Citrus Sinensis ID: 023030

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------29
MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL
ccHHHHHHHHHccccccccEEEEEEEccccccccccccHHHHHHHcccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHHcccHHHHHHccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHccccccccccccccccEEEEEEEEEEccccccEEEEEEccccccccccccHHHHHHHHHHHccccc
ccHHHHHHHHccccccEEEEEEEEEEcccccccccccccEEEEccccEEcHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccEcccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHHHHccHHHHHHHcccccccccEEEcccccccccccEcHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHccccEEEEEEEEEEEcccccEEEEEEEEEEccEEEEEEccccccHHHHcHHHHHHHHHHHHccccc
MIVQHIsdgidvghrprmnlkgyllgnpltdstenqnsvphfAYLNALISHEIYESAKrncqgeyvnvdpsnglciadLENITECISRVnhaqiyepscrgpfisprrklfnwnssvleedsldflssptqpaasgtwcrfhNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNqslsytkdvSSSLAYHRNLIKKGYQVLIYsgdvdmkvpYVATEAWIKSLNLTIetgwqpwfveGQVAGYWyrykeknnyhLTFAtvkgaghtapeykpkeclGMIDRWFACHPL
mivqhisdgidvghrprMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLtietgwqpwFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL
MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL
*****************MNLKGYLLGNPL********SVPHFAYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEEDSLDFL******AASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFAC***
MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGPFIS********************LSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL
MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL
MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGP****************E*DSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFAC***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query288 2.2.26 [Sep-21-2011]
Q9C7Z9464 Serine carboxypeptidase-l yes no 0.954 0.592 0.458 8e-61
Q9C7D6437 Serine carboxypeptidase-l yes no 0.861 0.567 0.421 1e-58
Q8RWJ6441 Serine carboxypeptidase-l no no 0.861 0.562 0.412 8e-54
Q9SQX6437 Serine carboxypeptidase-l no no 0.864 0.569 0.404 2e-53
Q9CAU3441 Serine carboxypeptidase-l no no 0.861 0.562 0.398 2e-53
Q9CAU0452 Serine carboxypeptidase-l no no 0.861 0.548 0.412 3e-53
Q8RUW5433 Serine carboxypeptidase-l no no 0.875 0.581 0.393 5e-52
Q8H780430 Serine carboxypeptidase-l no no 0.864 0.579 0.394 2e-51
Q9CAU1441 Serine carboxypeptidase-l no no 0.861 0.562 0.374 1e-50
Q8VZU3465 Serine carboxypeptidase-l no no 0.930 0.576 0.398 2e-50
>sp|Q9C7Z9|SCP18_ARATH Serine carboxypeptidase-like 18 OS=Arabidopsis thaliana GN=SCPL18 PE=2 SV=2 Back     alignment and function desciption
 Score =  233 bits (595), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 132/288 (45%), Positives = 172/288 (59%), Gaps = 13/288 (4%)

Query: 2   IVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNC 61
           IVQ IS G + G++P++NLKGY+LGNP TD   + NS   +A+   LIS E+YES KR C
Sbjct: 189 IVQQISIGNEHGYKPQINLKGYILGNPSTDLDSDHNSKIPYAHRMGLISDELYESLKRTC 248

Query: 62  QGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEED 121
           QG YV VDP+N  C+  +E+  +C+SR+N   I    C     +P         S L+  
Sbjct: 249 QGNYVKVDPTNTKCLKLMEDYGKCVSRINEGLILIALCDLASPNPYSGEHG-GRSYLQTL 307

Query: 122 SLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTK 181
               LS PT        C  + Y+ +  WAND+ V+R + V +G++  W+RCN  L Y K
Sbjct: 308 VQSDLSLPTPD------CYMYRYLLASHWANDEDVRRELHVVKGSIGKWMRCNWDLPYEK 361

Query: 182 DVSSSLAYHR-NLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQV 240
           D+ SS+ YHR N I   Y+ L+YS D DM VPY+ TEAWIKSLN +I   W+PWFV  QV
Sbjct: 362 DIKSSVPYHRNNSIIGDYRSLVYSSDHDMMVPYIGTEAWIKSLNYSITDDWRPWFVNNQV 421

Query: 241 AGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL 288
            GY   Y   NN  +TFAT+KG GHTA EYKP+E   M  RW +  PL
Sbjct: 422 IGYTRTY--ANN--MTFATIKGGGHTA-EYKPEESFMMFQRWISGRPL 464
Probable carboxypeptidase.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 1EC: 6EC: .EC: -
>sp|Q9C7D6|SCP17_ARATH Serine carboxypeptidase-like 17 OS=Arabidopsis thaliana GN=SCPL17 PE=2 SV=1 Back     alignment and function description
>sp|Q8RWJ6|SCP1_ARATH Serine carboxypeptidase-like 1 OS=Arabidopsis thaliana GN=SCPL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9SQX6|SCP7_ARATH Serine carboxypeptidase-like 7 OS=Arabidopsis thaliana GN=SCPL7 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAU3|SCP2_ARATH Serine carboxypeptidase-like 2 OS=Arabidopsis thaliana GN=SCPL2 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAU0|SCP6_ARATH Serine carboxypeptidase-like 6 OS=Arabidopsis thaliana GN=SCPL6 PE=2 SV=2 Back     alignment and function description
>sp|Q8RUW5|SCP8_ARATH Serine carboxypeptidase-like 8 OS=Arabidopsis thaliana GN=SCPL8 PE=1 SV=2 Back     alignment and function description
>sp|Q8H780|SCP13_ARATH Serine carboxypeptidase-like 13 OS=Arabidopsis thaliana GN=SCPL13 PE=2 SV=2 Back     alignment and function description
>sp|Q9CAU1|SCP3_ARATH Serine carboxypeptidase-like 3 OS=Arabidopsis thaliana GN=SCPL3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VZU3|SCP19_ARATH Serine carboxypeptidase-like 19 OS=Arabidopsis thaliana GN=SCPL19 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
255562254 478 serine carboxypeptidase, putative [Ricin 0.989 0.596 0.539 6e-85
224056272 469 predicted protein [Populus trichocarpa] 0.986 0.605 0.527 3e-84
359475474 468 PREDICTED: serine carboxypeptidase-like 0.958 0.589 0.541 3e-81
296083020 507 unnamed protein product [Vitis vinifera] 0.996 0.566 0.494 4e-79
225429045 491 PREDICTED: serine carboxypeptidase-like 0.996 0.584 0.494 5e-79
296083016 503 unnamed protein product [Vitis vinifera] 0.954 0.546 0.531 8e-79
359475476 511 PREDICTED: serine carboxypeptidase-like 0.989 0.557 0.496 4e-77
296083017 589 unnamed protein product [Vitis vinifera] 0.989 0.483 0.496 5e-77
147780799 499 hypothetical protein VITISV_038590 [Viti 0.996 0.575 0.481 7e-77
4101703 464 glucose acyltransferase [Solanum berthau 0.937 0.581 0.478 5e-75
>gi|255562254|ref|XP_002522135.1| serine carboxypeptidase, putative [Ricinus communis] gi|223538734|gb|EEF40335.1| serine carboxypeptidase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  320 bits (819), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 157/291 (53%), Positives = 204/291 (70%), Gaps = 6/291 (2%)

Query: 1   MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRN 60
           ++VQ I +G ++G +P M+L+GYLLGNPLT+   + NS   FAY  +L+S +IYES K N
Sbjct: 191 IVVQEILNGNEMGLQPPMDLRGYLLGNPLTNYRIDLNSKISFAYRLSLLSKKIYESFKIN 250

Query: 61  CQGEYVNVDPSNGLCIADLENITECISRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEE 120
           C+GEY   DP+N LC+ D++ I ECI +++ AQI EP C   F SP      W+ + + +
Sbjct: 251 CKGEYAYPDPNNALCMQDIQTINECIKKLDPAQILEPECSRTF-SPNPMASRWDPTAISD 309

Query: 121 DSLD--FLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLS 178
            S+D   L SP+Q      WCR +NY+YSY WANDK VQ A+ ++EGT+K W RCN SLS
Sbjct: 310 YSIDDDILLSPSQ--IPERWCREYNYLYSYTWANDKNVQEALRIREGTIKEWARCNYSLS 367

Query: 179 YTKDVSSSLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEG 238
           Y+  V S++ YH+N  K G Q LIYSGD DM +P+V TE WI+SLNLTI + WQPW V+G
Sbjct: 368 YSYGVISTIDYHKNFTKTGLQALIYSGDHDMAIPHVGTEEWIESLNLTIASDWQPWLVDG 427

Query: 239 QVAGYWYRYK-EKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL 288
           QVAGY   Y  ++  Y LTFATVKG GHTAPEYKPK+CL M+DRWFA +PL
Sbjct: 428 QVAGYTVEYSYDEYAYRLTFATVKGGGHTAPEYKPKQCLAMVDRWFAIYPL 478

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224056272|ref|XP_002298786.1| predicted protein [Populus trichocarpa] gi|222846044|gb|EEE83591.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359475474|ref|XP_002266354.2| PREDICTED: serine carboxypeptidase-like 18-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083020|emb|CBI22424.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225429045|ref|XP_002265842.1| PREDICTED: serine carboxypeptidase-like 18 [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083016|emb|CBI22420.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359475476|ref|XP_002266151.2| PREDICTED: serine carboxypeptidase-like 18-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|296083017|emb|CBI22421.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147780799|emb|CAN74923.1| hypothetical protein VITISV_038590 [Vitis vinifera] Back     alignment and taxonomy information
>gi|4101703|gb|AAD01263.1| glucose acyltransferase [Solanum berthaultii] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query288
TAIR|locus:2158946441 scpl1 "serine carboxypeptidase 0.503 0.328 0.466 9.9e-56
TAIR|locus:2075755437 SCPL7 "serine carboxypeptidase 0.503 0.331 0.466 1.3e-55
TAIR|locus:2197309452 scpl6 "serine carboxypeptidase 0.482 0.307 0.479 1.6e-55
TAIR|locus:2045384437 scpl10 "serine carboxypeptidas 0.503 0.331 0.453 6.1e-52
TAIR|locus:2197259441 scpl4 "serine carboxypeptidase 0.503 0.328 0.433 1.6e-51
TAIR|locus:2082239435 scpl16 "serine carboxypeptidas 0.489 0.324 0.458 5.4e-51
TAIR|locus:2144751465 SCPL19 "serine carboxypeptidas 0.951 0.589 0.406 8.3e-51
TAIR|locus:2082229435 scpl14 "serine carboxypeptidas 0.503 0.333 0.453 2.9e-50
TAIR|locus:2045389437 SCPL9 "serine carboxypeptidase 0.503 0.331 0.44 4.7e-50
TAIR|locus:2082219436 SCPL15 "serine carboxypeptidas 0.503 0.332 0.426 5.3e-47
TAIR|locus:2158946 scpl1 "serine carboxypeptidase-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 372 (136.0 bits), Expect = 9.9e-56, Sum P(2) = 9.9e-56
 Identities = 70/150 (46%), Positives = 94/150 (62%)

Query:   139 CRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSLSYTKDVSSSLAYHRNLIKKGY 198
             C  + Y+ +  WAND TV+ A+ + + ++  WVRC  S+ Y  D+ SS+ YH N    GY
Sbjct:   297 CYIYRYLLTTYWANDATVREALQINKESIGEWVRCYYSIPYNNDIKSSMPYHVNNSISGY 356

Query:   199 QVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPWFVEGQVAGYWYRYKEKNNYHLTFA 258
             + LIYSGD D +VPY+ T+AWI+SLN +I   W+PW V+ Q+AGY   Y  K    +TFA
Sbjct:   357 RSLIYSGDHDFEVPYLGTQAWIRSLNYSIIDDWRPWMVKNQIAGYTRTYANK----MTFA 412

Query:   259 TVKGAGHTAPEYKPKECLGMIDRWFACHPL 288
             T+KG GHTA E KP+E   M  RW    PL
Sbjct:   413 TIKGGGHTA-ESKPEEASIMFQRWINGQPL 441
GO:0004185 "serine-type carboxypeptidase activity" evidence=IEA;ISS
GO:0005576 "extracellular region" evidence=ISM
GO:0006508 "proteolysis" evidence=IEA;ISS
TAIR|locus:2075755 SCPL7 "serine carboxypeptidase-like 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197309 scpl6 "serine carboxypeptidase-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045384 scpl10 "serine carboxypeptidase-like 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2197259 scpl4 "serine carboxypeptidase-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082239 scpl16 "serine carboxypeptidase-like 16" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144751 SCPL19 "serine carboxypeptidase-like 19" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082229 scpl14 "serine carboxypeptidase-like 14" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2045389 SCPL9 "serine carboxypeptidase-like 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082219 SCPL15 "serine carboxypeptidase-like 15" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.16LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
fgenesh4_pg.C_LG_I002690
hypothetical protein (469 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
pfam00450415 pfam00450, Peptidase_S10, Serine carboxypeptidase 2e-79
PLN02213319 PLN02213, PLN02213, sinapoylglucose-malate O-sinap 2e-62
PLN03016433 PLN03016, PLN03016, sinapoylglucose-malate O-sinap 3e-62
PLN02209437 PLN02209, PLN02209, serine carboxypeptidase 3e-59
PTZ00472462 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1) 7e-13
>gnl|CDD|215926 pfam00450, Peptidase_S10, Serine carboxypeptidase Back     alignment and domain information 
 Score =  246 bits (630), Expect = 2e-79
 Identities = 103/293 (35%), Positives = 148/293 (50%), Gaps = 35/293 (11%)

Query: 1   MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRN 60
            + Q I DG   G  P +NLKG L+GN LTD     NS   FAY + LIS E+YES K+ 
Sbjct: 150 ALAQEILDGNKKGTGPNINLKGVLIGNGLTDPAIQYNSYIPFAYYHGLISDELYESLKKA 209

Query: 61  CQGEYVNVDPSNGLCIADLENITECI---SRVNHAQIYEPSCRGPFISPRRKLFNWNSSV 117
           C G+Y + DP+N  C+  +E  + C      +N   IY P C    +S            
Sbjct: 210 CCGKYPDCDPANTKCLNLVEEASGCNAYNGGINPYNIYTPCCYNSSLSLNPS-------- 261

Query: 118 LEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKYWVRCNQSL 177
                    S+ +           ++  Y   + N   V++A+   +G+V  W RCN  +
Sbjct: 262 ---------STDSCG-----GYDCYDESYVEKYLNRPDVRKALHANKGSVGEWSRCNDEV 307

Query: 178 S--YTKDVSSSLAYH-RNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQPW 234
              Y  D+S S+      L++ G +VLIYSGD D+   ++ T+AWI +LN + + G++PW
Sbjct: 308 FNWYGDDISKSMLPILPKLLEGGLRVLIYSGDHDLICNFLGTQAWIDALNWSGKDGFRPW 367

Query: 235 FVE--GQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFAC 285
           +V   GQVAGY   Y      +LTFATVKGAGH  PE +P+  L M  R+ + 
Sbjct: 368 YVSVDGQVAGYVKSYG-----NLTFATVKGAGHMVPEDQPEAALQMFKRFLSG 415

Length = 415
>gnl|CDD|165857 PLN02213, PLN02213, sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>gnl|CDD|178590 PLN03016, PLN03016, sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>gnl|CDD|177859 PLN02209, PLN02209, serine carboxypeptidase Back     alignment and domain information
>gnl|CDD|240429 PTZ00472, PTZ00472, serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 288
KOG1282454 consensus Serine carboxypeptidases (lysosomal cath 100.0
PLN02213319 sinapoylglucose-malate O-sinapoyltransferase/ carb 100.0
PLN03016433 sinapoylglucose-malate O-sinapoyltransferase 100.0
PLN02209437 serine carboxypeptidase 100.0
PF00450415 Peptidase_S10: Serine carboxypeptidase; InterPro: 100.0
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 100.0
KOG1283414 consensus Serine carboxypeptidases [Posttranslatio 99.96
COG2939498 Carboxypeptidase C (cathepsin A) [Amino acid trans 99.93
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 97.53
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 97.26
PRK03204286 haloalkane dehalogenase; Provisional 97.26
PRK10349256 carboxylesterase BioH; Provisional 97.18
PRK10673255 acyl-CoA esterase; Provisional 97.18
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 97.18
TIGR03611257 RutD pyrimidine utilization protein D. This protei 97.13
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 97.11
PRK00870302 haloalkane dehalogenase; Provisional 97.09
PLN02679360 hydrolase, alpha/beta fold family protein 97.02
PRK07581339 hypothetical protein; Validated 96.99
PLN03084383 alpha/beta hydrolase fold protein; Provisional 96.95
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 96.87
PLN02824294 hydrolase, alpha/beta fold family protein 96.85
PRK03592295 haloalkane dehalogenase; Provisional 96.83
PRK08775343 homoserine O-acetyltransferase; Provisional 96.75
PHA02857276 monoglyceride lipase; Provisional 96.72
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 96.69
PLN02965255 Probable pheophorbidase 96.66
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 96.62
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 96.57
PLN02578354 hydrolase 96.38
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 96.31
PRK00175379 metX homoserine O-acetyltransferase; Provisional 96.14
PLN02385349 hydrolase; alpha/beta fold family protein 96.12
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 95.99
PLN02894402 hydrolase, alpha/beta fold family protein 95.95
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 95.94
PRK06765389 homoserine O-acetyltransferase; Provisional 95.91
PLN02298330 hydrolase, alpha/beta fold family protein 95.9
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 95.74
PF08386103 Abhydrolase_4: TAP-like protein; InterPro: IPR0135 95.72
PRK06489360 hypothetical protein; Provisional 95.65
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 95.61
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 95.37
PRK10749330 lysophospholipase L2; Provisional 95.01
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 94.97
PLN02652395 hydrolase; alpha/beta fold family protein 94.76
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 94.09
PRK05855 582 short chain dehydrogenase; Validated 93.19
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 93.18
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 93.1
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 92.97
PRK11460232 putative hydrolase; Provisional 92.47
PLN02511388 hydrolase 91.81
PRK10566249 esterase; Provisional 91.39
PLN02211273 methyl indole-3-acetate methyltransferase 91.02
PLN02872395 triacylglycerol lipase 90.59
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 90.53
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 89.98
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 89.46
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 89.21
KOG2382315 consensus Predicted alpha/beta hydrolase [General 88.74
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 88.74
PRK13604307 luxD acyl transferase; Provisional 88.2
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 87.93
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 86.73
PRK10985324 putative hydrolase; Provisional 86.53
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 85.7
COG0400207 Predicted esterase [General function prediction on 84.61
COG2267298 PldB Lysophospholipase [Lipid metabolism] 84.37
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 83.35
PF07519474 Tannase: Tannase and feruloyl esterase; InterPro: 82.83
>KOG1282 consensus Serine carboxypeptidases (lysosomal cathepsin A) [Posttranslational modification, protein turnover, chaperones; Amino acid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.5e-60  Score=438.09  Aligned_cols=259  Identities=41%  Similarity=0.704  Sum_probs=222.2

Q ss_pred             ChHHHHHhcccCCCCCCccceEEEEeCCCCCcccccCcccchhhcccccCHHHHHHHhccCCC---CccccCCCCcchHH
Q 023030            1 MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQG---EYVNVDPSNGLCIA   77 (288)
Q Consensus         1 ~lA~~I~~~n~~~~~~~inLkGi~IGNg~~dp~~q~~s~~~~~~~~gli~~~~~~~~~~~c~~---~~~~~~~~~~~C~~   77 (288)
                      +||++|+++|+....+.|||||++||||++|+..|.+++.+|+|+||||++++++.+++.|..   ++......+..|..
T Consensus       184 ~La~~I~~~N~~~~~~~iNLkG~~IGNg~td~~~~~~~~~~~a~~h~liSde~~~~l~~~C~~~~~~~~~~~~~~~~C~~  263 (454)
T KOG1282|consen  184 ALAQEILKGNKKCCKPNINLKGYAIGNGLTDPEIDYNGRIPFAWGHGLISDELYESLKRACDFSSDNYANVDPSNTKCNK  263 (454)
T ss_pred             HHHHHHHhccccccCCcccceEEEecCcccCccccccchhhhhhhcccCCHHHHHHHHHHhccCcccccccCCchhHHHH
Confidence            589999999986556789999999999999999999999999999999999999999999976   23333344678999


Q ss_pred             HHHHHH-HHhhcCCCCCCCCCCCCCCCCCCcccccccCccccccccccccCCCCCCCccccccccccchhhhhccCchhH
Q 023030           78 DLENIT-ECISRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTV  156 (288)
Q Consensus        78 ~~~~~~-~~~~~in~y~i~~~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~~~~~~~ylN~~~V  156 (288)
                      +++.+. .+.+.++.|+++.+.|..  .++.       +       .  .  + ..+...++|..  .. .++|||+++|
T Consensus       264 ~~~~~~~~~~~~i~~y~i~~~~C~~--~~~~-------~-------~--~--~-~~~~~~~~c~~--~~-~~~ylN~~~V  319 (454)
T KOG1282|consen  264 AVEEFDSKTTGDIDNYYILTPDCYP--TSYE-------L-------K--K--P-TDCYGYDPCLS--DY-AEKYLNRPEV  319 (454)
T ss_pred             HHHHHHHHHhccCchhhhcchhhcc--cccc-------c-------c--c--c-ccccccCCchh--hh-HHHhcCCHHH
Confidence            999887 677889999999999963  0000       0       0  0  0 12344578854  22 3899999999


Q ss_pred             HHHhCCCCCCcccceeecccc--ccCCCccchHHHHHHHHhcC-ceEEEEccCCccccccHHHHHHHHHcCCCCcccccc
Q 023030          157 QRAIGVQEGTVKYWVRCNQSL--SYTKDVSSSLAYHRNLIKKG-YQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGWQP  233 (288)
Q Consensus       157 ~~aL~v~~~~~~~w~~cs~~v--~~~~d~~~~~~~~~~Ll~~~-~rvliy~Gd~D~~~~~~g~~~~i~~l~w~~~~~~~~  233 (288)
                      |+||||+......|+.||+.|  .|.++..+++|++..++.++ +|||||+||.|++||++||++||++|+++...+|+|
T Consensus       320 rkALh~~~~~~~~W~~Cn~~v~~~~~~~~~sm~p~~~~~~~~~~~rvliysGD~D~~~p~~gt~~~i~~L~~~~~~~~~p  399 (454)
T KOG1282|consen  320 RKALHANKTSIGKWERCNDEVNYNYNDDIKSMLPIHKKLIASGGYRVLIYSGDHDLVVPFLGTQAWIKSLNLSITDEWRP  399 (454)
T ss_pred             HHHhCCCCCCCCcccccChhhhcccccCccchHHHHHHHhhcCceEEEEEeCCcceeCcchhhHHHHHhccCccccCccC
Confidence            999999886322799999998  47788899999999999865 999999999999999999999999999999999999


Q ss_pred             cccC-CEeeeEEEEEeecCCceeEEEEEcCCCccCCCCCcHHHHHHHHHHhcCCCC
Q 023030          234 WFVE-GQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL  288 (288)
Q Consensus       234 w~~~-~~~~G~~~~~~~~~~~~ltf~~V~~AGH~vP~dqP~~~~~m~~~fi~~~~~  288 (288)
                      |+++ +|||||+++|+   +  |+|+||+|||||||.|||++|++||++||.|++|
T Consensus       400 W~~~~~qvaG~~~~Y~---~--ltf~tVrGaGH~VP~~~p~~al~m~~~fl~g~~l  450 (454)
T KOG1282|consen  400 WYHKGGQVAGYTKTYG---G--LTFATVRGAGHMVPYDKPESALIMFQRFLNGQPL  450 (454)
T ss_pred             CccCCCceeeeEEEec---C--EEEEEEeCCcccCCCCCcHHHHHHHHHHHcCCCC
Confidence            9996 89999999998   7  9999999999999999999999999999999986

>PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase Back     alignment and domain information
>PLN03016 sinapoylglucose-malate O-sinapoyltransferase Back     alignment and domain information
>PLN02209 serine carboxypeptidase Back     alignment and domain information
>PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>KOG1283 consensus Serine carboxypeptidases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PF08386 Abhydrolase_4: TAP-like protein; InterPro: IPR013595 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>KOG2382 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
1ivy_A452 Physiological Dimer Hpp Precursor Length = 452 8e-23
1bcr_B160 Complex Of The Wheat Serine Carboxypeptidase, Cpdw- 2e-14
3sc2_B152 Refined Atomic Model Of Wheat Serine Carboxypeptida 3e-14
1whs_B153 Structure Of The Complex Of L-Benzylsuccinate With 3e-14
1wht_B153 Structure Of The Complex Of L-Benzylsuccinate With 3e-14
4az0_B155 Crystal Structure Of Cathepsin A, Complexed With 8a 5e-14
1gxs_B158 Crystal Structure Of Hydroxynitrile Lyase From Sorg 1e-13
4az0_A300 Crystal Structure Of Cathepsin A, Complexed With 8a 3e-05
>pdb|1IVY|A Chain A, Physiological Dimer Hpp Precursor Length = 452 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (258), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 140/301 (46%), Gaps = 31/301 (10%)
Query: 9   GIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNC--QGEYV 66
            + V   P MNL+G  +GN L+   +N NS+ +FAY + L+ + ++ S + +C  Q +  
Sbjct: 160 AVLVMQDPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCN 219
Query: 67  NVDPSNGLCIADLENITECI--SRVNHAQIYEPSCRGPFISPRRKLFNWNSSVLEEDSLD 124
             D  +  C+ +L+ +   +  S +N   +Y P   G    P    +  ++ V+++    
Sbjct: 220 FYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGG---VPSHFRYEKDTVVVQDLGNI 276
Query: 125 FLSSPTQPA------ASGTWCRFH----NYVYSYIWANDKTVQRAIGVQEGTVKYWVRCN 174
           F   P +         SG   R      N   +  + N+  V++A+ + E  +  W  CN
Sbjct: 277 FTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPE-QLPQWDMCN 335
Query: 175 --QSLSYTKDVSS-SLAYHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLTIETGW 231
              +L Y +   S +  Y + L  + YQ+L+Y+GDVDM   ++  E ++ SLN  +E   
Sbjct: 336 FLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQR 395
Query: 232 QPWFVE-----GQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACH 286
           +PW V+      Q+AG+   +      H+ F T+KGAGH  P  KP     M  R+    
Sbjct: 396 RPWLVKYGDSGEQIAGFVKEFS-----HIAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQ 450
Query: 287 P 287
           P
Sbjct: 451 P 451
>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, With The Microbial Peptide Aldehyde Inhibitor, Antipain, And Arginine At Room Temperature Length = 160 Back     alignment and structure
>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase Ii At 2.2- Angstroms Resolution Length = 152 Back     alignment and structure
>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution Length = 153 Back     alignment and structure
>pdb|4AZ0|B Chain B, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 155 Back     alignment and structure
>pdb|1GXS|B Chain B, Crystal Structure Of Hydroxynitrile Lyase From Sorghum Bicolor In Complex With Inhibitor Benzoic Acid: A Novel Cyanogenic Enzyme Length = 158 Back     alignment and structure
>pdb|4AZ0|A Chain A, Crystal Structure Of Cathepsin A, Complexed With 8a. Length = 300 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query288
1ivy_A452 Human protective protein; carboxypeptidase, serine 6e-75
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 1e-57
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 6e-56
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 2e-55
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 4e-55
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 6e-25
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 3e-23
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Length = 452 Back     alignment and structure
 Score =  235 bits (600), Expect = 6e-75
 Identities = 72/306 (23%), Positives = 131/306 (42%), Gaps = 31/306 (10%)

