLGWTDQQRAQAAKEGWGYRLVYTARLFGVVLAADALFVG 278

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SR92|STR10_ARATH Rhodanese-like domain-containing protein 10 OS=Arabidopsis thaliana GN=STR10 PE=2 SV=1 Back     alignment and function description
>sp|O48529|STR9_ARATH Rhodanese-like domain-containing protein 9, chloroplastic OS=Arabidopsis thaliana GN=STR9 PE=2 SV=1 Back     alignment and function description
>sp|Q94A65|STR14_ARATH Rhodanese-like domain-containing protein 14, chloroplastic OS=Arabidopsis thaliana GN=At4g27700 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
224135981296 predicted protein [Populus trichocarpa] 0.660 0.645 0.827 5e-91
225456849286 PREDICTED: uncharacterized protein LOC10 0.678 0.685 0.806 1e-90
449440618295 PREDICTED: rhodanese-like domain-contain 0.660 0.647 0.811 5e-90
388506840287 unknown [Lotus japonicus] 0.778 0.783 0.721 7e-90
255540455294 conserved hypothetical protein [Ricinus 0.660 0.649 0.807 8e-88
356516615290 PREDICTED: uncharacterized protein LOC10 0.775 0.772 0.693 4e-87
297799526292 hypothetical protein ARALYDRAFT_492367 [ 0.782 0.773 0.674 4e-85
79485806292 rhodanese homology domain-containing pro 0.782 0.773 0.674 2e-84
63003764266 At4g24750 [Arabidopsis thaliana] 0.782 0.849 0.674 3e-84
242065660289 hypothetical protein SORBIDRAFT_04g02489 0.622 0.622 0.683 6e-70
>gi|224135981|ref|XP_002322209.1| predicted protein [Populus trichocarpa] gi|222869205|gb|EEF06336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  340 bits (872), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 158/191 (82%), Positives = 177/191 (92%)

Query: 50  IRMQAGGEEYELKQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVRPST 109
           I+MQAG E++ELKQMRDMAAAKKRWDALIR+GKVK+LTPREAGYA+QLS+K LLDVRPS 
Sbjct: 59  IQMQAGDEDFELKQMRDMAAAKKRWDALIREGKVKILTPREAGYAIQLSNKPLLDVRPSV 118

Query: 110 ERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKL 169
           ERKKAW+K S WIPIF+ DD FDAG++ +KVTNFVMGGWWSG+PTLSY+KQFLSKVEEK 
Sbjct: 119 ERKKAWVKASTWIPIFEADDNFDAGTVTRKVTNFVMGGWWSGMPTLSYDKQFLSKVEEKF 178

Query: 170 PKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFAGIG 229
           PKD DLIVACQ+GLRSLAAC+LL NAGYRNLFWVQGGLEAAEEED + EGPQPLKFAGIG
Sbjct: 179 PKDADLIVACQRGLRSLAACDLLNNAGYRNLFWVQGGLEAAEEEDFIGEGPQPLKFAGIG 238

