Citrus Sinensis ID: 023157

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------

MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL

ccccccccccEEEEEEccccHHHHHHHHcccccEEEcccHHHHHHHcccccccccccEEEEEccHHccccccHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEEEccccccccEEEEEEEEcccccHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEccccccccccEEccccccccccccEEEEcccHHHHHHHHHHHHHHccccccccccHHccc

ccHHccccccEEEEEEccccccHHHHHHHccccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEcEcccccccccEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEEEHHHHcccccccccEEEEEcccccHHHHEEEEccccccccccEEEEEEcHcHHHHHHHHHHHHHHHHHHccccHHHHc

MRALGDYLGVKVHAcvggtsvreDQRILQAGVHVVVGTPGRVFDMLRrqslrpdyikMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQvgvfsatmppeALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDwltdkmrsrdhtvsathgdmdqntRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVInydlptqpenylhrigrsgrfgrkgvainfvtrdderMLFDIQKFYNVVIEELpsnvadll

MRALGDYLGVKVHACVGGTSVREDQRILQAGvhvvvgtpgrvfDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALeitrkfmnkpvRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLaitqsvifvntrrkvdwltdkmrsrdhtvsathgdmdqntrDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYlhrigrsgrfgrkGVAINfvtrddermLFDIQKFYNVVIEELPSNVADLL

***LGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDK********************DIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEEL********

*RALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNV**LL

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		286	2.2.26 [Sep-21-2011]
P35683		414	Eukaryotic initiation fac	yes	no	1.0	0.690	0.972	1e-164
P41379		413	Eukaryotic initiation fac	N/A	no	1.0	0.692	0.972	1e-164
Q40467		413	Eukaryotic initiation fac	N/A	no	1.0	0.692	0.965	1e-163
P41376		412	Eukaryotic initiation fac	yes	no	1.0	0.694	0.972	1e-163
P41381		413	Eukaryotic initiation fac	N/A	no	1.0	0.692	0.961	1e-163
P41382		413	Eukaryotic initiation fac	N/A	no	1.0	0.692	0.965	1e-163
Q6Z2Z4		414	Eukaryotic initiation fac	yes	no	1.0	0.690	0.965	1e-163
Q40465		413	Eukaryotic initiation fac	N/A	no	1.0	0.692	0.965	1e-163
Q40471		413	Eukaryotic initiation fac	N/A	no	1.0	0.692	0.961	1e-162
P41377		412	Eukaryotic initiation fac	yes	no	1.0	0.694	0.965	1e-162

>sp\|P35683\|IF4A1_ORYSJ Eukaryotic initiation factor 4A-1 OS=Oryza sativa subsp. japonica GN=Os06g0701100 PE=2 SV=2	Back alignment and function desciption

 Score =  578 bits (1489), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 278/286 (97%), Positives = 284/286 (99%)

Query: 1   MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 60
           MRALGDYLGVKVHACVGGTSVREDQRIL +GVHVVVGTPGRVFDMLRRQSLRPDYIKMFV
Sbjct: 129 MRALGDYLGVKVHACVGGTSVREDQRILASGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 188

Query: 61  LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 120
           LDEADEMLSRGFKDQIYDIFQLLP+K+QVGVFSATMPPEALEITRKFMNKPVRILVKRDE
Sbjct: 189 LDEADEMLSRGFKDQIYDIFQLLPSKIQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 248

Query: 121 LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 180
           LTLEGIKQFYVNVEKEEWKL+TLCDLYETLAITQSVIFVNTRRKVDWLTDKMR RDHTVS
Sbjct: 249 LTLEGIKQFYVNVEKEEWKLDTLCDLYETLAITQSVIFVNTRRKVDWLTDKMRGRDHTVS 308

Query: 181 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 240
           ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI
Sbjct: 309 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 368

Query: 241 GRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
           GRSGRFGRKGVAINFVTRDDERMLFDIQ+FYNVVIEELP+NVADLL
Sbjct: 369 GRSGRFGRKGVAINFVTRDDERMLFDIQRFYNVVIEELPANVADLL 414

ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Oryza sativa subsp. japonica (taxid: 39947)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3

>sp\|P41379\|IF4A2_NICPL Eukaryotic initiation factor 4A-2 OS=Nicotiana plumbaginifolia PE=2 SV=1	Back alignment and function description

>sp\|Q40467\|IF414_TOBAC Eukaryotic initiation factor 4A-14 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|P41376\|IF4A1_ARATH Eukaryotic initiation factor 4A-1 OS=Arabidopsis thaliana GN=TIF4A-1 PE=1 SV=1	Back alignment and function description

>sp\|P41381\|IF4A8_TOBAC Eukaryotic initiation factor 4A-8 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|P41382\|IF410_TOBAC Eukaryotic initiation factor 4A-10 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|Q6Z2Z4\|IF4A3_ORYSJ Eukaryotic initiation factor 4A-3 OS=Oryza sativa subsp. japonica GN=Os02g0146600 PE=2 SV=1	Back alignment and function description

>sp\|Q40465\|IF411_TOBAC Eukaryotic initiation factor 4A-11 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|Q40471\|IF4A9_TOBAC Eukaryotic initiation factor 4A-9 OS=Nicotiana tabacum PE=2 SV=1	Back alignment and function description

>sp\|P41377\|IF4A2_ARATH Eukaryotic initiation factor 4A-2 OS=Arabidopsis thaliana GN=TIF4A-2 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		286
255560725		413	dead box ATP-dependent RNA helicase, put	1.0	0.692	0.996	1e-165
283049400		413	DEAD-box RNA helicase-like protein [Prun	1.0	0.692	0.986	1e-164
224073500		413	predicted protein [Populus trichocarpa]	1.0	0.692	0.986	1e-164
359484301		803	PREDICTED: eukaryotic initiation factor	1.0	0.356	0.979	1e-163
297738640		413	unnamed protein product [Vitis vinifera]	1.0	0.692	0.979	1e-163
225429488		413	PREDICTED: eukaryotic initiation factor	1.0	0.692	0.972	1e-163
225442221		413	PREDICTED: eukaryotic initiation factor	1.0	0.692	0.979	1e-163
224153793		390	predicted protein [Populus trichocarpa]	1.0	0.733	0.979	1e-163
147779855		413	hypothetical protein VITISV_040122 [Viti	1.0	0.692	0.972	1e-163
449447868		413	PREDICTED: eukaryotic initiation factor	1.0	0.692	0.975	1e-162

>gi\|255560725\|ref\|XP_002521376.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis] gi\|223539454\|gb\|EEF41044.1\| dead box ATP-dependent RNA helicase, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  588 bits (1515), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 285/286 (99%), Positives = 285/286 (99%)

Query: 1   MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 60
           MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV
Sbjct: 128 MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 187

Query: 61  LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 120
           LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE
Sbjct: 188 LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 247

Query: 121 LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 180
           LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS
Sbjct: 248 LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 307

Query: 181 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 240
           ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI
Sbjct: 308 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 367

Query: 241 GRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
           GR GRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL
Sbjct: 368 GRGGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 413

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|283049400\|gb\|ADB07168.1\| DEAD-box RNA helicase-like protein [Prunus persica] gi\|283049402\|gb\|ADB07169.1\| DEAD-box RNA helicase-like protein [Prunus persica]	Back alignment and taxonomy information

