Citrus Sinensis ID: 023185
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| 255574131 | 440 | conserved hypothetical protein [Ricinus | 0.888 | 0.577 | 0.652 | 2e-88 | |
| 224121216 | 446 | predicted protein [Populus trichocarpa] | 0.916 | 0.587 | 0.679 | 6e-87 | |
| 225429824 | 449 | PREDICTED: uncharacterized protein LOC10 | 0.923 | 0.587 | 0.617 | 3e-84 | |
| 224115694 | 447 | predicted protein [Populus trichocarpa] | 0.919 | 0.588 | 0.652 | 8e-84 | |
| 363806748 | 446 | uncharacterized protein LOC100781922 pre | 0.895 | 0.573 | 0.606 | 5e-82 | |
| 217074086 | 404 | unknown [Medicago truncatula] | 0.881 | 0.623 | 0.606 | 3e-80 | |
| 357466595 | 439 | hypothetical protein MTR_3g109330 [Medic | 0.881 | 0.574 | 0.606 | 6e-80 | |
| 388521969 | 435 | unknown [Lotus japonicus] | 0.874 | 0.574 | 0.588 | 1e-78 | |
| 449509133 | 448 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.919 | 0.587 | 0.588 | 7e-74 | |
| 449437044 | 448 | PREDICTED: uncharacterized protein LOC10 | 0.919 | 0.587 | 0.584 | 1e-73 |
| >gi|255574131|ref|XP_002527981.1| conserved hypothetical protein [Ricinus communis] gi|223532607|gb|EEF34393.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 331 bits (848), Expect = 2e-88, Method: Compositional matrix adjust.
Identities = 171/262 (65%), Positives = 214/262 (81%), Gaps = 8/262 (3%)
Query: 4 SKLVIFSLFFALILTA--ADVSIQGEDVPPLTASDAVDSSPLKIELDQLKSKIRSLESHI 61
+ L IFS F ALI +A AD+S++ +D L +S AV SS KI+LDQL SKI +LES I
Sbjct: 3 ANLAIFSFFLALIFSAVRADISLESDD--QLISSHAVHSSAFKIQLDQLNSKIHALESQI 60
Query: 62 DEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKKETLNAAEQVDKAHARADEL 121
DE+T+ELK KD +++Q +K I+D S+ I+SLQ E+SSLQKKE ++AAEQV KAHARA EL
Sbjct: 61 DERTRELKNKDAIISQNDKIIKDNSDSILSLQTEISSLQKKEKIDAAEQVGKAHARAGEL 120
Query: 122 EKQIDNLKKESEKQQKEKEALEARAIEAEKKISDLSAKLEKLQKINDEQKSKIRKTERAL 181
EKQ++N+KKE E Q +EKEALEARA EAEKKI++L KLE LQKINDEQKSK+RKTERAL
Sbjct: 121 EKQVENIKKEVETQNREKEALEARANEAEKKIAELHLKLENLQKINDEQKSKLRKTERAL 180
Query: 182 KVAEEEMMRAKFEATSRSKELTEVHSAWLPPWLAVHLLQCQSLIETHWNAHGKPAMDVAI 241
KVAEEE+M+AKFEATS++KEL EVH AWLPPWLAV L++ I+THWN HG+PAM++ I
Sbjct: 181 KVAEEELMKAKFEATSKTKELMEVHGAWLPPWLAVELVR----IQTHWNEHGRPAMELVI 236
Query: 242 QKALEKKAQAGKWVQPHVETIK 263
QKAL+KKA A KW +PH++T+K
Sbjct: 237 QKALDKKAHAEKWAKPHLDTVK 258
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224121216|ref|XP_002330772.1| predicted protein [Populus trichocarpa] gi|118485922|gb|ABK94806.1| unknown [Populus trichocarpa] gi|222872574|gb|EEF09705.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|225429824|ref|XP_002280828.1| PREDICTED: uncharacterized protein LOC100254151 [Vitis vinifera] gi|296081785|emb|CBI20790.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224115694|ref|XP_002332119.1| predicted protein [Populus trichocarpa] gi|118488228|gb|ABK95933.1| unknown [Populus trichocarpa] gi|222874939|gb|EEF12070.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|363806748|ref|NP_001242275.1| uncharacterized protein LOC100781922 precursor [Glycine max] gi|255642485|gb|ACU21506.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|217074086|gb|ACJ85403.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357466595|ref|XP_003603582.1| hypothetical protein MTR_3g109330 [Medicago truncatula] gi|355492630|gb|AES73833.1| hypothetical protein MTR_3g109330 [Medicago truncatula] gi|388509130|gb|AFK42631.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388521969|gb|AFK49046.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|449509133|ref|XP_004163503.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229984 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449437044|ref|XP_004136302.1| PREDICTED: uncharacterized protein LOC101216465 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 286 | ||||||
| TAIR|locus:2128166 | 437 | AT4G31340 "AT4G31340" [Arabido | 0.905 | 0.592 | 0.524 | 6.5e-67 | |
| TAIR|locus:2061067 | 440 | AT2G24420 [Arabidopsis thalian | 0.898 | 0.584 | 0.485 | 1.6e-61 | |
| UNIPROTKB|F1PCW0 | 2240 | GOLGA4 "Uncharacterized protei | 0.545 | 0.069 | 0.25 | 1.7e-07 | |
| SGD|S000002764 | 944 | SPC110 "Inner plaque spindle p | 0.580 | 0.175 | 0.248 | 2.5e-06 | |
| TAIR|locus:2099114 | 318 | PMD1 "peroxisomal and mitochon | 0.727 | 0.654 | 0.235 | 8.3e-06 | |
| DICTYBASE|DDB_G0286985 | 1024 | zipA "zipper-like domain-conta | 0.646 | 0.180 | 0.228 | 1e-05 | |
| WB|WBGene00002978 | 284 | lev-11 [Caenorhabditis elegans | 0.601 | 0.605 | 0.186 | 1.4e-05 | |
| UNIPROTKB|Q22866 | 284 | lev-11 "Tropomyosin isoforms a | 0.601 | 0.605 | 0.186 | 1.4e-05 | |
| ZFIN|ZDB-GENE-040625-114 | 284 | tpm2 "tropomyosin 2 (beta)" [D | 0.538 | 0.542 | 0.254 | 2.4e-05 | |
| UNIPROTKB|Q1HPQ0 | 285 | Q1HPQ0 "Tropomyosin-2" [Bombyx | 0.573 | 0.575 | 0.213 | 2.5e-05 |
| TAIR|locus:2128166 AT4G31340 "AT4G31340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 680 (244.4 bits), Expect = 6.5e-67, P = 6.5e-67
Identities = 138/263 (52%), Positives = 185/263 (70%)
Query: 1 MAASKLVIFSLFFALILTAADVSIQGEDVPPLTASDAVDSSPLKIELDQLKSKIRSLESH 60
MAA+KLV L AL+ T + + D P ++ + D S KI LDQL +KIR+LES
Sbjct: 1 MAAAKLVAL-LLLALLFTTSVFA--DADEPEVSEAAGSDGSS-KIHLDQLNAKIRALESQ 56
Query: 61 IDEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKKETLNAAEQVDKAHARADE 120
IDEKT+E++GKDEVVA+KEK ++++ ++I SLQ E+SSLQKK + ++A+Q+ KA ARADE
Sbjct: 57 IDEKTREVQGKDEVVAEKEKLLKEREDKIASLQTEVSSLQKKGSSDSAKQLGKAQARADE 116
Query: 121 LEKQIDNXXXXXXXXXXXXXXXXXRAIEAEKKISDLSAKLEKLQKINDEQKSKIRKTERA 180
LEKQ++ R EAEKK+ +L++ L+KLQK N+EQK+KI K ERA
Sbjct: 117 LEKQVEVLKNFLEQKNKEKDSTEARTNEAEKKLRELNSSLDKLQKTNEEQKNKIGKLERA 176