Query: 230 GLSEFLGYTSQ 240
           G+SEFLG+T Q
Sbjct: 239 GVSEFLGWTDQ 249

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225456849|ref|XP_002276527.1| PREDICTED: uncharacterized protein LOC100243259 [Vitis vinifera] gi|297733669|emb|CBI14916.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449440618|ref|XP_004138081.1| PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic-like [Cucumis sativus] gi|449526263|ref|XP_004170133.1| PREDICTED: rhodanese-like domain-containing protein 11, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|388506840|gb|AFK41486.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|255540455|ref|XP_002511292.1| conserved hypothetical protein [Ricinus communis] gi|223550407|gb|EEF51894.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|356516615|ref|XP_003526989.1| PREDICTED: uncharacterized protein LOC100791331 [Glycine max] Back     alignment and taxonomy information
>gi|297799526|ref|XP_002867647.1| hypothetical protein ARALYDRAFT_492367 [Arabidopsis lyrata subsp. lyrata] gi|297313483|gb|EFH43906.1| hypothetical protein ARALYDRAFT_492367 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79485806|ref|NP_194206.2| rhodanese homology domain-containing protein [Arabidopsis thaliana] gi|122242714|sp|Q0WWT7.1|STR11_ARATH RecName: Full=Rhodanese-like domain-containing protein 11, chloroplastic; AltName: Full=Sulfurtransferase 11; Short=AtStr11; Flags: Precursor gi|110740615|dbj|BAE98411.1| hypothetical protein [Arabidopsis thaliana] gi|124301082|gb|ABN04793.1| At4g24750 [Arabidopsis thaliana] gi|332659552|gb|AEE84952.1| rhodanese homology domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|63003764|gb|AAY25411.1| At4g24750 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|242065660|ref|XP_002454119.1| hypothetical protein SORBIDRAFT_04g024890 [Sorghum bicolor] gi|241933950|gb|EES07095.1| hypothetical protein SORBIDRAFT_04g024890 [Sorghum bicolor] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query289
TAIR|locus:2121994292 AT4G24750 "AT4G24750" [Arabido 0.782 0.773 0.674 1.8e-80
TAIR|locus:2097628214 AT3G08920 "AT3G08920" [Arabido 0.543 0.733 0.404 2e-24
TAIR|locus:2059999234 AT2G42220 "AT2G42220" [Arabido 0.584 0.722 0.295 1.4e-16
TAIR|locus:2137792224 AT4G27700 "AT4G27700" [Arabido 0.467 0.602 0.281 2.1e-06
UNIPROTKB|Q3AEL0126 CHY_0566 "Rhodanese-like domai 0.159 0.365 0.306 1.2e-05
TIGR_CMR|CHY_0566126 CHY_0566 "rhodanese-like domai 0.159 0.365 0.306 1.2e-05
UNIPROTKB|Q604K3145 MCA2536 "Rhodanese domain prot 0.166 0.331 0.358 4.5e-05
TAIR|locus:505006261169 AT2G21045 [Arabidopsis thalian 0.238 0.408 0.385 0.00077
TAIR|locus:2121994 AT4G24750 "AT4G24750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 808 (289.5 bits), Expect = 1.8e-80, P = 1.8e-80
 Identities = 153/227 (67%), Positives = 184/227 (81%)

Query:    47 LGGIRMQAGGEEYELKQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVR 106
             +G +RMQA  E+ +LKQMRD+AAAKKRWD L+R+GKVK+LTPREAGYA+ LS+K LLDVR
Sbjct:    52 VGVVRMQAVDEDIDLKQMRDIAAAKKRWDGLLREGKVKLLTPREAGYAISLSNKPLLDVR 111

Query:   107 PSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVE 166
             PS+ER KAWIKGS W+PIFD DD  DAG+L +KVT+F MGGWWSG PTLS+N+ FLSKVE
Sbjct:   112 PSSERNKAWIKGSTWVPIFDNDDNLDAGTLSKKVTSFAMGGWWSGAPTLSFNRLFLSKVE 171

Query:   167 EKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREGPQPLKFA 226
             EK PKD++LIVACQKGLRSLAACELLYNAGY NLFWVQGGLE+A++EDLV EG QPLK A
Sbjct:   172 EKFPKDSELIVACQKGLRSLAACELLYNAGYENLFWVQGGLESAQDEDLVTEGVQPLKLA 231