>gi\|224073500\|ref\|XP_002304104.1\| predicted protein [Populus trichocarpa] gi\|118484805\|gb\|ABK94270.1\| unknown [Populus trichocarpa] gi\|222841536\|gb\|EEE79083.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|359484301\|ref\|XP_002281247.2\| PREDICTED: eukaryotic initiation factor 4A-15-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|297738640\|emb\|CBI27885.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225429488\|ref\|XP_002278119.1\| PREDICTED: eukaryotic initiation factor 4A-11 [Vitis vinifera] gi\|296081635\|emb\|CBI20640.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|225442221\|ref\|XP_002277703.1\| PREDICTED: eukaryotic initiation factor 4A-2 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224153793\|ref\|XP_002337398.1\| predicted protein [Populus trichocarpa] gi\|222838972\|gb\|EEE77323.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|147779855\|emb\|CAN61608.1\| hypothetical protein VITISV_040122 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|449447868\|ref\|XP_004141688.1\| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus] gi\|449480559\|ref\|XP_004155930.1\| PREDICTED: eukaryotic initiation factor 4A-11-like [Cucumis sativus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		286
TAIR\|locus:2020078		412	EIF4A-2 "eif4a-2" [Arabidopsis	1.0	0.694	0.965	6.6e-145
TAIR\|locus:2030285		414	AT1G72730 [Arabidopsis thalian	1.0	0.690	0.940	7.8e-142
TAIR\|locus:2088237		415	EIF4A1 "eukaryotic translation	0.923	0.636	0.973	3.3e-134
ZFIN\|ZDB-GENE-040426-2802		411	eif4a2 "eukaryotic translation	0.993	0.690	0.757	3.1e-115
UNIPROTKB\|Q8JFP1		407	EIF4A2 "Eukaryotic initiation	0.993	0.697	0.750	3.9e-115
UNIPROTKB\|Q3SZ65		407	EIF4A2 "Eukaryotic initiation	0.993	0.697	0.750	6.4e-115
UNIPROTKB\|E2R3J1		407	EIF4A2 "Uncharacterized protei	0.993	0.697	0.750	6.4e-115
UNIPROTKB\|Q14240		407	EIF4A2 "Eukaryotic initiation	0.993	0.697	0.750	6.4e-115
UNIPROTKB\|Q9NZE6		312	EIF4A2 "BM-010" [Homo sapiens	0.993	0.910	0.750	6.4e-115
UNIPROTKB\|A6M930		407	EIF4A2 "Eukaryotic translation	0.993	0.697	0.750	6.4e-115

TAIR\|locus:2020078 EIF4A-2 "eif4a-2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1416 (503.5 bits), Expect = 6.6e-145, P = 6.6e-145
 Identities = 276/286 (96%), Positives = 282/286 (98%)

Query:     1 MRALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFV 60
             MRALGDY GVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPD IKMFV
Sbjct:   127 MRALGDYQGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDCIKMFV 186

Query:    61 LDEADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDE 120
             LDEADEMLSRGFKDQIYDIFQLLP K+QVGVFSATMPPEALEITRKFM+KPVRILVKRDE
Sbjct:   187 LDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITRKFMSKPVRILVKRDE 246

Query:   121 LTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 180
             LTLEGIKQFYVNVEKE+WKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS
Sbjct:   247 LTLEGIKQFYVNVEKEDWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVS 306

Query:   181 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRI 240
             ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVIN+DLPTQPENYLHRI
Sbjct:   307 ATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINFDLPTQPENYLHRI 366

Query:   241 GRSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
             GRSGRFGRKGVAINFVT DD+RMLFDIQKFYNVV+EELPSNVADLL
Sbjct:   367 GRSGRFGRKGVAINFVTLDDQRMLFDIQKFYNVVVEELPSNVADLL 412

GO:0003676 "nucleic acid binding" evidence=IEA

GO:0003743 "translation initiation factor activity" evidence=ISS

GO:0004386 "helicase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005737 "cytoplasm" evidence=ISM

GO:0008026 "ATP-dependent helicase activity" evidence=IEA;ISS

GO:0046686 "response to cadmium ion" evidence=IEP;RCA

GO:0005774 "vacuolar membrane" evidence=IDA

GO:0005886 "plasma membrane" evidence=IDA

GO:0005829 "cytosol" evidence=IDA

GO:0009506 "plasmodesma" evidence=IDA

GO:0005794 "Golgi apparatus" evidence=RCA

GO:0006094 "gluconeogenesis" evidence=RCA

GO:0006096 "glycolysis" evidence=RCA

GO:0009651 "response to salt stress" evidence=RCA

TAIR\|locus:2030285 AT1G72730 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2088237 EIF4A1 "eukaryotic translation initiation factor 4A1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-2802 eif4a2 "eukaryotic translation initiation factor 4A, isoform 2" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q8JFP1 EIF4A2 "Eukaryotic initiation factor 4A-II" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|Q3SZ65 EIF4A2 "Eukaryotic initiation factor 4A-II" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R3J1 EIF4A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|Q14240 EIF4A2 "Eukaryotic initiation factor 4A-II" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9NZE6 EIF4A2 "BM-010" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|A6M930 EIF4A2 "Eukaryotic translation initiation factor 4A isoform 2" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q0UU86	IF4A_PHANO	3, ., 6, ., 4, ., 1, 3	0.7323	0.9930	0.7171	N/A	no
Q40470	IF4A7_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9545	1.0	0.6924	N/A	no
Q6Z2Z4	IF4A3_ORYSJ	3, ., 6, ., 4, ., 1, 3	0.9650	1.0	0.6908	yes	no
P0CQ73	FAL1_CRYNB	3, ., 6, ., 4, ., 1, 3	0.7102	0.9895	0.7146	N/A	no
P0CQ72	FAL1_CRYNJ	3, ., 6, ., 4, ., 1, 3	0.7102	0.9895	0.7146	yes	no
P35683	IF4A1_ORYSJ	3, ., 6, ., 4, ., 1, 3	0.9720	1.0	0.6908	yes	no
Q4R4Y9	IF4A2_MACFA	3, ., 6, ., 4, ., 1, 3	0.7473	0.9930	0.6960	N/A	no
Q4WEB4	FAL1_ASPFU	3, ., 6, ., 4, ., 1, 3	0.6866	0.9930	0.7135	yes	no
Q41741	IF4A_MAIZE	3, ., 6, ., 4, ., 1, 3	0.9440	1.0	0.6975	N/A	no
A5AAE5	FAL1_ASPNC	3, ., 6, ., 4, ., 1, 3	0.6866	0.9930	0.7117	yes	no
A4QVP2	IF4A_MAGO7	3, ., 6, ., 4, ., 1, 3	0.7323	0.9930	0.7171	N/A	no
Q40471	IF4A9_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9615	1.0	0.6924	N/A	no
Q4P331	IF4A_USTMA	3, ., 6, ., 4, ., 1, 3	0.7323	0.9930	0.6909	N/A	no
Q2UAK1	FAL1_ASPOR	3, ., 6, ., 4, ., 1, 3	0.6866	0.9930	0.7135	yes	no
P41382	IF410_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9650	1.0	0.6924	N/A	no
Q5AUL4	FAL1_EMENI	3, ., 6, ., 4, ., 1, 3	0.6866	0.9930	0.7117	yes	no
P41381	IF4A8_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9615	1.0	0.6924	N/A	no
P47943	IF4A_SCHPO	3, ., 6, ., 4, ., 1, 3	0.7288	0.9930	0.7244	yes	no
Q5R4X1	IF4A2_PONAB	3, ., 6, ., 4, ., 1, 3	0.7508	0.9930	0.6977	yes	no
Q14240	IF4A2_HUMAN	3, ., 6, ., 4, ., 1, 3	0.7508	0.9930	0.6977	yes	no
P41377	IF4A2_ARATH	3, ., 6, ., 4, ., 1, 3	0.9650	1.0	0.6941	yes	no
P41376	IF4A1_ARATH	3, ., 6, ., 4, ., 1, 3	0.9720	1.0	0.6941	yes	no
Q40467	IF414_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9650	1.0	0.6924	N/A	no
Q40466	IF413_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9649	0.7972	0.6422	N/A	no
Q40465	IF411_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9650	1.0	0.6924	N/A	no
Q40469	IF4A6_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9644	0.8846	1.0	N/A	no
Q40468	IF415_TOBAC	3, ., 6, ., 4, ., 1, 3	0.9580	1.0	0.6924	N/A	no
P41379	IF4A2_NICPL	3, ., 6, ., 4, ., 1, 3	0.9720	1.0	0.6924	N/A	no
Q5RKI1	IF4A2_RAT	3, ., 6, ., 4, ., 1, 3	0.7508	0.9930	0.6977	yes	no
Q9CAI7	IF4A3_ARATH	3, ., 6, ., 4, ., 1, 3	0.9405	1.0	0.6908	no	no
Q5R5F5	IF4A1_PONAB	3, ., 6, ., 4, ., 1, 3	0.7473	0.9930	0.6995	yes	no
Q4R8K5	IF4A1_MACFA	3, ., 6, ., 4, ., 1, 3	0.7438	0.9930	0.6995	N/A	no
P41378	IF4A_WHEAT	3, ., 6, ., 4, ., 1, 3	0.9580	1.0	0.6908	N/A	no
P27639	IF4A_CAEEL	3, ., 6, ., 4, ., 1, 3	0.6888	1.0	0.7114	yes	no
Q3SZ65	IF4A2_BOVIN	3, ., 6, ., 4, ., 1, 3	0.7508	0.9930	0.6977	yes	no
Q8JFP1	IF4A2_CHICK	3, ., 6, ., 4, ., 1, 3	0.7508	0.9930	0.6977	yes	no
Q7RV88	IF4A_NEUCR	3, ., 6, ., 4, ., 1, 3	0.7323	0.9930	0.7153	N/A	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.6.4.13	0.991
3rd Layer	3.6.4	0.976

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		286
PTZ00424		401	PTZ00424, PTZ00424, helicase 45; Provisional	1e-172
COG0513		513	COG0513, SrmB, Superfamily II DNA and RNA helicase	1e-102
PRK11776		460	PRK11776, PRK11776, ATP-dependent RNA helicase Dbp	6e-70
PRK11634		629	PRK11634, PRK11634, ATP-dependent RNA helicase Dea	2e-55
cd00268		203	cd00268, DEADc, DEAD-box helicases	7e-54
PRK10590		456	PRK10590, PRK10590, ATP-dependent RNA helicase Rhl	2e-49
PRK11192		434	PRK11192, PRK11192, ATP-dependent RNA helicase Srm	2e-49
PTZ00110		545	PTZ00110, PTZ00110, helicase; Provisional	5e-47
PRK01297		475	PRK01297, PRK01297, ATP-dependent RNA helicase Rhl	1e-43
cd00079		131	cd00079, HELICc, Helicase superfamily c-terminal d	6e-43
PLN00206		518	PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel	2e-42
PRK04837		423	PRK04837, PRK04837, ATP-dependent RNA helicase Rhl	4e-40
PRK04537		572	PRK04537, PRK04537, ATP-dependent RNA helicase Rhl	4e-39
pfam00270		169	pfam00270, DEAD, DEAD/DEAH box helicase	2e-29
smart00487		201	smart00487, DEXDc, DEAD-like helicases superfamily	5e-28
pfam00271		78	pfam00271, Helicase_C, Helicase conserved C-termin	8e-28
smart00490		82	smart00490, HELICc, helicase superfamily c-termina	6e-27
cd00046		144	cd00046, DEXDc, DEAD-like helicases superfamily	6e-21
COG0514		590	COG0514, RecQ, Superfamily II DNA helicase [DNA re	2e-15
COG1201		814	COG1201, Lhr, Lhr-like helicases [General function	9e-12
TIGR00614		470	TIGR00614, recQ_fam, ATP-dependent DNA helicase, R	2e-10
TIGR01389		591	TIGR01389, recQ, ATP-dependent DNA helicase RecQ	9e-10
PRK11057		607	PRK11057, PRK11057, ATP-dependent DNA helicase Rec	6e-09
COG1202		830	COG1202, COG1202, Superfamily II helicase, archaea	2e-08
COG1205		851	COG1205, COG1205, Distinct helicase family with a	8e-07
COG1111		542	COG1111, MPH1, ERCC4-like helicases [DNA replicati	1e-05
PLN03137		1195	PLN03137, PLN03137, ATP-dependent DNA helicase; Q4	2e-05
PRK09751		1490	PRK09751, PRK09751, putative ATP-dependent helicas	1e-04
COG1061		442	COG1061, SSL2, DNA or RNA helicases of superfamily	6e-04
TIGR00643		630	TIGR00643, recG, ATP-dependent DNA helicase RecG	8e-04
TIGR04121		803	TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA	0.001
TIGR00631		655	TIGR00631, uvrb, excinuclease ABC, B subunit	0.002
COG1200		677	COG1200, RecG, RecG-like helicase [DNA replication	0.004

>gnl\|CDD\|185609 PTZ00424, PTZ00424, helicase 45; Provisional	Back alignment and domain information

 Score =  480 bits (1237), Expect = e-172
 Identities = 209/284 (73%), Positives = 238/284 (83%)

Query: 3   ALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLD 62
           ALGDYL V+ HACVGGT VR+D   L+AGVH+VVGTPGRV+DM+ ++ LR D +K+F+LD
Sbjct: 118 ALGDYLKVRCHACVGGTVVRDDINKLKAGVHMVVGTPGRVYDMIDKRHLRVDDLKLFILD 177

Query: 63  EADEMLSRGFKDQIYDIFQLLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELT 122
           EADEMLSRGFK QIYD+F+ LP  VQV +FSATMP E LE+T KFM  P RILVK+DELT
Sbjct: 178 EADEMLSRGFKGQIYDVFKKLPPDVQVALFSATMPNEILELTTKFMRDPKRILVKKDELT 237

Query: 123 LEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSAT 182
           LEGI+QFYV VEKEEWK +TLCDLYETL ITQ++I+ NTRRKVD+LT KM  RD TVS  
Sbjct: 238 LEGIRQFYVAVEKEEWKFDTLCDLYETLTITQAIIYCNTRRKVDYLTKKMHERDFTVSCM 297

Query: 183 HGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGR 242
           HGDMDQ  RD+IMREFRSGS+RVLITTDLLARGIDVQQVSLVINYDLP  PENY+HRIGR
Sbjct: 298 HGDMDQKDRDLIMREFRSGSTRVLITTDLLARGIDVQQVSLVINYDLPASPENYIHRIGR 357