Query: 181 LKVAEEEMMRAKFEATSRSKELTEVHSAWLPPWLAVHLLQCQSLIETHWNAHGKPAMDVA 240
+K+AEEEM+R K EAT+++KEL E H +WLPPWLAVH + Q+ ETHW AHGKPA++
Sbjct: 177 IKIAEEEMLRTKLEATTKAKELLEAHGSWLPPWLAVHWFKFQTYTETHWEAHGKPAVETV 236
Query: 241 IQKALEKKAQAGKWVQPHVETIK 263
I K E KAQA KW +PHVE +K
Sbjct: 237 ILKVTEAKAQAEKWAEPHVENVK 259
|
|
| TAIR|locus:2061067 AT2G24420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PCW0 GOLGA4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| SGD|S000002764 SPC110 "Inner plaque spindle pole body (SPB) component" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099114 PMD1 "peroxisomal and mitochondrial division factor 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0286985 zipA "zipper-like domain-containing protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00002978 lev-11 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q22866 lev-11 "Tropomyosin isoforms a/b/d/f" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040625-114 tpm2 "tropomyosin 2 (beta)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1HPQ0 Q1HPQ0 "Tropomyosin-2" [Bombyx mori (taxid:7091)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-12 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 4e-10 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-09 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-08 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-08 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 3e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-08 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 8e-08 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 4e-07 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 4e-07 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 5e-07 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 6e-07 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 3e-06 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 3e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-06 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 7e-06 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 8e-06 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-05 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 1e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 2e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-05 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 3e-05 | |
| PRK00106 | 535 | PRK00106, PRK00106, hypothetical protein; Provisio | 3e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 4e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 5e-05 | |
| pfam05262 | 489 | pfam05262, Borrelia_P83, Borrelia P83/100 protein | 6e-05 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 8e-05 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 8e-05 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 1e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 1e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 2e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 2e-04 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 2e-04 | |
| TIGR03319 | 514 | TIGR03319, RNase_Y, ribonuclease Y | 2e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 2e-04 | |
| COG0419 | 908 | COG0419, SbcC, ATPase involved in DNA repair [DNA | 2e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 2e-04 | |
| PRK09039 | 343 | PRK09039, PRK09039, hypothetical protein; Validate | 2e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 3e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 3e-04 | |
| PRK11637 | 428 | PRK11637, PRK11637, AmiB activator; Provisional | 3e-04 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 3e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 4e-04 | |
| COG1196 | 1163 | COG1196, Smc, Chromosome segregation ATPases [Cell | 6e-04 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 6e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 7e-04 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 8e-04 | |
| COG1579 | 239 | COG1579, COG1579, Zn-ribbon protein, possibly nucl | 8e-04 | |
| PRK10636 | 638 | PRK10636, PRK10636, putative ABC transporter ATP-b | 8e-04 | |
| PTZ00121 | 2084 | PTZ00121, PTZ00121, MAEBL; Provisional | 0.001 | |
| pfam13166 | 713 | pfam13166, AAA_13, AAA domain | 0.001 | |
| COG4372 | 499 | COG4372, COG4372, Uncharacterized protein conserve | 0.001 | |
| PRK02224 | 880 | PRK02224, PRK02224, chromosome segregation protein | 0.002 | |
| pfam02463 | 1162 | pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | 0.002 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.002 | |
| PRK00409 | 782 | PRK00409, PRK00409, recombination and DNA strand e | 0.002 | |
| PRK11281 | 1113 | PRK11281, PRK11281, hypothetical protein; Provisio | 0.002 | |
| COG2433 | 652 | COG2433, COG2433, Uncharacterized conserved protei | 0.002 | |
| PRK11448 | 1123 | PRK11448, hsdR, type I restriction enzyme EcoKI su | 0.002 | |
| COG5185 | 622 | COG5185, HEC1, Protein involved in chromosome segr | 0.002 | |
| TIGR01554 | 384 | TIGR01554, major_cap_HK97, phage major capsid prot | 0.002 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| TIGR02168 | 1179 | TIGR02168, SMC_prok_B, chromosome segregation prot | 0.003 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.003 | |
| pfam08614 | 194 | pfam08614, ATG16, Autophagy protein 16 (ATG16) | 0.003 | |
| PRK12704 | 520 | PRK12704, PRK12704, phosphodiesterase; Provisional | 0.004 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.004 | |
| PRK03918 | 880 | PRK03918, PRK03918, chromosome segregation protein | 0.004 | |
| PRK11448 | 1123 | PRK11448, hsdR, type I restriction enzyme EcoKI su | 0.004 | |
| COG1283 | 533 | COG1283, NptA, Na+/phosphate symporter [Inorganic | 0.004 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
Score = 65.5 bits (160), Expect = 6e-12
Identities = 46/166 (27%), Positives = 91/166 (54%), Gaps = 1/166 (0%)
Query: 43 LKIELDQLKSKIRSLESHIDEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKK 102
LK E+++L+ K ++L+ ++E +EL+ + + E+ ++ +R L++E+ L++
Sbjct: 777 LKEEIEELEEKRQALQEELEELEEELEEAERRLDALERELESLEQRRERLEQEIEELEE- 835
Query: 103 ETLNAAEQVDKAHARADELEKQIDNLKKESEKQQKEKEALEARAIEAEKKISDLSAKLEK 162
E E++D+ +ELEK+++ LK+E E+ + EKE LE E E++ +L +L +
Sbjct: 836 EIEELEEKLDELEEELEELEKELEELKEELEELEAEKEELEDELKELEEEKEELEEELRE 895
Query: 163 LQKINDEQKSKIRKTERALKVAEEEMMRAKFEATSRSKELTEVHSA 208
L+ E K +I K L+ E ++ R + E +EL E +
Sbjct: 896 LESELAELKEEIEKLRERLEELEAKLERLEVELPELEEELEEEYED 941
|
Length = 1163 |
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|178867 PRK00106, PRK00106, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|188306 TIGR03319, RNase_Y, ribonuclease Y | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236942 PRK11637, PRK11637, AmiB activator; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|236729 PRK10636, PRK10636, putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|221952 pfam13166, AAA_13, AAA domain | Back alignment and domain information |
|---|
| >gnl|CDD|226809 COG4372, COG4372, Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
| >gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236892 PRK11281, PRK11281, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227512 COG5185, HEC1, Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|233467 TIGR01554, major_cap_HK97, phage major capsid protein, HK97 family | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|219934 pfam08614, ATG16, Autophagy protein 16 (ATG16) | Back alignment and domain information |
|---|
| >gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236912 PRK11448, hsdR, type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224202 COG1283, NptA, Na+/phosphate symporter [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| PRK11637 | 428 | AmiB activator; Provisional | 99.26 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 99.05 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 98.57 | |
| PRK11637 | 428 | AmiB activator; Provisional | 98.44 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 98.24 | |
| PRK09039 | 343 | hypothetical protein; Validated | 98.15 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 98.07 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 97.96 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.95 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.91 | |
| TIGR02169 | 1164 | SMC_prok_A chromosome segregation protein SMC, pri | 97.89 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.88 | |
| TIGR02168 | 1179 | SMC_prok_B chromosome segregation protein SMC, com | 97.79 | |
| PF00261 | 237 | Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop | 97.72 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 97.72 | |
| PRK02224 | 880 | chromosome segregation protein; Provisional | 97.32 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.31 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 97.31 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 97.28 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 97.27 | |
| COG1196 | 1163 | Smc Chromosome segregation ATPases [Cell division | 97.25 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 97.24 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.21 | |
| PRK03918 | 880 | chromosome segregation protein; Provisional | 97.19 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 97.15 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 97.14 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 97.1 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 97.08 | |
| KOG0161 | 1930 | consensus Myosin class II heavy chain [Cytoskeleto | 97.02 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 96.96 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.86 | |
| TIGR00606 | 1311 | rad50 rad50. This family is based on the phylogeno | 96.84 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 96.84 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 96.8 | |
| PRK09039 | 343 | hypothetical protein; Validated | 96.73 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.58 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.49 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 96.48 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.48 | |
| PRK04863 | 1486 | mukB cell division protein MukB; Provisional | 96.38 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.35 | |
| KOG0996 | 1293 | consensus Structural maintenance of chromosome pro | 96.34 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.33 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 96.32 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 96.32 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 96.3 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 96.22 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 96.13 | |
| KOG0933 | 1174 | consensus Structural maintenance of chromosome pro | 96.12 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 96.06 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 96.03 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 96.03 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 96.0 | |
| PF10174 | 775 | Cast: RIM-binding protein of the cytomatrix active | 95.96 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 95.89 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 95.89 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.87 | |
| PF00038 | 312 | Filament: Intermediate filament protein; InterPro: | 95.84 | |
| smart00787 | 312 | Spc7 Spc7 kinetochore protein. This domain is foun | 95.82 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 95.8 | |
| COG1340 | 294 | Uncharacterized archaeal coiled-coil protein [Func | 95.67 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 95.65 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 95.64 | |
| KOG4643 | 1195 | consensus Uncharacterized coiled-coil protein [Fun | 95.61 | |
| PRK04778 | 569 | septation ring formation regulator EzrA; Provision | 95.56 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 95.55 | |
| PRK01156 | 895 | chromosome segregation protein; Provisional | 95.53 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 95.51 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 95.48 | |
| COG4372 | 499 | Uncharacterized protein conserved in bacteria with | 95.45 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 95.44 | |
| PF05701 | 522 | WEMBL: Weak chloroplast movement under blue light; | 95.43 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 95.13 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 95.12 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 94.93 | |
| PF12128 | 1201 | DUF3584: Protein of unknown function (DUF3584); In | 94.72 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 94.7 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 94.66 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 94.63 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 94.52 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.45 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 94.44 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 94.44 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 94.4 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 94.25 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 94.24 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 94.19 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 94.11 | |
| PRK11281 | 1113 | hypothetical protein; Provisional | 94.08 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 94.0 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 93.91 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 93.79 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 93.74 | |
| TIGR03007 | 498 | pepcterm_ChnLen polysaccharide chain length determ | 93.73 | |
| TIGR01005 | 754 | eps_transp_fam exopolysaccharide transport protein | 93.73 | |
| PF05911 | 769 | DUF869: Plant protein of unknown function (DUF869) | 93.72 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 93.66 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 93.64 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 93.59 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 93.58 | |
| PF04728 | 56 | LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 | 93.32 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 93.13 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.12 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.01 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 92.83 | |
| KOG4674 | 1822 | consensus Uncharacterized conserved coiled-coil pr | 92.8 | |
| KOG0980 | 980 | consensus Actin-binding protein SLA2/Huntingtin-in | 92.76 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 92.59 | |
| KOG0995 | 581 | consensus Centromere-associated protein HEC1 [Cell | 92.54 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 92.52 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 92.37 | |
| KOG4673 | 961 | consensus Transcription factor TMF, TATA element m | 92.27 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 92.21 | |
| PF12795 | 240 | MscS_porin: Mechanosensitive ion channel porin dom | 92.17 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 92.1 | |
| KOG0994 | 1758 | consensus Extracellular matrix glycoprotein Lamini | 91.99 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 91.71 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 91.7 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 91.66 | |
| PF06008 | 264 | Laminin_I: Laminin Domain I; InterPro: IPR009254 L | 91.56 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 91.46 | |
| PF00769 | 246 | ERM: Ezrin/radixin/moesin family; InterPro: IPR011 | 91.45 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 91.43 | |
| PF07926 | 132 | TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: | 91.23 | |
| KOG0018 | 1141 | consensus Structural maintenance of chromosome pro | 91.15 | |
| KOG0964 | 1200 | consensus Structural maintenance of chromosome pro | 91.09 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 91.09 | |
| PF10168 | 717 | Nup88: Nuclear pore component; InterPro: IPR019321 | 91.02 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 90.83 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 90.78 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 90.77 | |
| KOG0971 | 1243 | consensus Microtubule-associated protein dynactin | 90.7 | |
| PF10498 | 359 | IFT57: Intra-flagellar transport protein 57 ; Inte | 90.33 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 90.29 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 90.26 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 90.16 | |
| PF14282 | 106 | FlxA: FlxA-like protein | 90.14 | |
| KOG0963 | 629 | consensus Transcription factor/CCAAT displacement | 90.11 | |
| PF09789 | 319 | DUF2353: Uncharacterized coiled-coil protein (DUF2 | 89.82 | |
| PF13514 | 1111 | AAA_27: AAA domain | 89.75 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 89.69 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 89.63 | |
| TIGR03185 | 650 | DNA_S_dndD DNA sulfur modification protein DndD. T | 89.44 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 89.39 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 89.33 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 89.31 | |
| KOG0976 | 1265 | consensus Rho/Rac1-interacting serine/threonine ki | 89.29 | |
| PF03962 | 188 | Mnd1: Mnd1 family; InterPro: IPR005647 This family | 89.26 | |
| COG5185 | 622 | HEC1 Protein involved in chromosome segregation, i | 89.18 | |
| PF04582 | 326 | Reo_sigmaC: Reovirus sigma C capsid protein; Inter | 89.16 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 89.12 | |
| PF01576 | 859 | Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu | 88.9 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 88.88 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 88.86 | |
| PRK15396 | 78 | murein lipoprotein; Provisional | 88.58 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 88.54 | |
| KOG4809 | 654 | consensus Rab6 GTPase-interacting protein involved | 88.22 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 87.98 | |
| PF07889 | 126 | DUF1664: Protein of unknown function (DUF1664); In | 87.93 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 87.64 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 87.57 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 87.53 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 87.38 | |
| PRK00736 | 68 | hypothetical protein; Provisional | 87.37 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 87.31 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 87.26 | |
| PF05557 | 722 | MAD: Mitotic checkpoint protein; InterPro: IPR0086 | 87.07 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 86.47 | |
| PHA03332 | 1328 | membrane glycoprotein; Provisional | 86.39 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 86.31 | |
| PF06818 | 202 | Fez1: Fez1; InterPro: IPR009638 This family repres | 86.07 | |
| PF15397 | 258 | DUF4618: Domain of unknown function (DUF4618) | 85.96 | |
| PF10146 | 230 | zf-C4H2: Zinc finger-containing protein ; InterPro | 85.92 | |
| TIGR01000 | 457 | bacteriocin_acc bacteriocin secretion accessory pr | 85.54 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 85.51 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 85.42 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 85.38 | |
| KOG0979 | 1072 | consensus Structural maintenance of chromosome pro | 85.26 | |
| COG1382 | 119 | GimC Prefoldin, chaperonin cofactor [Posttranslati | 85.24 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 85.06 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 84.43 | |
| PRK03947 | 140 | prefoldin subunit alpha; Reviewed | 84.3 | |
| COG1842 | 225 | PspA Phage shock protein A (IM30), suppresses sigm | 84.19 | |
| PF04012 | 221 | PspA_IM30: PspA/IM30 family; InterPro: IPR007157 T | 84.1 | |
| PF14282 | 106 | FlxA: FlxA-like protein | 83.99 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 83.96 | |
| TIGR02680 | 1353 | conserved hypothetical protein TIGR02680. Members | 83.86 | |
| PRK10929 | 1109 | putative mechanosensitive channel protein; Provisi | 83.51 | |
| TIGR03017 | 444 | EpsF chain length determinant protein EpsF. Sequen | 83.26 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 83.06 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 82.74 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 82.7 | |
| PF09730 | 717 | BicD: Microtubule-associated protein Bicaudal-D; I | 82.67 | |
| PF03148 | 384 | Tektin: Tektin family; InterPro: IPR000435 Tektin | 82.64 | |
| KOG1899 | 861 | consensus LAR transmembrane tyrosine phosphatase-i | 82.55 | |
| PF05384 | 159 | DegS: Sensor protein DegS; InterPro: IPR008595 Thi | 82.51 | |
| PF13870 | 177 | DUF4201: Domain of unknown function (DUF4201) | 82.39 | |
| PF15066 | 527 | CAGE1: Cancer-associated gene protein 1 family | 82.19 | |
| PF15619 | 194 | Lebercilin: Ciliary protein causing Leber congenit | 82.05 | |
| PRK09343 | 121 | prefoldin subunit beta; Provisional | 81.67 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 81.53 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 81.5 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 81.39 | |
| PF10267 | 395 | Tmemb_cc2: Predicted transmembrane and coiled-coil | 81.16 | |
| KOG4360 | 596 | consensus Uncharacterized coiled coil protein [Fun | 80.93 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 80.57 | |
| PRK10476 | 346 | multidrug resistance protein MdtN; Provisional | 80.4 | |
| KOG2264 | 907 | consensus Exostosin EXT1L [Signal transduction mec | 80.38 | |
| PF06160 | 560 | EzrA: Septation ring formation regulator, EzrA ; I | 80.16 | |
| PF05622 | 713 | HOOK: HOOK protein; InterPro: IPR008636 This famil | 80.04 |
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
Probab=99.26 E-value=4.4e-09 Score=103.20 Aligned_cols=145 Identities=18% Similarity=0.315 Sum_probs=80.4
Q ss_pred chhHHHHHHHHHHHHHHHhhHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh-----hHHHHHHHHHHH
Q 023185 41 SPLKIELDQLKSKIRSLESHIDEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKKE-----TLNAAEQVDKAH 115 (286)
Q Consensus 41 ~~l~~el~elk~ki~eLes~i~e~~~eL~~~d~~I~q~e~~i~e~~~eI~~Lq~eI~~~qkkl-----~~~~~eqi~ka~ 115 (286)
..+++++++++.++..++++++++..+|..++.+|..++..|+.++.+|..++.+|+.++.++ .++..+..++
T Consensus 50 ~~l~~qi~~~~~~i~~~~~~~~~~~~~l~~l~~qi~~~~~~i~~~~~~i~~~~~ei~~l~~eI~~~q~~l~~~~~~l~-- 127 (428)
T PRK11637 50 KSIQQDIAAKEKSVRQQQQQRASLLAQLKKQEEAISQASRKLRETQNTLNQLNKQIDELNASIAKLEQQQAAQERLLA-- 127 (428)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
Confidence 334555555555555555666666666666666666666666666666666666666666555 2222222222
Q ss_pred HHHHHHHH-----------------------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 023185 116 ARADELEK-----------------------------------QIDNLKKESEKQQKEKEALEARAIEAEKKISDLSAKL 160 (286)
Q Consensus 116 ~Ri~eLek-----------------------------------~Ie~Lk~eie~~~~kk~eLEa~~~e~e~k~~el~~k~ 160 (286)
.|++.+.+ .|+.+......+...+..|+....+++..+.++....
T Consensus 128 ~rlra~Y~~g~~~~l~vLl~a~~~~~~~r~~~~l~~i~~~d~~~l~~l~~~~~~L~~~k~~le~~~~~l~~~~~e~~~~k 207 (428)
T PRK11637 128 AQLDAAFRQGEHTGLQLILSGEESQRGERILAYFGYLNQARQETIAELKQTREELAAQKAELEEKQSQQKTLLYEQQAQQ 207 (428)
T ss_pred HHHHHHHHcCCCcHHHHHhcCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 34444211 5666666666666666666666666666555555555
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 023185 161 EKLQKINDEQKSKIRKTERALKVAEEE 187 (286)
Q Consensus 161 ~~Lek~~~Eqk~~i~~lE~~lq~~Eee 187 (286)
..|+....+++..+..++...+..+.+
T Consensus 208 ~~L~~~k~e~~~~l~~L~~~~~~~~~~ 234 (428)
T PRK11637 208 QKLEQARNERKKTLTGLESSLQKDQQQ 234 (428)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 555555555444444444444333333
|
|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type | Back alignment and domain information |
|---|
| >PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PRK02224 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PRK03918 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0161 consensus Myosin class II heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >TIGR00606 rad50 rad50 | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK04863 mukB cell division protein MukB; Provisional | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope | Back alignment and domain information |
|---|
| >smart00787 Spc7 Spc7 kinetochore protein | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK04778 septation ring formation regulator EzrA; Provisional | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK01156 chromosome segregation protein; Provisional | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >PRK11281 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >TIGR01005 eps_transp_fam exopolysaccharide transport protein family | Back alignment and domain information |
|---|
| >PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >PF12795 MscS_porin: Mechanosensitive ion channel porin domain | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures] | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) | Back alignment and domain information |
|---|
| >KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF14282 FlxA: FlxA-like protein | Back alignment and domain information |
|---|
| >KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription] | Back alignment and domain information |
|---|
| >PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function | Back alignment and domain information |
|---|
| >PF13514 AAA_27: AAA domain | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) | Back alignment and domain information |
|---|
| >COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PRK15396 murein lipoprotein; Provisional | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >KOG4809 consensus Rab6 GTPase-interacting protein involved in endosome-to-TGN transport [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK00736 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
| >PHA03332 membrane glycoprotein; Provisional | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein | Back alignment and domain information |
|---|
| >PF15397 DUF4618: Domain of unknown function (DUF4618) | Back alignment and domain information |
|---|
| >PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0979 consensus Structural maintenance of chromosome protein SMC5/Spr18, SMC superfamily [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG1382 GimC Prefoldin, chaperonin cofactor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK03947 prefoldin subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >COG1842 PspA Phage shock protein A (IM30), suppresses sigma54-dependent transcription [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF04012 PspA_IM30: PspA/IM30 family; InterPro: IPR007157 This family includes PspA a protein that suppresses sigma54-dependent transcription | Back alignment and domain information |
|---|
| >PF14282 FlxA: FlxA-like protein | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >TIGR02680 conserved hypothetical protein TIGR02680 | Back alignment and domain information |
|---|
| >PRK10929 putative mechanosensitive channel protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03017 EpsF chain length determinant protein EpsF | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] | Back alignment and domain information |
|---|
| >PF03148 Tektin: Tektin family; InterPro: IPR000435 Tektin heteropolymers form unique protofilaments of flagellar microtubules [] | Back alignment and domain information |
|---|
| >KOG1899 consensus LAR transmembrane tyrosine phosphatase-interacting protein liprin [General function prediction only] | Back alignment and domain information |
|---|
| >PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins | Back alignment and domain information |
|---|
| >PF13870 DUF4201: Domain of unknown function (DUF4201) | Back alignment and domain information |
|---|
| >PF15066 CAGE1: Cancer-associated gene protein 1 family | Back alignment and domain information |
|---|
| >PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease | Back alignment and domain information |
|---|
| >PRK09343 prefoldin subunit beta; Provisional | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF10267 Tmemb_cc2: Predicted transmembrane and coiled-coil 2 protein; InterPro: IPR019394 This family of transmembrane coiled-coil containing proteins is conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG4360 consensus Uncharacterized coiled coil protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PRK10476 multidrug resistance protein MdtN; Provisional | Back alignment and domain information |
|---|
| >KOG2264 consensus Exostosin EXT1L [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site | Back alignment and domain information |
|---|
| >PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 286 | |||
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-14 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-11 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 1e-10 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 2e-09 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-07 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 5e-04 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 7e-12 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 5e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-11 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 3e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 4e-10 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 2e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 3lvg_D | 190 | LCB, clathrin light chain B; SELF assembly, coated | 3e-06 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 6e-06 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 4e-05 | |
| 2zuo_A | 861 | MVP, major vault protein; repeat domains, protein- | 6e-05 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 1e-04 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 2e-04 | |
| 1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 1e-04 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 3e-04 |
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
Score = 73.2 bits (180), Expect = 1e-14
Identities = 35/160 (21%), Positives = 69/160 (43%), Gaps = 8/160 (5%)
Query: 43 LKIELDQLKSKIRSLESHIDEKTQELKGKDEVVAQKEKAIQDKSERIVSLQKELSSLQKK 102
K L++KI L+ IDE+ +E K ++ + S L+ ++ L+
Sbjct: 919 YKKLHIGLENKIMQLQRKIDEQNKEYK---SLLEKMNNLEITYSTETEKLRSDVERLRMS 975
Query: 103 ETLNAAEQVDKAHARADELEKQIDNLKKESEKQQKEKEALEARAIEAEKKISDLSAKLEK 162
E E+ A R L+++I L+KE + Q EK+ +E A + + + L ++L++
Sbjct: 976 E-----EEAKNATNRVLSLQEEIAKLRKELHQTQTEKKTIEEWADKYKHETEQLVSELKE 1030
Query: 163 LQKINDEQKSKIRKTERALKVAEEEMMRAKFEATSRSKEL 202
+ +K ++ + E M K ++ EL
Sbjct: 1031 QNTLLKTEKEELNRRIHDQAKEITETMEKKLVEETKQLEL 1070
|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Length = 256 | Back alignment and structure |
|---|
| >2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Length = 430 | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Length = 854 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 98.43 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.31 | |
| 1c1g_A | 284 | Tropomyosin; contractIle protein; 7.00A {Sus scrof | 98.26 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 97.94 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 97.29 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.24 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 97.21 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 97.12 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.94 | |
| 2fxo_A | 129 | Myosin heavy chain, cardiac muscle beta isoform; c | 96.59 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 96.54 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.47 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 96.26 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 96.23 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 96.22 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 96.1 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 96.02 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 95.79 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.75 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 95.61 | |
| 3tnu_B | 129 | Keratin, type II cytoskeletal 5; coiled-coil, stru | 95.35 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 95.21 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 95.16 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 94.94 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 94.86 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 94.78 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 94.77 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 94.62 | |
| 3ol1_A | 119 | Vimentin; structural genomics, PSI-2, protein stru | 94.23 | |
| 2efr_A | 155 | General control protein GCN4 and tropomyosin 1 Al; | 94.21 | |
| 3qh9_A | 81 | Liprin-beta-2; coiled-coil, dimerization, structur | 94.05 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 93.63 | |
| 1l8d_A | 112 | DNA double-strand break repair RAD50 ATPase; zinc | 93.58 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 92.97 | |
| 3tnu_A | 131 | Keratin, type I cytoskeletal 14; coiled-coil, stru | 91.88 | |
| 1m1j_B | 464 | Fibrinogen beta chain; coiled coils, disulfide rin | 91.5 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 91.48 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 91.08 | |
| 3swk_A | 86 | Vimentin; cytoskeleton, intermediate filament, alp | 90.92 | |
| 1jcd_A | 52 | Major outer membrane lipoprotein; protein folding, | 90.76 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 90.37 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 90.0 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 89.97 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 89.35 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 89.14 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 88.75 | |
| 2e7s_A | 135 | RAB guanine nucleotide exchange factor SEC2; coile | 88.2 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 88.04 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 87.68 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 87.25 | |
| 2b9c_A | 147 | Striated-muscle alpha tropomyosin; alpha-helix, co | 86.93 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 85.48 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 84.94 | |
| 2ocy_A | 154 | RAB guanine nucleotide exchange factor SEC2; RAB, | 84.67 | |
| 3htk_A | 60 | Structural maintenance of chromosomes protein 5; S | 84.49 | |
| 1zxa_A | 67 | CGMP-dependent protein kinase 1, alpha isozyme; pa | 83.26 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 82.14 | |
| 3mq9_A | 471 | Bone marrow stromal antigen 2 fused to maltose-BI | 81.88 | |
| 3nmd_A | 72 | CGMP dependent protein kinase; leucine zipper, coi | 80.53 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 80.11 |
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
Probab=98.43 E-value=0.00024 Score=64.10 Aligned_cols=17 Identities=6% Similarity=-0.071 Sum_probs=10.3
Q ss_pred ccCCchhHHHHHHHHHH
Q 023185 207 SAWLPPWLAVHLLQCQS 223 (286)
Q Consensus 207 g~~l~Pwla~~~~~~~~ 223 (286)
..-+||-|-..|.++..
T Consensus 170 ~~~i~~~lL~~Yerir~ 186 (256)
T 3na7_A 170 VEKTEPKIYSFYERIRR 186 (256)
T ss_dssp HHTSCHHHHHHHHHHHH
T ss_pred HhcCCHHHHHHHHHHHH
Confidence 33556666666666554
|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A | Back alignment and structure |
|---|
| >3qh9_A Liprin-beta-2; coiled-coil, dimerization, structural protein; 2.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1l8d_A DNA double-strand break repair RAD50 ATPase; zinc finger, DNA repair, recombination, HOOK motif, replication; HET: DNA CIT; 2.20A {Pyrococcus furiosus} SCOP: h.4.12.1 | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m1j_B Fibrinogen beta chain; coiled coils, disulfide rings, fibrinogen, blood clotting; HET: NDG NAG; 2.70A {Gallus gallus} SCOP: d.171.1.1 h.1.8.1 PDB: 1ei3_B* | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1jcd_A Major outer membrane lipoprotein; protein folding, coiled coil, helix capping, alanine-zipper, membrane protein; 1.30A {Escherichia coli} SCOP: h.1.16.1 PDB: 1eq7_A 1t8z_A* 2guv_A 2gus_A 1jcc_A 1kfn_A 1kfm_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2e7s_A RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 3.00A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2b9c_A Striated-muscle alpha tropomyosin; alpha-helix, coiled coil, alanine, axial stagger, radius, SIDE-chain packing, crystal packing; 2.30A {Rattus norvegicus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ocy_A RAB guanine nucleotide exchange factor SEC2; RAB, GEF, guanine exchange factor, coiled-coil, endocytosis/exocytosis complex; 3.30A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >3htk_A Structural maintenance of chromosomes protein 5; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zxa_A CGMP-dependent protein kinase 1, alpha isozyme; parallel coiled coil dimer, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 286 | |||
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 90.92 | |
| d1fxka_ | 107 | Prefoldin beta subunit {Archaeon Methanobacterium | 88.38 | |
| d1fxkc_ | 133 | Prefoldin alpha subunit {Archaeon Methanobacterium | 84.45 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 83.41 | |
| d2ap3a1 | 185 | Hypothetical protein MW0975 (SA0943) {Staphylococc | 83.15 |
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Long alpha-hairpin superfamily: Prefoldin family: Prefoldin domain: Prefoldin alpha subunit species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
Probab=90.92 E-value=1.8 Score=32.37 Aligned_cols=34 Identities=18% Similarity=0.219 Sum_probs=22.5
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 023185 116 ARADELEKQIDNLKKESEKQQKEKEALEARAIEA 149 (286)
Q Consensus 116 ~Ri~eLek~Ie~Lk~eie~~~~kk~eLEa~~~e~ 149 (286)
.|++.+++.++.+..++...+.....++....++
T Consensus 95 ~ri~~l~~~~~~l~~~~~~~~~~i~~l~~~~~~l 128 (133)
T d1fxkc_ 95 SQKNELESTLQKMGENLRAITDIMMKLSPQAEEL 128 (133)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 6777777777777777777766665555554443
|
| >d1fxka_ a.2.5.1 (A:) Prefoldin beta subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fxkc_ a.2.5.1 (C:) Prefoldin alpha subunit {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ap3a1 a.24.27.1 (A:12-196) Hypothetical protein MW0975 (SA0943) {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|