Query:   227 GIGGLSEFLGYTSQLCYPFLHISYP-STSFSKMTYVIIHAMDSLYVG 272
             GIGG SEFLG+T Q         +     ++   + ++ A D+L+VG
Sbjct:   232 GIGGFSEFLGWTDQQRAQAAKEGWGYRLVYTARLFGVVLAADALFVG 278
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
GO:0009507 "chloroplast" evidence=ISM;IDA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006399 "tRNA metabolic process" evidence=RCA
GO:0009658 "chloroplast organization" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0045036 "protein targeting to chloroplast" evidence=RCA
TAIR|locus:2097628 AT3G08920 "AT3G08920" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059999 AT2G42220 "AT2G42220" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137792 AT4G27700 "AT4G27700" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q3AEL0 CHY_0566 "Rhodanese-like domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0566 CHY_0566 "rhodanese-like domain protein" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|Q604K3 MCA2536 "Rhodanese domain protein" [Methylococcus capsulatus str. Bath (taxid:243233)] Back     alignment and assigned GO terms
TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0WWT7STR11_ARATHNo assigned EC number0.67400.78200.7739yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 3e-15
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 7e-12
PRK08762 376 PRK08762, PRK08762, molybdopterin biosynthesis pro 7e-10
cd01522117 cd01522, RHOD_1, Member of the Rhodanese Homology 6e-09
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 1e-07
cd0152490 cd01524, RHOD_Pyr_redox, Member of the Rhodanese H 1e-07
COG0607110 COG0607, PspE, Rhodanese-related sulfurtransferase 6e-07
cd01519106 cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom 1e-05
cd01528101 cd01528, RHOD_2, Member of the Rhodanese Homology 9e-05
PRK05597355 PRK05597, PRK05597, molybdopterin biosynthesis pro 1e-04
PLN02160136 PLN02160, PLN02160, thiosulfate sulfurtransferase 5e-04
cd01523100 cd01523, RHOD_Lact_B, Member of the Rhodanese Homo 6e-04
cd0144496 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and 0.002
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information 
 Score = 69.3 bits (170), Expect = 3e-15
 Identities = 28/109 (25%), Positives = 44/109 (40%), Gaps = 33/109 (30%)

Query: 101 TLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQ 160
            LLDVR   E     I G+I IP+ ++++                               
Sbjct: 12  VLLDVREPEEYAAGHIPGAINIPLSELEE------------------------------- 40

Query: 161 FLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEA 209
                  +L KD  ++V C+ G RS  A +LL  AG  N++ ++GG+ A
Sbjct: 41  --RAALLELDKDKPIVVYCRSGNRSARAAKLLRKAGGTNVYNLEGGMLA 87

The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins. Length = 89
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>gnl|CDD|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase Back     alignment and domain information
>gnl|CDD|238781 cd01523, RHOD_Lact_B, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>gnl|CDD|238721 cd01444, GlpE_ST, GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 289
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.94
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 99.94
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.89
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.88
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.87
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.87
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.87
PLN02160136 thiosulfate sulfurtransferase 99.87
KOG1530136 consensus Rhodanese-related sulfurtransferase [Ino 99.86
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.86
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.85
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.84
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.84
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.83
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.83
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.83
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.83
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.82
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.82
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.82
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.82
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.82
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.82
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.81
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.81
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.8
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.8
PRK01415247 hypothetical protein; Validated 99.78
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.77
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.77
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 99.77
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.77
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.76
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.76
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.76
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.76
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.75
PRK05320257 rhodanese superfamily protein; Provisional 99.74
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.74
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.73
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 99.73
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.71
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.7
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.69
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.69
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.68
PRK07411390 hypothetical protein; Validated 99.67
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.65
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.63
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 99.62
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.62
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.59
PRK05600370 thiamine biosynthesis protein ThiF; Validated 99.58
COG1054308 Predicted sulfurtransferase [General function pred 99.34
COG2603 334 Predicted ATPase [General function prediction only 99.34
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 99.29
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 99.24
KOG2017427 consensus Molybdopterin synthase sulfurylase [Coen 99.11
KOG3772325 consensus M-phase inducer phosphatase [Cell cycle 99.08
KOG1529286 consensus Mercaptopyruvate sulfurtransferase/thios 98.63
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 98.25
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 96.56
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 96.47
KOG1093725 consensus Predicted protein kinase (contains TBC a 94.27
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 93.42
KOG1717 343 consensus Dual specificity phosphatase [Defense me 93.22
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 93.0
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 91.66
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 88.67
COG2603334 Predicted ATPase [General function prediction only 88.59
PLN02727 986 NAD kinase 86.26
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 84.69
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 83.15
COG3453130 Uncharacterized protein conserved in bacteria [Fun 82.73
COG1220 444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase 80.64
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information 
Probab=99.94  E-value=1.4e-27  Score=226.73  Aligned_cols=159  Identities=19%  Similarity=0.260  Sum_probs=126.5

Q ss_pred             CHHHHHHhhcCCCcEEEEeCChhhhhhccCCCcEeeCCCCCcccccCCCCCccccccccCCccCCCCCC-cccHHHHHHH
Q 022972           87 TPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTL-SYNKQFLSKV  165 (289)
Q Consensus        87 s~~el~~~l~~~~~vlIDVRs~~Ey~~ghIPGAinIP~~~~~~~~~vgtlyk~~~~~~~~a~~~g~~~~-~~~~~f~~~~  165 (289)
                      +..++.+.+ .++.+|||||+|.||.+||||||+|+|+.+++++..|||+|||.|++.+.  -.|.... ...++...+.
T Consensus         4 ~~~~~~~~~-~~~~~lIDVRsp~Ef~~ghIpgAiniPl~~~~er~~vgt~Ykq~g~~~a~--~lg~~lv~~~l~~~~~~~   80 (345)
T PRK11784          4 DAQDFRALF-LNDTPLIDVRSPIEFAEGHIPGAINLPLLNDEERAEVGTCYKQQGQFAAI--ALGHALVAGNIAAHREEA   80 (345)
T ss_pred             cHHHHHHHH-hCCCEEEECCCHHHHhcCCCCCeeeCCCCChhHHHhhchhhcccCHHHHH--HhhhhhcchhHHHHHHHH
Confidence            345555544 35789999999999999999999999999999999999999999976543  2333332 2334444444


Q ss_pred             HhcCC-CCCcEEEEc-CCCCchHHHHHHHHHccCCCeeEccccHHHHHhCCCCccC--CCCCccccccccccccchhhhh
Q 022972          166 EEKLP-KDTDLIVAC-QKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREG--PQPLKFAGIGGLSEFLGYTSQL  241 (289)
Q Consensus       166 ~~~l~-k~~~IVvyC-~~G~RS~~aa~~L~~~G~~nV~~L~GG~~aw~~~gl~~~~--~~~~~~~~~~G~t~~~Gkt~~l  241 (289)
                      ....+ ++++||+|| ++|+||..+++.|..+|| +++.|+|||++|++.+++...  +.+..+.+++|.|| +|||+++
T Consensus        81 ~~~~~~~~~~ivvyC~rgG~RS~~aa~~L~~~G~-~v~~L~GG~~awr~~~~~~~~~~~~~~~~ivl~G~TG-sGKT~iL  158 (345)
T PRK11784         81 WADFPRANPRGLLYCWRGGLRSGSVQQWLKEAGI-DVPRLEGGYKAYRRFVIDTLEEAPAQFPLVVLGGNTG-SGKTELL  158 (345)
T ss_pred             HHhcccCCCeEEEEECCCChHHHHHHHHHHHcCC-CcEEEcCCHHHHHHhhHHHHhhhcccCceEecCCCCc-ccHHHHH
Confidence            43444 788999999 589999999999999999 599999999999998776554  35677889999995 9999999


Q ss_pred             cccchhcCCC
Q 022972          242 CYPFLHISYP  251 (289)
Q Consensus       242 ~~l~~~~g~~  251 (289)
                      +.| .+.|++
T Consensus       159 ~~L-~~~~~~  167 (345)
T PRK11784        159 QAL-ANAGAQ  167 (345)
T ss_pred             HHH-HhcCCe
Confidence            999 666654

>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
1tq1_A129 Solution Structure Of At5g66040, A Putative Protein 3e-04
>pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 Back     alignment and structure 
Iteration: 1

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 44/113 (38%), Gaps = 23/113 (20%)
Query: 97  LSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLS 156
           L+    LDVR   E  +    G+I +P  +                        G   +S
Sbjct: 30  LAGHRYLDVRTPEEFSQGHACGAINVPYMN-----------------------RGASGMS 66
Query: 157 YNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEA 209
            N  FL +V     +  ++IV CQ G RS+ A   L +AG+  +  + GG  A
Sbjct: 67  KNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSA 119

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query289
1tq1_A129 AT5G66040, senescence-associated family protein; C 1e-16
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 4e-14
3r2u_A466 Metallo-beta-lactamase family protein; structural 3e-13
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 4e-13
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 1e-12
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 2e-12
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-12
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 5e-08
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 2e-07
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 5e-12
1vee_A134 Proline-rich protein family; hypothetical protein, 9e-12
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 1e-11
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 1e-11
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 3e-11
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 3e-11
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 9e-11
3foj_A100 Uncharacterized protein; protein SSP1007, structur 4e-10
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 5e-10
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 5e-10
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 5e-10
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 7e-10
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 6e-09
2jtq_A85 Phage shock protein E; solution structure rhodanes 7e-09
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 7e-08
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 2e-07
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 4e-07
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 1e-05
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 Back     alignment and structure
 Score = 73.6 bits (181), Expect = 1e-16
 Identities = 31/148 (20%), Positives = 53/148 (35%), Gaps = 32/148 (21%)

Query: 62  KQMRDMAAAKKRWDALIRDGKVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIW 121
                + A + R            ++   A + + L+    LDVR   E  +    G+I 
Sbjct: 4   HHHHHLEAEESR--------VPSSVSVTVA-HDLLLAGHRYLDVRTPEEFSQGHACGAIN 54

Query: 122 IPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQK 181
           +P  +   +                        +S N  FL +V     +  ++IV CQ 
Sbjct: 55  VPYMNRGAS-----------------------GMSKNTDFLEQVSSHFGQSDNIIVGCQS 91

Query: 182 GLRSLAACELLYNAGYRNLFWVQGGLEA 209
           G RS+ A   L +AG+  +  + GG  A
Sbjct: 92  GGRSIKATTDLLHAGFTGVKDIVGGYSA 119
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.93
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.93
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.93
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.92
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.92
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.91
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.91
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.9
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.9
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.9
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.89
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.89
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.89
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.89
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.88
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.88
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.88
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.87
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.86
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.86
1vee_A134 Proline-rich protein family; hypothetical protein, 99.85
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.85
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.83
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.83
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.82
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.82
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.82
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.82
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.82
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.81
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.81
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.8
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.8
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.8
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.8
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.8
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.8
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.8
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.8
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.79
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.79
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.78
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.78
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.78
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.77
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.76
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.76
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.76
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.76
1yt8_A539 Thiosulfate sulfurtransferase; rhodanase domains, 99.75
2wlr_A423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.74
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.74
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.74
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.73
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.72
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.72
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.71
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.68
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.66
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.64
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.63
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.58
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.54
3r2u_A466 Metallo-beta-lactamase family protein; structural 99.21
2f46_A156 Hypothetical protein; structural genomics, joint c 97.93
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 94.28
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 93.27
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 92.94
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 91.53
2hcm_A164 Dual specificity protein phosphatase; structural g 91.37
1v8c_A168 MOAD related protein; riken structural genomics/pr 90.97
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 90.63
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 90.26
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 90.22
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 89.24
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 88.99
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 88.76
1xri_A151 AT1G05000; structural genomics, protein structure 88.74
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 88.47
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 87.6
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 87.51
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 87.08
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 87.03
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 85.75
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 84.53
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 84.02
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 83.62
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 83.26
2q05_A195 Late protein H1, dual specificity protein phosphat 81.25
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 81.03
2oud_A177 Dual specificity protein phosphatase 10; A central 80.96
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
Probab=99.93  E-value=1.7e-26  Score=182.49  Aligned_cols=101  Identities=26%  Similarity=0.376  Sum_probs=90.1