Query: 243 SGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL 286
           SGRFGRKGVAINFVT DD   L +I++ YN  IEE+P  VAD L
Sbjct: 358 SGRFGRKGVAINFVTPDDIEQLKEIERHYNTQIEEMPMEVADYL 401

Length = 401

>gnl\|CDD\|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>gnl\|CDD\|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>gnl\|CDD\|238167 cd00268, DEADc, DEAD-box helicases	Back alignment and domain information

>gnl\|CDD\|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>gnl\|CDD\|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>gnl\|CDD\|240273 PTZ00110, PTZ00110, helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>gnl\|CDD\|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>gnl\|CDD\|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>gnl\|CDD\|215832 pfam00270, DEAD, DEAD/DEAH box helicase	Back alignment and domain information

>gnl\|CDD\|214692 smart00487, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain	Back alignment and domain information

>gnl\|CDD\|197757 smart00490, HELICc, helicase superfamily c-terminal domain	Back alignment and domain information

>gnl\|CDD\|238005 cd00046, DEXDc, DEAD-like helicases superfamily	Back alignment and domain information

>gnl\|CDD\|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>gnl\|CDD\|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ	Back alignment and domain information

>gnl\|CDD\|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>gnl\|CDD\|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|215597 PLN03137, PLN03137, ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>gnl\|CDD\|137505 PRK09751, PRK09751, putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>gnl\|CDD\|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG	Back alignment and domain information

>gnl\|CDD\|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated	Back alignment and domain information

>gnl\|CDD\|233063 TIGR00631, uvrb, excinuclease ABC, B subunit	Back alignment and domain information

>gnl\|CDD\|224121 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		286
KOG0328		400	consensus Predicted ATP-dependent RNA helicase FAL	100.0
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	100.0
PTZ00110		545	helicase; Provisional	100.0
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	100.0
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	100.0
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	100.0
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	100.0
PLN00206		518	DEAD-box ATP-dependent RNA helicase; Provisional	100.0
PTZ00424		401	helicase 45; Provisional	100.0
KOG0326		459	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	100.0
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	100.0
KOG0333		673	consensus U5 snRNP-like RNA helicase subunit [RNA	100.0
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	100.0
KOG0336		629	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0335		482	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0345		567	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0342		543	consensus ATP-dependent RNA helicase pitchoune [RN	100.0
KOG0343		758	consensus RNA Helicase [RNA processing and modific	100.0
KOG0327		397	consensus Translation initiation factor 4F, helica	100.0
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0332		477	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0341		610	consensus DEAD-box protein abstrakt [RNA processin	100.0
KOG0346		569	consensus RNA helicase [RNA processing and modific	100.0
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	100.0
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	100.0
TIGR03817		742	DECH_helic helicase/secretion neighborhood putativ	100.0
KOG4284		980	consensus DEAD box protein [Transcription]	100.0
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	100.0
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	100.0
KOG0347		731	consensus RNA helicase [RNA processing and modific	100.0
COG0514		590	RecQ Superfamily II DNA helicase [DNA replication,	100.0
KOG0337		529	consensus ATP-dependent RNA helicase [RNA processi	100.0
KOG0334		997	consensus RNA helicase [RNA processing and modific	100.0
KOG0348		708	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK09751		1490	putative ATP-dependent helicase Lhr; Provisional	100.0
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	100.0
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	100.0
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	100.0
PRK13767		876	ATP-dependent helicase; Provisional	100.0
PRK10689		1147	transcription-repair coupling factor; Provisional	100.0
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	100.0
KOG0344		593	consensus ATP-dependent RNA helicase [RNA processi	100.0
PRK02362		737	ski2-like helicase; Provisional	100.0
PRK00254		720	ski2-like helicase; Provisional	100.0
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	100.0
TIGR02621		844	cas3_GSU0051 CRISPR-associated helicase Cas3, Anae	100.0
COG1201		814	Lhr Lhr-like helicases [General function predictio	100.0
TIGR01970		819	DEAH_box_HrpB ATP-dependent helicase HrpB. This mo	99.98
PRK01172		674	ski2-like helicase; Provisional	99.97
PHA02653		675	RNA helicase NPH-II; Provisional	99.97
PRK11664		812	ATP-dependent RNA helicase HrpB; Provisional	99.97
TIGR01587		358	cas3_core CRISPR-associated helicase Cas3. This mo	99.97
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	99.97
KOG0351		941	consensus ATP-dependent DNA helicase [Replication,	99.97
PHA02558		501	uvsW UvsW helicase; Provisional	99.97
KOG0329		387	consensus ATP-dependent RNA helicase [RNA processi	99.96
KOG0352		641	consensus ATP-dependent DNA helicase [Replication,	99.96
PRK13766		773	Hef nuclease; Provisional	99.96
COG1202		830	Superfamily II helicase, archaea-specific [General	99.96
COG1204		766	Superfamily II helicase [General function predicti	99.96
PRK11131		1294	ATP-dependent RNA helicase HrpA; Provisional	99.96
TIGR00603		732	rad25 DNA repair helicase rad25. All proteins in t	99.95
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	99.95
PRK09401		1176	reverse gyrase; Reviewed	99.95
TIGR03158		357	cas3_cyano CRISPR-associated helicase, Cyano-type.	99.95
KOG0349		725	consensus Putative DEAD-box RNA helicase DDX1 [RNA	99.95
PRK09200		790	preprotein translocase subunit SecA; Reviewed	99.95
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	99.95
PRK14701		1638	reverse gyrase; Provisional	99.94
KOG0354		746	consensus DEAD-box like helicase [General function	99.94
TIGR01967		1283	DEAH_box_HrpA ATP-dependent helicase HrpA. This mo	99.94
TIGR03714		762	secA2 accessory Sec system translocase SecA2. Memb	99.94
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	99.94
PRK04914		956	ATP-dependent helicase HepA; Validated	99.94
TIGR00595		505	priA primosomal protein N'. All proteins in this f	99.93
COG1205		851	Distinct helicase family with a unique C-terminal	99.93
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	99.93
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	99.93
KOG0353		695	consensus ATP-dependent DNA helicase [General func	99.92
PRK05580		679	primosome assembly protein PriA; Validated	99.92
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.92
KOG0947		1248	consensus Cytoplasmic exosomal RNA helicase SKI2,	99.91
COG1061		442	SSL2 DNA or RNA helicases of superfamily II [Trans	99.91
COG4098		441	comFA Superfamily II DNA/RNA helicase required for	99.91
COG1643		845	HrpA HrpA-like helicases [DNA replication, recombi	99.88
KOG0948		1041	consensus Nuclear exosomal RNA helicase MTR4, DEAD	99.88
PRK12904		830	preprotein translocase subunit SecA; Reviewed	99.88
PRK12906		796	secA preprotein translocase subunit SecA; Reviewed	99.88
KOG0950		1008	consensus DNA polymerase theta/eta, DEAD-box super	99.88
PRK09694		878	helicase Cas3; Provisional	99.88
KOG0922		674	consensus DEAH-box RNA helicase [RNA processing an	99.88
PRK05298		652	excinuclease ABC subunit B; Provisional	99.88
TIGR00631		655	uvrb excinuclease ABC, B subunit. This family is b	99.87
PRK13104		896	secA preprotein translocase subunit SecA; Reviewed	99.87
cd00079		131	HELICc Helicase superfamily c-terminal domain; ass	99.86
PRK11448		1123	hsdR type I restriction enzyme EcoKI subunit R; Pr	99.85
COG0556		663	UvrB Helicase subunit of the DNA excision repair c	99.85
PLN03142		1033	Probable chromatin-remodeling complex ATPase chain	99.84
COG4581		1041	Superfamily II RNA helicase [DNA replication, reco	99.84
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	99.82
COG1203		733	CRISPR-associated helicase Cas3 [Defense mechanism	99.82
PRK13107		908	preprotein translocase subunit SecA; Reviewed	99.82
KOG0923		902	consensus mRNA splicing factor ATP-dependent RNA h	99.79
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	99.79
KOG0385		971	consensus Chromatin remodeling complex WSTF-ISWI,	99.79
KOG0926		1172	consensus DEAH-box RNA helicase [RNA processing an	99.78
COG1198		730	PriA Primosomal protein N' (replication factor Y)	99.77
KOG0920		924	consensus ATP-dependent RNA helicase A [RNA proces	99.74
KOG1123		776	consensus RNA polymerase II transcription initiati	99.74
smart00490		82	HELICc helicase superfamily c-terminal domain.	99.72
KOG0924		1042	consensus mRNA splicing factor ATP-dependent RNA h	99.71
KOG4150		1034	consensus Predicted ATP-dependent RNA helicase [RN	99.69
PRK12899		970	secA preprotein translocase subunit SecA; Reviewed	99.66
COG4096		875	HsdR Type I site-specific restriction-modification	99.66
KOG0384		1373	consensus Chromodomain-helicase DNA-binding protei	99.66
KOG0925		699	consensus mRNA splicing factor ATP-dependent RNA h	99.64
PRK12326		764	preprotein translocase subunit SecA; Reviewed	99.64
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	99.63
KOG0953		700	consensus Mitochondrial RNA helicase SUV3, DEAD-bo	99.61
PRK12903		925	secA preprotein translocase subunit SecA; Reviewed	99.6
TIGR00348		667	hsdR type I site-specific deoxyribonuclease, HsdR	99.6
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	99.59
PRK13103		913	secA preprotein translocase subunit SecA; Reviewed	99.58
KOG0387		923	consensus Transcription-coupled repair protein CSB	99.57
KOG0949		1330	consensus Predicted helicase, DEAD-box superfamily	99.55
PF06862		442	DUF1253: Protein of unknown function (DUF1253); In	99.52
KOG0389		941	consensus SNF2 family DNA-dependent ATPase [Chroma	99.49
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	99.44
CHL00122		870	secA preprotein translocase subunit SecA; Validate	99.41
KOG0390		776	consensus DNA repair protein, SNF2 family [Replica	99.4
PRK14873		665	primosome assembly protein PriA; Provisional	99.37
COG4889		1518	Predicted helicase [General function prediction on	99.35
KOG1000		689	consensus Chromatin remodeling protein HARP/SMARCA	99.35
TIGR02562		1110	cas3_yersinia CRISPR-associated helicase Cas3. The	99.34
KOG0951		1674	consensus RNA helicase BRR2, DEAD-box superfamily	99.33
PRK12902		939	secA preprotein translocase subunit SecA; Reviewed	99.31
KOG0392		1549	consensus SNF2 family DNA-dependent ATPase domain-	99.31
PRK12901		1112	secA preprotein translocase subunit SecA; Reviewed	99.29
KOG0386		1157	consensus Chromatin remodeling complex SWI/SNF, co	99.15
smart00487		201	DEXDc DEAD-like helicases superfamily.	99.02
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	99.0
cd00046		144	DEXDc DEAD-like helicases superfamily. A diverse f	98.9
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	98.9
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	98.84
PF13307		167	Helicase_C_2: Helicase C-terminal domain; PDB: 4A1	98.81
TIGR00596		814	rad1 DNA repair protein (rad1). This family is bas	98.81
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	98.79
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	98.78
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	98.74
KOG2340		698	consensus Uncharacterized conserved protein [Funct	98.69
PF02399		824	Herpes_ori_bp: Origin of replication binding prote	98.62
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	98.57
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	98.53
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	98.52
COG0610		962	Type I site-specific restriction-modification syst	98.49
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	98.45
KOG0921		1282	consensus Dosage compensation complex, subunit MLE	98.41
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	98.31
COG0653		822	SecA Preprotein translocase subunit SecA (ATPase,	98.29
PF07652		148	Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR	98.19
PF04851		184	ResIII: Type III restriction enzyme, res subunit;	98.09
KOG4439		901	consensus RNA polymerase II transcription terminat	98.04
smart00492		141	HELICc3 helicase superfamily c-terminal domain.	98.02
smart00491		142	HELICc2 helicase superfamily c-terminal domain.	98.01
KOG1002		791	consensus Nucleotide excision repair protein RAD16	97.7
PF13871		278	Helicase_C_4: Helicase_C-like	97.62
PF00176		299	SNF2_N: SNF2 family N-terminal domain; InterPro: I	97.48
KOG1016		1387	consensus Predicted DNA helicase, DEAD-box superfa	97.26
PRK14873		665	primosome assembly protein PriA; Provisional	96.89
PRK10917		681	ATP-dependent DNA helicase RecG; Provisional	96.75
PRK05580		679	primosome assembly protein PriA; Validated	96.71
TIGR00595		505	priA primosomal protein N'. All proteins in this f	96.68
PF13872		303	AAA_34: P-loop containing NTP hydrolase pore-1	96.61
KOG0952		1230	consensus DNA/RNA helicase MER3/SLH1, DEAD-box sup	96.29
TIGR00643		630	recG ATP-dependent DNA helicase RecG.	96.25
COG1198		730	PriA Primosomal protein N' (replication factor Y)	96.21
COG1110		1187	Reverse gyrase [DNA replication, recombination, an	96.21
PF14617		252	CMS1: U3-containing 90S pre-ribosomal complex subu	95.97
PF07517		266	SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011	95.85
TIGR00580		926	mfd transcription-repair coupling factor (mfd). Al	95.8
COG1200		677	RecG RecG-like helicase [DNA replication, recombin	95.79
KOG0391		1958	consensus SNF2 family DNA-dependent ATPase [Genera	95.76
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	95.65
KOG0701		1606	consensus dsRNA-specific nuclease Dicer and relate	95.56
PRK10689		1147	transcription-repair coupling factor; Provisional	95.29
KOG1002		791	consensus Nucleotide excision repair protein RAD16	94.99
COG1197		1139	Mfd Transcription-repair coupling factor (superfam	94.96
TIGR03117		636	cas_csf4 CRISPR-associated DEAD/DEAH-box helicase	94.83
COG0513		513	SrmB Superfamily II DNA and RNA helicases [DNA rep	94.35
PF06733		174	DEAD_2: DEAD_2; InterPro: IPR010614 This represent	94.2
KOG4439		901	consensus RNA polymerase II transcription terminat	94.07
PRK14701		1638	reverse gyrase; Provisional	94.01
TIGR00614		470	recQ_fam ATP-dependent DNA helicase, RecQ family.	93.93
cd00268		203	DEADc DEAD-box helicases. A diverse family of prot	93.9
KOG0331		519	consensus ATP-dependent RNA helicase [RNA processi	93.6
KOG1001		674	consensus Helicase-like transcription factor HLTF/	93.5
KOG1513		1300	consensus Nuclear helicase MOP-3/SNO (DEAD-box sup	93.36
TIGR01407		850	dinG_rel DnaQ family exonuclease/DinG family helic	93.05
TIGR01389		591	recQ ATP-dependent DNA helicase RecQ. The ATP-depe	92.98
smart00489		289	DEXDc3 DEAD-like helicases superfamily.	92.87
smart00488		289	DEXDc2 DEAD-like helicases superfamily.	92.87
KOG0330		476	consensus ATP-dependent RNA helicase [RNA processi	92.4
PRK11634		629	ATP-dependent RNA helicase DeaD; Provisional	91.7
PRK12898		656	secA preprotein translocase subunit SecA; Reviewed	91.69
TIGR01054		1171	rgy reverse gyrase. Generally, these gyrases are e	91.67
PRK08074		928	bifunctional ATP-dependent DNA helicase/DNA polyme	91.57
PRK11776		460	ATP-dependent RNA helicase DbpA; Provisional	91.4
PF10593		239	Z1: Z1 domain; InterPro: IPR018310 This entry repr	91.38
COG1111		542	MPH1 ERCC4-like helicases [DNA replication, recomb	91.37
PRK11747		697	dinG ATP-dependent DNA helicase DinG; Provisional	91.22
PRK07246		820	bifunctional ATP-dependent DNA helicase/DNA polyme	90.64
KOG0338		691	consensus ATP-dependent RNA helicase [RNA processi	90.36
KOG1513		1300	consensus Nuclear helicase MOP-3/SNO (DEAD-box sup	89.64
PRK11192		434	ATP-dependent RNA helicase SrmB; Provisional	89.5
PRK05642		234	DNA replication initiation factor; Validated	89.29
PF13401		131	AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S	89.26
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	89.06
KOG0347		731	consensus RNA helicase [RNA processing and modific	88.95
KOG0388		1185	consensus SNF2 family DNA-dependent ATPase [Replic	88.89
PF00271		78	Helicase_C: Helicase conserved C-terminal domain;	88.81
PF09848		352	DUF2075: Uncharacterized conserved protein (DUF207	88.76
KOG0298		1394	consensus DEAD box-containing helicase-like transc	88.75
KOG1132		945	consensus Helicase of the DEAD superfamily [Replic	88.49
PRK11057		607	ATP-dependent DNA helicase RecQ; Provisional	88.23
PRK10590		456	ATP-dependent RNA helicase RhlE; Provisional	87.77
PRK04837		423	ATP-dependent RNA helicase RhlB; Provisional	87.69
PRK04537		572	ATP-dependent RNA helicase RhlB; Provisional	87.54
PRK08084		235	DNA replication initiation factor; Provisional	87.31
TIGR00963		745	secA preprotein translocase, SecA subunit. The pro	86.65
COG1435		201	Tdk Thymidine kinase [Nucleotide transport and met	86.2
PF00270		169	DEAD: DEAD/DEAH box helicase; InterPro: IPR011545	86.09
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	85.93
KOG0339		731	consensus ATP-dependent RNA helicase [RNA processi	85.9
PRK12422		445	chromosomal replication initiation protein; Provis	85.88
PF13173		128	AAA_14: AAA domain	85.76
PF13086		236	AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV	85.23
PRK08727		233	hypothetical protein; Validated	85.22
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	84.91
PRK12900		1025	secA preprotein translocase subunit SecA; Reviewed	84.91
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	84.83
TIGR00604		705	rad3 DNA repair helicase (rad3). All proteins in t	84.76
COG1199		654	DinG Rad3-related DNA helicases [Transcription / D	84.71
COG3973		747	Superfamily I DNA and RNA helicases [General funct	84.59
PRK06893		229	DNA replication initiation factor; Validated	84.3
KOG1015		1567	consensus Transcription regulator XNP/ATRX, DEAD-b	84.28
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	84.18
KOG0350		620	consensus DEAD-box ATP-dependent RNA helicase [RNA	84.08
TIGR00708		173	cobA cob(I)alamin adenosyltransferase. Alternate n	84.07
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	84.01
PLN03137		1195	ATP-dependent DNA helicase; Q4-like; Provisional	83.68
PRK09401		1176	reverse gyrase; Reviewed	83.27
KOG1001		674	consensus Helicase-like transcription factor HLTF/	83.25
KOG0343		758	consensus RNA Helicase [RNA processing and modific	83.05
PRK01297		475	ATP-dependent RNA helicase RhlB; Provisional	82.95
PRK14087		450	dnaA chromosomal replication initiation protein; P	82.79
PHA03368		738	DNA packaging terminase subunit 1; Provisional	82.46
KOG1133		821	consensus Helicase of the DEAD superfamily [Replic	82.15
KOG0340		442	consensus ATP-dependent RNA helicase [RNA processi	82.0
PF05621		302	TniB: Bacterial TniB protein; InterPro: IPR008868	81.95
PRK07414		178	cob(I)yrinic acid a,c-diamide adenosyltransferase;	81.76
COG1205		851	Distinct helicase family with a unique C-terminal	81.75
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	81.48
COG0553		866	HepA Superfamily II DNA/RNA helicases, SNF2 family	81.31
KOG3089		271	consensus Predicted DEAD-box-containing helicase [	81.17
PF02562		205	PhoH: PhoH-like protein; InterPro: IPR003714 PhoH	80.87
cd01524		90	RHOD_Pyr_redox Member of the Rhodanese Homology Do	80.68
PRK05986		191	cob(I)alamin adenolsyltransferase/cobinamide ATP-d	80.59
KOG0298		1394	consensus DEAD box-containing helicase-like transc	80.49
PTZ00110		545	helicase; Provisional	80.4
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	80.23
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	80.15

>KOG0328 consensus Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

Probab=100.00  E-value=1.1e-51  Score=314.82  Aligned_cols=285  Identities=68%  Similarity=1.104  Sum_probs=277.2

Q ss_pred             cccccccCceEEEEEcCcchHHHHHHHhCCCcEEEeCcHHHHHHHhcCCCCCCCccEEEEehhhHhhccccHHHHHHHHH
Q 023157            2 RALGDYLGVKVHACVGGTSVREDQRILQAGVHVVVGTPGRVFDMLRRQSLRPDYIKMFVLDEADEMLSRGFKDQIYDIFQ   81 (286)
Q Consensus         2 ~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~iii~Tp~~l~~~~~~~~~~~~~~~~iIiDE~h~~~~~~~~~~~~~i~~   81 (286)
                      ..++...++.++.+.||++..+..+.+.-+.+++.+||+++++++++..+....++++|+||++.+++.++..++-.+.+
T Consensus       116 ~alg~~mnvq~hacigg~n~gedikkld~G~hvVsGtPGrv~dmikr~~L~tr~vkmlVLDEaDemL~kgfk~Qiydiyr  195 (400)
T KOG0328|consen  116 LALGDYMNVQCHACIGGKNLGEDIKKLDYGQHVVSGTPGRVLDMIKRRSLRTRAVKMLVLDEADEMLNKGFKEQIYDIYR  195 (400)
T ss_pred             HHhcccccceEEEEecCCccchhhhhhcccceEeeCCCchHHHHHHhccccccceeEEEeccHHHHHHhhHHHHHHHHHH
Confidence            35778889999999999999999999988999999999999999999999999999999999999999999999999999


Q ss_pred             hCCcCccEEEEEeecChhHHHHHHHhcCCCeEEEecCCccccccceeEEEEccchhhHHHHHHHHHhhccCcceEEEecc
Q 023157           82 LLPAKVQVGVFSATMPPEALEITRKFMNKPVRILVKRDELTLEGIKQFYVNVEKEEWKLETLCDLYETLAITQSVIFVNT  161 (286)
Q Consensus        82 ~~~~~~~~i~~SAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~l~~~~~~~~~~~~ivf~~~  161 (286)
                      ++|+.+|++++|||++.+..+....+..+|+.+...+++...+.+.+++..++.+++|.+.++.++....-..++|||++
T Consensus       196 ~lp~~~Qvv~~SATlp~eilemt~kfmtdpvrilvkrdeltlEgIKqf~v~ve~EewKfdtLcdLYd~LtItQavIFcnT  275 (400)
T KOG0328|consen  196 YLPPGAQVVLVSATLPHEILEMTEKFMTDPVRILVKRDELTLEGIKQFFVAVEKEEWKFDTLCDLYDTLTITQAVIFCNT  275 (400)
T ss_pred             hCCCCceEEEEeccCcHHHHHHHHHhcCCceeEEEecCCCchhhhhhheeeechhhhhHhHHHHHhhhhehheEEEEecc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHHHHHHHHhcCCCeeEEecCCCCHHHHHHHHHHhhcCCCcEEEEecCCccCCCCCCCcEEEEccCCCCcchhhhhhc
Q 023157          162 RRKVDWLTDKMRSRDHTVSATHGDMDQNTRDIIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIG  241 (286)
Q Consensus       162 ~~~~~~l~~~l~~~~~~~~~~~~~~~~~~r~~~~~~f~~~~~~vlv~T~~~~~Gidi~~~~~vi~~~~~~s~~~~~Q~~G  241 (286)
                      +..+.++.+.+++.+..+...||+|++++|..++..|++|+.+|||+|++-++|+|+|.++.||.||.|.+...|+||+|
T Consensus       276 k~kVdwLtekm~~~nftVssmHGDm~qkERd~im~dFRsg~SrvLitTDVwaRGiDv~qVslviNYDLP~nre~YIHRIG  355 (400)
T KOG0328|consen  276 KRKVDWLTEKMREANFTVSSMHGDMEQKERDKIMNDFRSGKSRVLITTDVWARGIDVQQVSLVINYDLPNNRELYIHRIG  355 (400)
T ss_pred             cchhhHHHHHHHhhCceeeeccCCcchhHHHHHHHHhhcCCceEEEEechhhccCCcceeEEEEecCCCccHHHHhhhhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCcceEEEEeccCcHHHHHHHHHHhchhcccCCcchhccC
Q 023157          242 RSGRFGRKGVAINFVTRDDERMLFDIQKFYNVVIEELPSNVADLL  286 (286)
Q Consensus       242 R~~R~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~l~  286 (286)
                      |.||.|..|.++-|+..+|.+.+..+++++...+.+.|..+++++
T Consensus       356 RSGRFGRkGvainFVk~~d~~~lrdieq~yst~i~emp~nvad~i  400 (400)
T KOG0328|consen  356 RSGRFGRKGVAINFVKSDDLRILRDIEQYYSTQIDEMPMNVADLI  400 (400)
T ss_pred             cccccCCcceEEEEecHHHHHHHHHHHHHHhhhcccccchhhhcC
Confidence            999999999999999999999999999999999999999998875

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional	Back alignment and domain information

>PTZ00424 helicase 45; Provisional	Back alignment and domain information

>KOG0326 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>KOG0333 consensus U5 snRNP-like RNA helicase subunit [RNA processing and modification]	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>KOG0336 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0335 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0345 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0342 consensus ATP-dependent RNA helicase pitchoune [RNA processing and modification]	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>KOG0327 consensus Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0332 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0341 consensus DEAD-box protein abstrakt [RNA processing and modification]	Back alignment and domain information

>KOG0346 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase	Back alignment and domain information

>KOG4284 consensus DEAD box protein [Transcription]	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0337 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0334 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0348 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK09751 putative ATP-dependent helicase Lhr; Provisional	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>PRK13767 ATP-dependent helicase; Provisional	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>KOG0344 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK02362 ski2-like helicase; Provisional	Back alignment and domain information

>PRK00254 ski2-like helicase; Provisional	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype	Back alignment and domain information

>COG1201 Lhr Lhr-like helicases [General function prediction only]	Back alignment and domain information

>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB	Back alignment and domain information

>PRK01172 ski2-like helicase; Provisional	Back alignment and domain information

>PHA02653 RNA helicase NPH-II; Provisional	Back alignment and domain information

>PRK11664 ATP-dependent RNA helicase HrpB; Provisional	Back alignment and domain information

>TIGR01587 cas3_core CRISPR-associated helicase Cas3	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0351 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PHA02558 uvsW UvsW helicase; Provisional	Back alignment and domain information

>KOG0329 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0352 consensus ATP-dependent DNA helicase [Replication, recombination and repair]	Back alignment and domain information

>PRK13766 Hef nuclease; Provisional	Back alignment and domain information

>COG1202 Superfamily II helicase, archaea-specific [General function prediction only]	Back alignment and domain information

>COG1204 Superfamily II helicase [General function prediction only]	Back alignment and domain information

>PRK11131 ATP-dependent RNA helicase HrpA; Provisional	Back alignment and domain information

>TIGR00603 rad25 DNA repair helicase rad25	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type	Back alignment and domain information

>KOG0349 consensus Putative DEAD-box RNA helicase DDX1 [RNA processing and modification]	Back alignment and domain information

>PRK09200 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>KOG0354 consensus DEAD-box like helicase [General function prediction only]	Back alignment and domain information

>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA	Back alignment and domain information

>TIGR03714 secA2 accessory Sec system translocase SecA2	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK04914 ATP-dependent helicase HepA; Validated	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0353 consensus ATP-dependent DNA helicase [General function prediction only]	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>KOG0947 consensus Cytoplasmic exosomal RNA helicase SKI2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0948 consensus Nuclear exosomal RNA helicase MTR4, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12904 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>PRK12906 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0950 consensus DNA polymerase theta/eta, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK09694 helicase Cas3; Provisional	Back alignment and domain information

>KOG0922 consensus DEAH-box RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK05298 excinuclease ABC subunit B; Provisional	Back alignment and domain information

>TIGR00631 uvrb excinuclease ABC, B subunit	Back alignment and domain information

>PRK13104 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process

Back alignment and domain information

>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional	Back alignment and domain information

>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair]	Back alignment and domain information

>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional	Back alignment and domain information

>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms]	Back alignment and domain information

>PRK13107 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0923 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0385 consensus Chromatin remodeling complex WSTF-ISWI, small subunit [Transcription]	Back alignment and domain information

>KOG0926 consensus DEAH-box RNA helicase [RNA processing and modification; Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0920 consensus ATP-dependent RNA helicase A [RNA processing and modification]	Back alignment and domain information

>KOG1123 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, 3'-5' helicase subunit SSL2 [Transcription; Replication, recombination and repair]	Back alignment and domain information

>smart00490 HELICc helicase superfamily c-terminal domain	Back alignment and domain information

>KOG0924 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG4150 consensus Predicted ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12899 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>KOG0384 consensus Chromodomain-helicase DNA-binding protein [Transcription]	Back alignment and domain information

>KOG0925 consensus mRNA splicing factor ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12326 preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0953 consensus Mitochondrial RNA helicase SUV3, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12903 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>PRK13103 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0387 consensus Transcription-coupled repair protein CSB/RAD26 (contains SNF2 family DNA-dependent ATPase domain) [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0949 consensus Predicted helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ]	Back alignment and domain information

>KOG0389 consensus SNF2 family DNA-dependent ATPase [Chromatin structure and dynamics]	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>CHL00122 secA preprotein translocase subunit SecA; Validated	Back alignment and domain information

>KOG0390 consensus DNA repair protein, SNF2 family [Replication, recombination and repair]	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>COG4889 Predicted helicase [General function prediction only]	Back alignment and domain information

>KOG1000 consensus Chromatin remodeling protein HARP/SMARCAL1, DEAD-box superfamily [Chromatin structure and dynamics]	Back alignment and domain information

>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3	Back alignment and domain information

>KOG0951 consensus RNA helicase BRR2, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>PRK12902 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription]	Back alignment and domain information

>PRK12901 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>KOG0386 consensus Chromatin remodeling complex SWI/SNF, component SWI2 and related ATPases (DNA/RNA helicase superfamily) [Chromatin structure and dynamics; Transcription]	Back alignment and domain information

>smart00487 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>cd00046 DEXDc DEAD-like helicases superfamily	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A	Back alignment and domain information

>TIGR00596 rad1 DNA repair protein (rad1)	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>KOG2340 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms]	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>KOG0921 consensus Dosage compensation complex, subunit MLE [Transcription]	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion]	Back alignment and domain information

>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain	Back alignment and domain information

>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>smart00492 HELICc3 helicase superfamily c-terminal domain	Back alignment and domain information

>smart00491 HELICc2 helicase superfamily c-terminal domain	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>PF13871 Helicase_C_4: Helicase_C-like	Back alignment and domain information

>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e	Back alignment and domain information

>KOG1016 consensus Predicted DNA helicase, DEAD-box superfamily [General function prediction only]	Back alignment and domain information

>PRK14873 primosome assembly protein PriA; Provisional	Back alignment and domain information

>PRK10917 ATP-dependent DNA helicase RecG; Provisional	Back alignment and domain information

>PRK05580 primosome assembly protein PriA; Validated	Back alignment and domain information

>TIGR00595 priA primosomal protein N'	Back alignment and domain information

>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1	Back alignment and domain information

>KOG0952 consensus DNA/RNA helicase MER3/SLH1, DEAD-box superfamily [RNA processing and modification]	Back alignment and domain information

>TIGR00643 recG ATP-dependent DNA helicase RecG	Back alignment and domain information

>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]	Back alignment and domain information

>COG1110 Reverse gyrase [DNA replication, recombination, and repair]	Back alignment and domain information

>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit	Back alignment and domain information

>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane	Back alignment and domain information

>TIGR00580 mfd transcription-repair coupling factor (mfd)	Back alignment and domain information

>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>KOG0391 consensus SNF2 family DNA-dependent ATPase [General function prediction only]	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG0701 consensus dsRNA-specific nuclease Dicer and related ribonucleases [RNA processing and modification]	Back alignment and domain information

>PRK10689 transcription-repair coupling factor; Provisional	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]	Back alignment and domain information

>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4	Back alignment and domain information

>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin	Back alignment and domain information

>KOG4439 consensus RNA polymerase II transcription termination factor TTF2/lodestar, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK14701 reverse gyrase; Provisional	Back alignment and domain information

>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family	Back alignment and domain information

>cd00268 DEADc DEAD-box helicases	Back alignment and domain information

>KOG0331 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms]	Back alignment and domain information

>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative	Back alignment and domain information

>TIGR01389 recQ ATP-dependent DNA helicase RecQ	Back alignment and domain information

>smart00489 DEXDc3 DEAD-like helicases superfamily	Back alignment and domain information

>smart00488 DEXDc2 DEAD-like helicases superfamily	Back alignment and domain information

>KOG0330 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK11634 ATP-dependent RNA helicase DeaD; Provisional	Back alignment and domain information

>PRK12898 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>TIGR01054 rgy reverse gyrase	Back alignment and domain information

>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>PRK11776 ATP-dependent RNA helicase DbpA; Provisional	Back alignment and domain information

>PF10593 Z1: Z1 domain; InterPro: IPR018310 This entry represents the Z1 domain of unknown function that is found in a group of putative endonucleases	Back alignment and domain information

>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional	Back alignment and domain information

>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated	Back alignment and domain information

>KOG0338 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG1513 consensus Nuclear helicase MOP-3/SNO (DEAD-box superfamily) [Transcription; Signal transduction mechanisms]	Back alignment and domain information

>PRK11192 ATP-dependent RNA helicase SrmB; Provisional	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG0347 consensus RNA helicase [RNA processing and modification]	Back alignment and domain information

>KOG0388 consensus SNF2 family DNA-dependent ATPase [Replication, recombination and repair]	Back alignment and domain information

>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins	Back alignment and domain information

>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>KOG1132 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>PRK11057 ATP-dependent DNA helicase RecQ; Provisional	Back alignment and domain information

>PRK10590 ATP-dependent RNA helicase RhlE; Provisional	Back alignment and domain information

>PRK04837 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK04537 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>TIGR00963 secA preprotein translocase, SecA subunit	Back alignment and domain information

>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>KOG0339 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF13173 AAA_14: AAA domain	Back alignment and domain information

>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PRK12900 secA preprotein translocase subunit SecA; Reviewed	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>TIGR00604 rad3 DNA repair helicase (rad3)	Back alignment and domain information

>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>COG3973 Superfamily I DNA and RNA helicases [General function prediction only]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>KOG1015 consensus Transcription regulator XNP/ATRX, DEAD-box superfamily [Transcription]	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>KOG0350 consensus DEAD-box ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>TIGR00708 cobA cob(I)alamin adenosyltransferase	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional	Back alignment and domain information

>PRK09401 reverse gyrase; Reviewed	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0343 consensus RNA Helicase [RNA processing and modification]	Back alignment and domain information

>PRK01297 ATP-dependent RNA helicase RhlB; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PHA03368 DNA packaging terminase subunit 1; Provisional	Back alignment and domain information

>KOG1133 consensus Helicase of the DEAD superfamily [Replication, recombination and repair]	Back alignment and domain information

>KOG0340 consensus ATP-dependent RNA helicase [RNA processing and modification]	Back alignment and domain information

>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins	Back alignment and domain information

>PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated	Back alignment and domain information

>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only]	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG3089 consensus Predicted DEAD-box-containing helicase [General function prediction only]	Back alignment and domain information

>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli []	Back alignment and domain information

>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily	Back alignment and domain information

>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>PTZ00110 helicase; Provisional	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

Homologous Structure Templates