Query: 1   MIVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRN 60
            +   +         P MNL+G  +GN L+   +N NS+ +FAY + L+ + ++ S + +
Sbjct: 158 TLAVLVMQ------DPSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTH 211

Query: 61  CQG--EYVNVDPSNGLCIADLENITECI--SRVNHAQIYEPSC-------RGPFISPRRK 109
           C    +    D  +  C+ +L+ +   +  S +N   +Y P         R    +   +
Sbjct: 212 CCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQ 271

Query: 110 LFNWNSSVLEEDSLDFLSSPTQPAASGTWCRFHNYVYSYIWANDKTVQRAIGVQEGTVKY 169
                 + L    +   +               N   +  + N+  V++A+ + E  +  
Sbjct: 272 DLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCTNTTAASTYLNNPYVRKALNIPE-QLPQ 330

Query: 170 WVRCNQSLS--YTKDVSSSLA-YHRNLIKKGYQVLIYSGDVDMKVPYVATEAWIKSLNLT 226
           W  CN  ++  Y +   S  + Y + L  + YQ+L+Y+GDVDM   ++  E ++ SLN  
Sbjct: 331 WDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQK 390

Query: 227 IETGWQPWFVE-----GQVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDR 281
           +E   +PW V+      Q+AG+   +      H+ F T+KGAGH  P  KP     M  R
Sbjct: 391 MEVQRRPWLVKYGDSGEQIAGFVKEFS-----HIAFLTIKGAGHMVPTDKPLAAFTMFSR 445

Query: 282 WFACHP 287
           +    P
Sbjct: 446 FLNKQP 451
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Length = 153 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Length = 421 Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 158 Back     alignment and structure
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Length = 483 Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Length = 270 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Length = 255 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
1ivy_A452 Human protective protein; carboxypeptidase, serine 100.0
1ac5_A483 KEX1(delta)P; carboxypeptidase, hydrolase, glycopr 100.0
1cpy_A421 Serine carboxypeptidase; hydrolase (carboxypeptida 100.0
4az3_B155 Lysosomal protective protein 20 kDa chain; hydrola 100.0
1gxs_B158 P-(S)-hydroxymandelonitrIle lyase chain B; inhibit 100.0
1whs_B153 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 100.0
4az3_A300 Lysosomal protective protein 32 kDa chain; hydrola 99.77
1gxs_A270 P-(S)-hydroxymandelonitrIle lyase chain A; inhibit 99.65
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 99.6
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 97.48
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 97.37
1iup_A282 META-cleavage product hydrolase; aromatic compound 97.35
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 97.31
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 97.31
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 97.27
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 97.26
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 97.26
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 97.25
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 97.24
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 97.24
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 97.23
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 97.23
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 97.22
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 97.21
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 97.16
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 97.15
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 97.14
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 97.1
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 97.09
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 97.09
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 97.08
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 97.08
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 97.08
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 97.07
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 97.06
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 97.05
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 97.03
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 97.03
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 97.02
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 97.02
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 97.01
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 97.01
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 97.0
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 97.0
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 97.0
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 97.0
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 97.0
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 96.99
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 96.96
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 96.95
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.95
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 96.94
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 96.94
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 96.92
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 96.92
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 96.91
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 96.91
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 96.87
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 96.87
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 96.86
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 96.86
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 96.85
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.84
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 96.83
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 96.82
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 96.8
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 96.76
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 96.75
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 96.65
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 96.65
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 96.63
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 96.6
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.59
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 96.59
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 96.59
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 96.56
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 96.5
3llc_A270 Putative hydrolase; structural genomics, joint cen 96.48
3h04_A275 Uncharacterized protein; protein with unknown func 96.44
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 96.43
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 96.41
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 96.4
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 96.39
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 96.38
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 96.38
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 96.37
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 96.35
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 96.3
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 96.23
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 96.19
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 96.18
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 96.17
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 96.14
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 96.08
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 95.99
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 95.96
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 95.9
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 94.88
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 95.87
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 95.82
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 95.77
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 95.68
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 95.66
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 95.62
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 95.6
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 95.6
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 95.54
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 95.5
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 95.5
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 95.47
1r3d_A264 Conserved hypothetical protein VC1974; structural 95.37
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 95.35
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 95.3
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 95.27
1vkh_A273 Putative serine hydrolase; structural genomics, jo 95.27
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 95.21
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 95.09
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 95.04
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 94.85
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 94.83
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 94.73
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 94.73
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 94.73
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 94.7
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 94.44
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 94.33
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 93.98
4f21_A246 Carboxylesterase/phospholipase family protein; str 93.97
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 93.93
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 93.76
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 93.55
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 93.46
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 93.42
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 93.36
3bjr_A283 Putative carboxylesterase; structural genomics, jo 93.19
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 92.82
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 92.73
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 92.33
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 92.28
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 92.24
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 92.09
2d81_A 318 PHB depolymerase; alpha/beta hydrolase fold, circu 92.07
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.9
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 91.86
4fle_A202 Esterase; structural genomics, PSI-biology, northe 91.66
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 91.65
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 91.65
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 91.53
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 91.43
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 91.35
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 91.18
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 90.94
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 90.84
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 90.37
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 90.06
1kez_A300 Erythronolide synthase; polyketide synthase, modul 89.69
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 89.37
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 89.34
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 88.39
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 87.98
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 87.96
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 87.31
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 85.85
3lp5_A250 Putative cell surface hydrolase; structural genom 84.97
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 84.78
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 83.95
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 83.32
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 83.1
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 82.37
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 81.15
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 81.02
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 80.76
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 80.42
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
Probab=100.00  E-value=8.9e-56  Score=414.01  Aligned_cols=270  Identities=27%  Similarity=0.529  Sum_probs=208.6