Q ss_pred             cceeCHHHHHHhhcC-CCcEEEEeCChhhhhhccCCCcEeeCCCCCcccccCCCCCccccccccCCccCCCCCCcccHHH
Q 022972           83 VKVLTPREAGYAVQL-SSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQF  161 (289)
Q Consensus        83 ~~~Is~~el~~~l~~-~~~vlIDVRs~~Ey~~ghIPGAinIP~~~~~~~~~vgtlyk~~~~~~~~a~~~g~~~~~~~~~f  161 (289)
                      ++.||++|+.+.+.+ ++.+|||||++.||+.||||||+|||+.++.++.                              
T Consensus         1 ~k~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpgA~~ip~~~l~~~~------------------------------   50 (103)
T 3iwh_A            1 MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNL------------------------------   50 (103)
T ss_dssp             CCEECHHHHHHGGGSSSCCEEEECSCHHHHTTCBCTTCEECCGGGGGGCG------------------------------
T ss_pred             CCCcCHHHHHHHHhCCCCeEEEECCChhHHhcCccCCcccCcccchhhhh------------------------------
Confidence            468999999987754 4789999999999999999999999998876554                              


Q ss_pred             HHHHHhcCCCCCcEEEEcCCCCchHHHHHHHHHccCCCeeEccccHHHHHhCCCCccC
Q 022972          162 LSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVREG  219 (289)
Q Consensus       162 ~~~~~~~l~k~~~IVvyC~~G~RS~~aa~~L~~~G~~nV~~L~GG~~aw~~~gl~~~~  219 (289)
                           ..++++++||+||++|.||..++..|+..||+ ++.|.||+.+|+++|+|+++
T Consensus        51 -----~~l~~~~~ivv~C~~G~rS~~aa~~L~~~G~~-~~~l~GG~~~W~~~g~pves  102 (103)
T 3iwh_A           51 -----NSFNKNEIYYIVCAGGVRSAKVVEYLEANGID-AVNVEGGMHAWGDEGLEIKS  102 (103)
T ss_dssp             -----GGCCTTSEEEEECSSSSHHHHHHHHHHTTTCE-EEEETTHHHHHCSSSCBCCC
T ss_pred             -----hhhcCCCeEEEECCCCHHHHHHHHHHHHcCCC-EEEecChHHHHHHCCCccee
Confidence                 36789999999999999999999999999997 45799999999999999874
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 289
d1tq1a_119 c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc 2e-08
d1gmxa_108 c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia 2e-05
d1yt8a4130 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase 0.001
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 49.9 bits (118), Expect = 2e-08
 Identities = 30/134 (22%), Positives = 49/134 (36%), Gaps = 23/134 (17%)

Query: 82  KVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVT 141
           +V         + + L+    LDVR   E  +    G+I +P  +   +           
Sbjct: 5   RVPSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAINVPYMNRGASGM--------- 55

Query: 142 NFVMGGWWSGVPTLSYNKQFLSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLF 201
                         S N  FL +V     +  ++IV CQ G RS+ A   L +AG+  + 
Sbjct: 56  --------------SKNTDFLEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVK 101

Query: 202 WVQGGLEAAEEEDL 215
            + GG  A  +  L
Sbjct: 102 DIVGGYSAWAKNGL 115
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query289
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.91
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.91
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.89
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.89
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.88
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.88
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.88
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.87
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.87
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.87
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.86
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.86
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.86
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.84
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.82
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.81
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.8
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.76
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.76
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.71
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.63
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 91.7
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 90.33
d1kaga_ 169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 88.67
d1rkba_ 173 Adenylate kinase {Human (Homo sapiens), isoenzyme 87.1
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 86.73
d1lw7a2 192 Transcriptional regulator NadR, ribosylnicotinamid 85.62
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 85.06
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 84.45
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 82.75
d2bdta1 176 Hypothetical protein BH3686 {Bacillus halodurans [ 81.7
d1qhxa_ 178 Chloramphenicol phosphotransferase {Streptomyces v 81.57
d1zp6a1 176 Hypothetical protein Atu3015 {Agrobacterium tumefa 81.15
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 80.98
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Single-domain sulfurtransferase
domain: Thiosulfate sulfurtransferase/Senescence-associated protein
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

Probab=99.91  E-value=3.3e-25  Score=176.80  Aligned_cols=113  Identities=26%  Similarity=0.363  Sum_probs=97.6

Q ss_pred             CcceeCHHHHHHhhcCCCcEEEEeCChhhhhhccCCCcEeeCCCCCcccccCCCCCccccccccCCccCCCCCCcccHHH
Q 022972           82 KVKVLTPREAGYAVQLSSKTLLDVRPSTERKKAWIKGSIWIPIFDIDDTFDAGSLPQKVTNFVMGGWWSGVPTLSYNKQF  161 (289)
Q Consensus        82 ~~~~Is~~el~~~l~~~~~vlIDVRs~~Ey~~ghIPGAinIP~~~~~~~~~vgtlyk~~~~~~~~a~~~g~~~~~~~~~f  161 (289)
                      ....++++++.++++. +.+|||||++.||+.||||||+|+|+.+....                       .....+++
T Consensus         6 ~p~~i~~~~a~~l~~~-g~~liDvR~~~e~~~ghi~ga~~ip~~~~~~~-----------------------~~~~~~~~   61 (119)
T d1tq1a_           6 VPSSVSVTVAHDLLLA-GHRYLDVRTPEEFSQGHACGAINVPYMNRGAS-----------------------GMSKNTDF   61 (119)
T ss_dssp             CCEEEEHHHHHHHHHH-TCCEEEESCHHHHHHCCBTTBEECCSCCCSTT-----------------------TCCCTTTH
T ss_pred             CCCccCHHHHHHHHHC-cCEEEECCCHHHHHcCCCCCccchhhcccccc-----------------------cccccHHH
Confidence            3557888988888754 57899999999999999999999998764322                       23345677


Q ss_pred             HHHHHhcCCCCCcEEEEcCCCCchHHHHHHHHHccCCCeeEccccHHHHHhCCCCcc
Q 022972          162 LSKVEEKLPKDTDLIVACQKGLRSLAACELLYNAGYRNLFWVQGGLEAAEEEDLVRE  218 (289)
Q Consensus       162 ~~~~~~~l~k~~~IVvyC~~G~RS~~aa~~L~~~G~~nV~~L~GG~~aw~~~gl~~~  218 (289)
                      +.++...++++++||+||++|.||..++..|.++||+||+.|+|||.+|+++|+|++
T Consensus        62 ~~~~~~~~~~~~~iv~~C~~G~rs~~a~~~L~~~G~~nv~~l~GG~~~W~~~g~P~e  118 (119)
T d1tq1a_          62 LEQVSSHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK  118 (119)
T ss_dssp             HHHHTTTCCTTSSEEEEESSCSHHHHHHHHHHHHHCCSEEEEECCHHHHHHHTCCCC
T ss_pred             HHHHHHhcCCCcEEEEEcCCcCcHHHHHHHHHhcccCCeEEecChHHHHHHCCCCcc
Confidence            888877789999999999999999999999999999999999999999999999986
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure