Citrus Sinensis ID: 023267
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 285 | ||||||
| 255544812 | 464 | ubiquitin-protein ligase, putative [Rici | 0.947 | 0.581 | 0.409 | 4e-49 | |
| 357477131 | 447 | F-box family-6 [Medicago truncatula] gi| | 0.950 | 0.606 | 0.367 | 2e-40 | |
| 356544606 | 444 | PREDICTED: putative F-box protein At3g58 | 0.915 | 0.587 | 0.381 | 2e-39 | |
| 449440973 | 475 | PREDICTED: putative FBD-associated F-box | 0.933 | 0.56 | 0.355 | 6e-30 | |
| 302142991 | 402 | unnamed protein product [Vitis vinifera] | 0.954 | 0.676 | 0.326 | 2e-29 | |
| 255540581 | 457 | ubiquitin-protein ligase, putative [Rici | 0.782 | 0.487 | 0.383 | 1e-27 | |
| 297736820 | 487 | unnamed protein product [Vitis vinifera] | 0.961 | 0.562 | 0.268 | 1e-20 | |
| 147865783 | 1789 | hypothetical protein VITISV_020815 [Viti | 0.961 | 0.153 | 0.275 | 3e-20 | |
| 357155585 | 449 | PREDICTED: LOW QUALITY PROTEIN: putative | 0.8 | 0.507 | 0.283 | 3e-15 | |
| 242047392 | 256 | hypothetical protein SORBIDRAFT_02g00277 | 0.670 | 0.746 | 0.323 | 3e-15 |
| >gi|255544812|ref|XP_002513467.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223547375|gb|EEF48870.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 201 bits (510), Expect = 4e-49, Method: Compositional matrix adjust.
Identities = 117/286 (40%), Positives = 181/286 (63%), Gaps = 16/286 (5%)
Query: 1 MDDRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAIL 60
+ + IS+LP+D+L+ ILSRLT++EAAR SILS RWR+LW ++TG +DF + L +
Sbjct: 31 ISEHISQLPEDVLLNILSRLTMKEAARTSILSTRWRHLWTYYTGIMDFDASLTMWYLQL- 89
Query: 61 SDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSD--YDVDSWVQFA 118
+ + ++R +F++ V+ +L + +++ LRIC+ ++SD Y++DSW+ A
Sbjct: 90 ------GLGSKSLDMERHSFVSWVNQVLRSHEGPTMEGLRICFDLDSDFMYEIDSWITIA 143
Query: 119 VDKRVQRLELDFSES----KTEGHELHTFSPYFKTTSSFSSLVSLRLIDVDIPEEVL-HY 173
+ KRV+RLE+D + KT G + F SSFSSL +L+L VD+ E L H
Sbjct: 144 MQKRVKRLEIDLTNIEPSIKTTGS--YAFPSGLLNDSSFSSLKTLQLNMVDVTGEALQHL 201
Query: 174 LLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSNLEINAPNLVSFEFSAG 233
LL +CPLLEVL++ + L+ ++VSG SLKLKYLE+ NL LEI A +LVSF++
Sbjct: 202 LLSWCPLLEVLSIVNSTSLVSLKVSGSSLKLKYLEMVCCNNLKYLEITAASLVSFKYYGP 261
Query: 234 ELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNL 279
+ + FK VP+LV+ S G +C + L+QFS ++ QL TL+ ++
Sbjct: 262 LIGLPFKSVPNLVDASFGGPFCQLTIENLYQFSLYILQLETLRFDV 307
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|357477131|ref|XP_003608851.1| F-box family-6 [Medicago truncatula] gi|355509906|gb|AES91048.1| F-box family-6 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356544606|ref|XP_003540740.1| PREDICTED: putative F-box protein At3g58860-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449440973|ref|XP_004138258.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] gi|449501454|ref|XP_004161371.1| PREDICTED: putative FBD-associated F-box protein At5g56700-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|302142991|emb|CBI20286.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255540581|ref|XP_002511355.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223550470|gb|EEF51957.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|297736820|emb|CBI26021.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147865783|emb|CAN81149.1| hypothetical protein VITISV_020815 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357155585|ref|XP_003577168.1| PREDICTED: LOW QUALITY PROTEIN: putative F-box/LRR-repeat protein At5g54820-like [Brachypodium distachyon] | Back alignment and taxonomy information |
|---|
| >gi|242047392|ref|XP_002461442.1| hypothetical protein SORBIDRAFT_02g002773 [Sorghum bicolor] gi|241924819|gb|EER97963.1| hypothetical protein SORBIDRAFT_02g002773 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 285 | ||||||
| TAIR|locus:2160205 | 472 | AT5G54820 [Arabidopsis thalian | 0.887 | 0.536 | 0.282 | 3e-12 | |
| TAIR|locus:2010032 | 416 | AT1G13570 "AT1G13570" [Arabido | 0.715 | 0.490 | 0.314 | 3.1e-11 | |
| TAIR|locus:2161088 | 421 | AT5G56370 "AT5G56370" [Arabido | 0.133 | 0.090 | 0.552 | 1.3e-10 | |
| TAIR|locus:2099019 | 457 | AT3G58860 "AT3G58860" [Arabido | 0.810 | 0.505 | 0.306 | 1.5e-10 | |
| TAIR|locus:2099644 | 481 | AT3G03360 [Arabidopsis thalian | 0.835 | 0.494 | 0.271 | 1.5e-09 | |
| TAIR|locus:2037558 | 452 | AT1G78760 "AT1G78760" [Arabido | 0.554 | 0.349 | 0.254 | 4.6e-09 | |
| TAIR|locus:2129266 | 434 | AT4G13960 "AT4G13960" [Arabido | 0.403 | 0.264 | 0.354 | 5.5e-09 | |
| TAIR|locus:2025812 | 486 | AT1G80960 "AT1G80960" [Arabido | 0.740 | 0.434 | 0.265 | 7.6e-09 | |
| TAIR|locus:2081157 | 520 | AT3G59200 "AT3G59200" [Arabido | 0.743 | 0.407 | 0.311 | 1.5e-08 | |
| TAIR|locus:2151261 | 469 | AT5G02930 "AT5G02930" [Arabido | 0.870 | 0.528 | 0.278 | 3.5e-08 |
| TAIR|locus:2160205 AT5G54820 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 186 (70.5 bits), Expect = 3.0e-12, P = 3.0e-12
Identities = 82/290 (28%), Positives = 135/290 (46%)
Query: 3 DRISKLPDDILICILSRLTIEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSD 62
DR+S LPD +LI I+S L ++E R S+LS RWRYL T +L F + + ++D
Sbjct: 7 DRLSSLPDILLIMIISFLPLKECVRTSVLSKRWRYLC-LETTNLSFKESDYVN--PDITD 63
Query: 63 PYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYP--VNSDYDVDSWVQFAVD 120
Y Y R+F VD + + Q + ++ IC+ V + +D+ +++AV
Sbjct: 64 AEYSRIVAY------RSFFCSVDKWVSITQHQVVESFEICFSHLVGFEDKIDALIEYAVS 117
Query: 121 KRVQRLELDFSES--KTEG-----HELHTF--SPYFKTT-------------SSFSSLVS 158
RV+ L +D S ++ G H ++T S Y TT S F + V
Sbjct: 118 TRVKNLVVDLSNPSWRSNGDISYRHFMYTLPKSVYSLTTLESLKIYGCKFDPSKFVNPVL 177
Query: 159 LRLIDVD-IPEEVLHYLLCYCPLLEVLTLKGAEKLIRIRVSGPSLKLKYLELRDLPNLSN 217
LR + + + E LH LL P L+ L++K + ++G +L +E D +
Sbjct: 178 LRSLSIGWVRLENLHSLLSKSPSLQSLSIKNCWGVDITSMAGQFREL-VIEHSDFSYMQ- 235
Query: 218 LEINAPNLVSFEFSAGELIVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSS 267
P + SF++S GEL + V +++ ++ D+ VY L SS
Sbjct: 236 CAFELPRIHSFKYS-GELFEFYFDVVNVIIPNVYLDFGEERVYDLQSQSS 284
|
|
| TAIR|locus:2010032 AT1G13570 "AT1G13570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2161088 AT5G56370 "AT5G56370" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099019 AT3G58860 "AT3G58860" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099644 AT3G03360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2037558 AT1G78760 "AT1G78760" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129266 AT4G13960 "AT4G13960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025812 AT1G80960 "AT1G80960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2081157 AT3G59200 "AT3G59200" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2151261 AT5G02930 "AT5G02930" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| Sb02g002773.1 | hypothetical protein (256 aa) | |||||||
(Sorghum bicolor) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 285 | |||
| pfam00646 | 48 | pfam00646, F-box, F-box domain | 3e-04 | |
| pfam12937 | 47 | pfam12937, F-box-like, F-box-like | 4e-04 |
| >gnl|CDD|201368 pfam00646, F-box, F-box domain | Back alignment and domain information |
|---|
Score = 37.6 bits (88), Expect = 3e-04
Identities = 17/38 (44%), Positives = 24/38 (63%)
Query: 3 DRISKLPDDILICILSRLTIEEAARASILSYRWRYLWR 40
+ LPDD+L+ ILSRL ++ R S++S RWR L
Sbjct: 1 FSLLDLPDDLLLEILSRLDPKDLLRLSLVSKRWRSLVD 38
|
This domain is approximately 50 amino acids long, and is usually found in the N-terminal half of a variety of proteins. Two motifs that are commonly found associated with the F-box domain are the leucine rich repeats (LRRs; pfam00560 and pfam07723) and the WD repeat (pfam00400). The F-box domain has a role in mediating protein-protein interactions in a variety of contexts, such as polyubiquitination, transcription elongation, centromere binding and translational repression. Length = 48 |
| >gnl|CDD|221867 pfam12937, F-box-like, F-box-like | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.55 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.41 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 99.01 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 98.57 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.46 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.15 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.92 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 97.75 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.54 | |
| PF07723 | 26 | LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le | 97.49 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 97.49 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.34 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.32 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.27 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 97.27 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.26 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.24 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.2 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.03 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 96.95 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.89 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 96.48 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.4 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 95.93 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 95.72 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 95.18 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 95.13 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.04 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.65 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 94.63 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 94.53 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 94.51 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 94.48 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 94.41 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 94.28 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 93.87 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 93.48 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 92.93 | |
| KOG0274 | 537 | consensus Cdc4 and related F-box and WD-40 protein | 92.3 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 90.66 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 90.62 | |
| PF13013 | 109 | F-box-like_2: F-box-like domain | 89.99 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 89.65 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 84.64 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 84.32 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 84.29 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 82.7 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 82.22 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 81.59 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 81.45 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 81.06 |
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.55 E-value=1.5e-16 Score=129.92 Aligned_cols=249 Identities=24% Similarity=0.256 Sum_probs=147.1
Q ss_pred CCCCChHHHHHHHhcCChhhHhhhcccccchhh------hccccCCceeecCccchhcccc--cCCCcccccchhhhhhh
Q 023267 5 ISKLPDDILICILSRLTIEEAARASILSYRWRY------LWRFFTGSLDFVDPYKIRRLAI--LSDPYYKCEDNYFIRVK 76 (285)
Q Consensus 5 is~LPd~iL~~Ils~L~~~d~~~~s~vs~rW~~------lw~~~~~~l~f~~~~~~~~~~~--~~~~~~~~~~~~~~~~~ 76 (285)
+..|||||+..||+.|+-+|+.+++.|||||++ +|. .++..+..+.|..-. ..+-. ..++..
T Consensus 98 ~~slpDEill~IFs~L~kk~LL~~~~VC~Rfyr~~~de~lW~----~lDl~~r~i~p~~l~~l~~rgV------~v~Rla 167 (419)
T KOG2120|consen 98 WDSLPDEILLGIFSCLCKKELLKVSGVCKRFYRLASDESLWQ----TLDLTGRNIHPDVLGRLLSRGV------IVFRLA 167 (419)
T ss_pred cccCCHHHHHHHHHhccHHHHHHHHHHHHHHhhcccccccee----eeccCCCccChhHHHHHHhCCe------EEEEcc
Confidence 468999999999999999999999999999986 577 666666644432100 00000 000000
Q ss_pred --hhhHHHhHHHHHhccCCCCCceEEEEeeCCCcccHHHHHHHHHh-CCceEEEEEecCCCCCCCceeecCcccc-CCCC
Q 023267 77 --RRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFAVD-KRVQRLELDFSESKTEGHELHTFSPYFK-TTSS 152 (285)
Q Consensus 77 --~~~~~~~v~~~L~~~~~~~l~~l~l~~~~~~~~~~~~wl~~~~~-~~v~~L~l~~~~~~~~~~~~~~~p~~~~-~~~~ 152 (285)
..+-.+++..+.-.+ .+++.+.++-... .+......... ..++.+.+.... +..... ..+.
T Consensus 168 r~~~~~prlae~~~~fr--sRlq~lDLS~s~i---t~stl~~iLs~C~kLk~lSlEg~~----------LdD~I~~~iAk 232 (419)
T KOG2120|consen 168 RSFMDQPRLAEHFSPFR--SRLQHLDLSNSVI---TVSTLHGILSQCSKLKNLSLEGLR----------LDDPIVNTIAK 232 (419)
T ss_pred hhhhcCchhhhhhhhhh--hhhHHhhcchhhe---eHHHHHHHHHHHHhhhhccccccc----------cCcHHHHHHhc
Confidence 000001111111000 1233444432221 11222222222 244445444221 111110 1123
Q ss_pred CCCccEEEeeeEE-eChhHHHHHHhcCCccceeecccCCCcce---EEEeCCCCceeEEEEecCCC-C-----CeEEEeC
Q 023267 153 FSSLVSLRLIDVD-IPEEVLHYLLCYCPLLEVLTLKGAEKLIR---IRVSGPSLKLKYLELRDLPN-L-----SNLEINA 222 (285)
Q Consensus 153 ~~~L~~L~L~~~~-i~~~~l~~ll~~cp~Le~L~L~~c~~~~~---~~i~~~~~~L~~L~i~~c~~-l-----~~l~i~~ 222 (285)
=.+|+.|+|+.+. |+..++.-+++.|..|.+|+|.+|...++ ..|.+-++++..|.++||.. + ..+...|
T Consensus 233 N~~L~~lnlsm~sG~t~n~~~ll~~scs~L~~LNlsWc~l~~~~Vtv~V~hise~l~~LNlsG~rrnl~~sh~~tL~~rc 312 (419)
T KOG2120|consen 233 NSNLVRLNLSMCSGFTENALQLLLSSCSRLDELNLSWCFLFTEKVTVAVAHISETLTQLNLSGYRRNLQKSHLSTLVRRC 312 (419)
T ss_pred cccceeeccccccccchhHHHHHHHhhhhHhhcCchHhhccchhhhHHHhhhchhhhhhhhhhhHhhhhhhHHHHHHHhC
Confidence 3689999999988 99999999999999999999999976554 35566778899999999853 2 2233478
Q ss_pred CCceEEEEeccee-----eeeecCCCceEEEEEEccccchhhhHHhhhhcCCCcceEEEEEEE
Q 023267 223 PNLVSFEFSAGEL-----IVSFKHVPSLVEMSIEGDYCTYFVYTLHQFSSFLPQLRTLKLNLM 280 (285)
Q Consensus 223 p~L~~l~~~~~~~-----~~~~~~~~~L~~l~l~~~~~~~~~~~~~~ll~~~~~L~~L~L~~~ 280 (285)
|+|..|+++++.. ...+-..+.|+.+.++.+. ... ....-.+...|.|..|++..+
T Consensus 313 p~l~~LDLSD~v~l~~~~~~~~~kf~~L~~lSlsRCY-~i~-p~~~~~l~s~psl~yLdv~g~ 373 (419)
T KOG2120|consen 313 PNLVHLDLSDSVMLKNDCFQEFFKFNYLQHLSLSRCY-DII-PETLLELNSKPSLVYLDVFGC 373 (419)
T ss_pred CceeeeccccccccCchHHHHHHhcchheeeehhhhc-CCC-hHHeeeeccCcceEEEEeccc
Confidence 9999999987653 1234467899999998633 222 233333578888888887643
|
|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PF13013 F-box-like_2: F-box-like domain | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 285 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-07 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 4e-06 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 9e-05 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 1e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 51.4 bits (123), Expect = 1e-07
Identities = 48/240 (20%), Positives = 76/240 (31%), Gaps = 39/240 (16%)
Query: 5 ISKLPDDILICILSRLTIEEAARASILSYRWR------YLWRFFTGSLDFVDPYKIRRLA 58
LPD++L+ I S L + E + S + RW LW+ + + P RL
Sbjct: 9 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLL 68
Query: 59 ILSDPYYKCEDNYFIRVKRRNFINLVDPILGLLQTKSLQQLRICYPVNSDYDVDSWVQFA 118
+ R + P+ +Q + + V + +
Sbjct: 69 SQG-----------VIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQC 117
Query: 119 VDKRVQRLELDFSESKTEGHELHTFSPYFKTTSSFSSLVSLRLIDVD-IPEEVLHYLLCY 177
++Q L L+ T + S+LV L L E L LL
Sbjct: 118 --SKLQNLSLEGLRLSDPI---------VNTLAKNSNLVRLNLSGCSGFSEFALQTLLSS 166
Query: 178 CPLLEVLTLKGAEKL----IRIRVSGPSLKLKYLELRDLPN------LSNLEINAPNLVS 227
C L+ L L +++ V+ S + L L LS L PNLV
Sbjct: 167 CSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVH 226
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Length = 53 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.78 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.74 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.69 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 99.01 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.48 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 98.46 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.34 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 98.34 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 98.31 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.23 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.17 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.16 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 98.1 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 98.01 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.99 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.98 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.95 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.89 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.87 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.87 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.86 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.83 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.79 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.78 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.78 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.76 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.76 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.75 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.74 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.73 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.72 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.72 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.7 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.67 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.66 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.66 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.63 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.62 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.61 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.59 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.59 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.58 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.57 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.51 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.5 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.49 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.49 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.49 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.49 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.49 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.48 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.48 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.47 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.44 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.44 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.41 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.39 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.39 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.38 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.38 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.38 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.37 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 97.37 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.36 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.36 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.34 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.34 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 97.33 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.31 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.29 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.27 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.27 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.27 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.27 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.23 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 97.23 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.22 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 97.2 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.2 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.19 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.18 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.17 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.17 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.17 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.15 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.15 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.13 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.13 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.12 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.09 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.07 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.07 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.05 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.03 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.02 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.02 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.0 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.0 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.0 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 96.96 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 96.96 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.96 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 96.93 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 96.91 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 96.9 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.83 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 96.82 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.76 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.72 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.7 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 96.68 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.68 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.65 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 96.63 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 96.59 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 96.55 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 96.5 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 96.46 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.36 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 96.26 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 96.24 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.23 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.13 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 95.77 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 95.71 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 95.67 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 95.62 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 95.46 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 95.3 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 95.16 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.15 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 95.13 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 95.12 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 95.08 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 95.05 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 94.69 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 94.46 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 93.89 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 93.78 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 93.73 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 93.36 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 93.13 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 92.84 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 92.62 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 92.53 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 89.69 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 87.25 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 86.24 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 84.86 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 84.35 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 83.84 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 83.19 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 80.62 |
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
Probab=99.78 E-value=4.5e-19 Score=164.08 Aligned_cols=151 Identities=13% Similarity=0.206 Sum_probs=90.3
Q ss_pred CCcCCCCChHHHHHHHhcCC-hhhHhhhcccccchhhhccccCCceeecCccchhcccccCCCcccccchhhhhhhhhhH
Q 023267 2 DDRISKLPDDILICILSRLT-IEEAARASILSYRWRYLWRFFTGSLDFVDPYKIRRLAILSDPYYKCEDNYFIRVKRRNF 80 (285)
Q Consensus 2 ~D~is~LPd~iL~~Ils~L~-~~d~~~~s~vs~rW~~lw~~~~~~l~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (285)
+|+++.||||||.+||+||+ .+|+++++.|||||+++.......+++...+..
T Consensus 3 ~d~~~~LPdevL~~If~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~~~~~-------------------------- 56 (594)
T 2p1m_B 3 KRIALSFPEEVLEHVFSFIQLDKDRNSVSLVCKSWYEIERWCRRKVFIGNCYAV-------------------------- 56 (594)
T ss_dssp -------CHHHHHHHHHTCCCHHHHHHHHTSCHHHHHHHHHHCCEEEESSTTSS--------------------------
T ss_pred ccchhhCCHHHHHHHHhhcCCchhHHHHHHHHHHHHHhhhhhceEEeecccccc--------------------------
Confidence 49999999999999999999 999999999999999873312334444332100
Q ss_pred HHhHHHHHhccCCCCCceEEEEeeCCC----------cccHHHHHHHHHh--CCceEEEEEecCCCCCCCceeecCcccc
Q 023267 81 INLVDPILGLLQTKSLQQLRICYPVNS----------DYDVDSWVQFAVD--KRVQRLELDFSESKTEGHELHTFSPYFK 148 (285)
Q Consensus 81 ~~~v~~~L~~~~~~~l~~l~l~~~~~~----------~~~~~~wl~~~~~--~~v~~L~l~~~~~~~~~~~~~~~p~~~~ 148 (285)
.....+... +.++++.+...... ...+..|+..... +++++|.+..+.-. ...+..+
T Consensus 57 --~~~~~~~~~--~~L~~L~L~~~~~~~~~~l~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~~~------~~~~~~l- 125 (594)
T 2p1m_B 57 --SPATVIRRF--PKVRSVELKGKPHFADFNLVPDGWGGYVYPWIEAMSSSYTWLEEIRLKRMVVT------DDCLELI- 125 (594)
T ss_dssp --CHHHHHHHC--TTCCEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCC------HHHHHHH-
T ss_pred --CHHHHHhhC--CCceEEeccCCCchhhcccccccccchhhHHHHHHHHhCCCCCeEEeeCcEEc------HHHHHHH-
Confidence 001122222 24777887764311 0345567776654 68888888744211 0000111
Q ss_pred CCCCCCCccEEEeeeE-EeChhHHHHHHhcCCccceeecccCC
Q 023267 149 TTSSFSSLVSLRLIDV-DIPEEVLHYLLCYCPLLEVLTLKGAE 190 (285)
Q Consensus 149 ~~~~~~~L~~L~L~~~-~i~~~~l~~ll~~cp~Le~L~L~~c~ 190 (285)
...|++|++|+|.++ .+++.++..+..+||+|++|+|.+|.
T Consensus 126 -~~~~~~L~~L~L~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~ 167 (594)
T 2p1m_B 126 -AKSFKNFKVLVLSSCEGFSTDGLAAIAATCRNLKELDLRESD 167 (594)
T ss_dssp -HHHCTTCCEEEEESCEEEEHHHHHHHHHHCTTCCEEECTTCE
T ss_pred -HHhCCCCcEEeCCCcCCCCHHHHHHHHHhCCCCCEEeCcCCc
Confidence 013678888888877 47777777777788888888887764
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 285 | ||||
| d1nexb1 | 100 | a.158.1.1 (B:270-369) Cdc4 F-box and linker domain | 1e-06 | |
| d2ovrb1 | 102 | a.158.1.1 (B:2263-2364) F-box/WD repeat-containing | 1e-05 | |
| d1fs1a1 | 41 | a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [ | 6e-04 |
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Cdc4 F-box and linker domains species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 43.9 bits (103), Expect = 1e-06
Identities = 21/90 (23%), Positives = 33/90 (36%), Gaps = 10/90 (11%)
Query: 3 DRISKLPDDILICILSRLTIEEAARASILSYRWRY-------LWRFFTGSLDFVDPYKIR 55
D I+ LP +I + I + L E+ + +S W LW+ S +FV P
Sbjct: 4 DLITSLPFEISLKIFNYLQFEDIINSLGVSQNWNKIIRKSTSLWKKLLISENFVSPKGFN 63
Query: 56 RLAILSDPYYK---CEDNYFIRVKRRNFIN 82
L + Y +D + FI
Sbjct: 64 SLNLKLSQKYPKLSQQDRLRLSFLENIFIL 93
|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 285 | |||
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.98 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.93 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.8 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 98.79 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.64 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.08 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.71 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.66 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.57 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.55 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.31 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.08 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.07 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.01 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 96.95 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.81 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 96.79 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 96.56 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.52 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.38 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.95 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 95.91 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 95.82 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 95.4 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 95.13 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 95.04 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 94.92 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 94.62 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 94.51 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 94.41 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 94.05 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 93.82 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 92.76 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 89.84 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 89.71 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 88.64 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 87.96 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 86.43 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 85.06 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 84.07 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 83.68 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 83.21 |
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: F-box domain superfamily: F-box domain family: F-box domain domain: Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.26 E-value=1.3e-12 Score=74.21 Aligned_cols=36 Identities=33% Similarity=0.503 Sum_probs=33.5
Q ss_pred CCCCChHHHHHHHhcCChhhHhhhcccccchhhhcc
Q 023267 5 ISKLPDDILICILSRLTIEEAARASILSYRWRYLWR 40 (285)
Q Consensus 5 is~LPd~iL~~Ils~L~~~d~~~~s~vs~rW~~lw~ 40 (285)
++.||+||+.+||+||+.+|+++++.|||+|+++-.
T Consensus 1 f~~LP~eil~~If~~L~~~dl~~~~~Vcr~w~~l~~ 36 (41)
T d1fs1a1 1 WDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLAS 36 (41)
T ss_dssp CCSSCHHHHHHHHTTSCGGGHHHHHTTCHHHHHHHT
T ss_pred CCcCCHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhC
Confidence 478999999999999999999999999999998754
|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|