Q ss_pred             hHHHHHhcccCCCCCCccceEEEEeCCCCCcccccCcccchhhcccccCHHHHHHHhccCCC----CccccCCCCcchHH
Q 023030            2 IVQHISDGIDVGHRPRMNLKGYLLGNPLTDSTENQNSVPHFAYLNALISHEIYESAKRNCQG----EYVNVDPSNGLCIA   77 (288)
Q Consensus         2 lA~~I~~~n~~~~~~~inLkGi~IGNg~~dp~~q~~s~~~~~~~~gli~~~~~~~~~~~c~~----~~~~~~~~~~~C~~   77 (288)
                      ||.+|++.      ..||||||+||||++||..|..++++|+|+||||++++++.+.+.|..    .+..  ..+..|..
T Consensus       159 la~~i~~~------~~~~l~g~~ign~~~d~~~~~~~~~~~~~~~glis~~~~~~~~~~c~~~~~~~~~~--~~~~~C~~  230 (452)
T 1ivy_A          159 LAVLVMQD------PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYD--NKDLECVT  230 (452)
T ss_dssp             HHHHHTTC------TTSCEEEEEEESCCSBHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHEETTEECCSS--CCCHHHHH
T ss_pred             HHHHHHhc------CccccceEEecCCccChhhhhhhHHHHHhhhhcCCHHHHHHHHHHhhhcccccccc--cchHHHHH
Confidence            67888743      369999999999999999999999999999999999999999998852    2221  33457999


Q ss_pred             HHHHHHHHh--hcCCCCCCCCCCCCCCCCCCcccc--cc--cC-cccccccc-ccccCCCC-C---CCccccccccccch
Q 023030           78 DLENITECI--SRVNHAQIYEPSCRGPFISPRRKL--FN--WN-SSVLEEDS-LDFLSSPT-Q---PAASGTWCRFHNYV  145 (288)
Q Consensus        78 ~~~~~~~~~--~~in~y~i~~~~C~~~~~~~~~~~--~~--~~-~~~~~~~~-~~~~~~~~-~---~~~~~~~C~~~~~~  145 (288)
                      +++.+.+.+  +++|+|+++.+ |......+....  ..  .. ...+.... .+.+.... .   .....+||.  +..
T Consensus       231 ~~~~~~~~~~~~~in~Y~i~~~-C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~pc~--~~~  307 (452)
T 1ivy_A          231 NLQEVARIVGNSGLNIYNLYAP-CAGGVPSHFRYEKDTVVVQDLGNIFTRLPLKRMWHQALLRSGDKVRMDPPCT--NTT  307 (452)
T ss_dssp             HHHHHHHHHHSSSCCTTCTTSC-CTTCCSSSEEEETTEEEECCCSCSSTTSCCCCCCGGGHHHHTCEEEECCTTC--CCH
T ss_pred             HHHHHHHHHhcCCCcccccccc-cccccccccchhcccccccccchhhhhhhhccccccccccccccccCCCCcc--chH
Confidence            988887765  78999999987 742111000000  00  00 00000000 00000000 0   001123784  345


Q ss_pred             hhhhccCchhHHHHhCCCCCCcccceeecccc--ccCCCccchHHHHHHHHhc-CceEEEEccCCccccccHHHHHHHHH
Q 023030          146 YSYIWANDKTVQRAIGVQEGTVKYWVRCNQSL--SYTKDVSSSLAYHRNLIKK-GYQVLIYSGDVDMKVPYVATEAWIKS  222 (288)
Q Consensus       146 ~~~~ylN~~~V~~aL~v~~~~~~~w~~cs~~v--~~~~d~~~~~~~~~~Ll~~-~~rvliy~Gd~D~~~~~~g~~~~i~~  222 (288)
                      .++.|||+++||+||||+.. ...|+.||..|  .|.+...++++.++.||++ |+|||||+||.|++||+.|+++||++
T Consensus       308 ~~~~ylN~~~Vq~ALhv~~~-~~~W~~Cs~~V~~~~~~~~~s~~~~~~~LL~~~girVlIYsGD~D~icn~~Gt~~wi~~  386 (452)
T 1ivy_A          308 AASTYLNNPYVRKALNIPEQ-LPQWDMCNFLVNLQYRRLYRSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDS  386 (452)
T ss_dssp             HHHHHHTSHHHHHHTTCCTT-SCCCCSBCHHHHHHCBCCCSBSHHHHHHHHHHTCCEEEEEEETTCSSSCHHHHHHHHHH
T ss_pred             HHHHHhCcHHHHHHcCCCCC-CCccccCcHHHHhhhhcccccHHHHHHHHHhccCceEEEEeCCCCccCCcHHHHHHHHh
Confidence            68899999999999999864 35799999988  4666667999999999998 99999999999999999999999999


Q ss_pred             cCCCCcccccccccC-C----EeeeEEEEEeecCCceeEEEEEcCCCccCCCCCcHHHHHHHHHHhcCCCC
Q 023030          223 LNLTIETGWQPWFVE-G----QVAGYWYRYKEKNNYHLTFATVKGAGHTAPEYKPKECLGMIDRWFACHPL  288 (288)
Q Consensus       223 l~w~~~~~~~~w~~~-~----~~~G~~~~~~~~~~~~ltf~~V~~AGH~vP~dqP~~~~~m~~~fi~~~~~  288 (288)
                      |+|++.++|+||+++ +    +++||+++|+   |  |||++|+|||||||+|||++|++||++||.|++|
T Consensus       387 L~~~~~~~~~pw~~~~~~~~~~vaG~~~~y~---n--Ltf~tV~gAGHmVP~dqP~~al~m~~~fl~g~~l  452 (452)
T 1ivy_A          387 LNQKMEVQRRPWLVKYGDSGEQIAGFVKEFS---H--IAFLTIKGAGHMVPTDKPLAAFTMFSRFLNKQPY  452 (452)
T ss_dssp             TCCCEEEEEEEEEEECTTSCEEEEEEEEEES---S--EEEEEETTCCSSHHHHCHHHHHHHHHHHHTTCCC
T ss_pred             cCCcccccceeeeeccCCCCcccceEEEEEc---c--eEEEEECCCcccCcccChHHHHHHHHHHhcCCCC
Confidence            999999999999886 5    9999999998   8  9999999999999999999999999999999986
>1ac5_A KEX1(delta)P; carboxypeptidase, hydrolase, glycoprotein, transmembrane; HET: NAG; 2.40A {Saccharomyces cerevisiae} SCOP: c.69.1.5 Back     alignment and structure
>1cpy_A Serine carboxypeptidase; hydrolase (carboxypeptidase); HET: NAG; 2.60A {Saccharomyces cerevisiae} SCOP: c.69.1.5 PDB: 1wpx_A* 1ysc_A* Back     alignment and structure
>4az3_B Lysosomal protective protein 20 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_B* Back     alignment and structure
>1gxs_B P-(S)-hydroxymandelonitrIle lyase chain B; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1whs_B Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1wht_B* 1bcs_B* 1bcr_B* 3sc2_B* Back     alignment and structure
>4az3_A Lysosomal protective protein 32 kDa chain; hydrolase, drug discovery, carboxypeptidase, cardiovascular; HET: NAG S35; 2.04A {Homo sapiens} PDB: 4az0_A* Back     alignment and structure
>1gxs_A P-(S)-hydroxymandelonitrIle lyase chain A; inhibitor complex, cyanogenesis mechanism; HET: NAG FUL DKA; 2.3A {Sorghum bicolor} SCOP: c.69.1.5 Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 288
g1wht.1409 c.69.1.5 (A:,B:) Serine carboxypeptidase II {Wheat 3e-50
d1ivya_452 c.69.1.5 (A:) Human 'protective protein', HPP {Hum 7e-50
g1gxs.1425 c.69.1.5 (A:,B:) Hydroxynitrile lyase {Sorghum (So 3e-48
d1ac5a_483 c.69.1.5 (A:) Serine carboxypeptidase II {Baker's 3e-47
d1wpxa1421 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Bak 5e-38
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Length = 452 Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Length = 483 Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 421 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query288
g1wht.1409 Serine carboxypeptidase II {Wheat (Triticum vulgar 100.0
g1gxs.1425 Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T 100.0
d1ivya_452 Human 'protective protein', HPP {Human (Homo sapie 100.0
d1ac5a_483 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1wpxa1421 Serine carboxypeptidase II {Baker's yeast (Sacchar 100.0
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 97.73
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 97.66
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 97.64
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 97.53
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 97.52
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 97.48
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.47
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 97.43
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.39
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 97.31
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 97.3
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 97.28
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 97.27
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 97.24
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 97.21
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 97.2
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 97.2
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 97.11
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.9
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 96.89
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 96.73
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 96.45
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 96.44
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 96.3
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 96.18
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 95.89
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 95.85
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 95.79
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 95.71
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 94.94
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 93.87
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 93.1
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 92.99
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 92.96
d1qfma2280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 91.84
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 91.26
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 91.24
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 91.13
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 90.87
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 90.45
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 90.01
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 88.88
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 88.3
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 87.5
d2d81a1 318 Polyhydroxybutyrate depolymerase {Penicillium funi 87.37
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 87.15
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 86.8
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 85.62
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 85.14
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 81.92
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 80.4
>d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} Back     information, alignment and structure
>d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure