Citrus Sinensis ID: 023338
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| 224137810 | 307 | predicted protein [Populus trichocarpa] | 0.982 | 0.905 | 0.685 | 1e-102 | |
| 225441918 | 276 | PREDICTED: probable calcium-binding prot | 0.932 | 0.956 | 0.671 | 1e-102 | |
| 296087059 | 314 | unnamed protein product [Vitis vinifera] | 0.851 | 0.767 | 0.665 | 1e-100 | |
| 346703263 | 302 | hypothetical_protein [Oryza brachyantha] | 0.805 | 0.754 | 0.748 | 1e-98 | |
| 115484099 | 308 | Os11g0140600 [Oryza sativa Japonica Grou | 0.837 | 0.769 | 0.718 | 4e-98 | |
| 449449801 | 290 | PREDICTED: probable calcium-binding prot | 0.975 | 0.951 | 0.676 | 1e-96 | |
| 115487238 | 292 | Os12g0137100 [Oryza sativa Japonica Grou | 0.791 | 0.767 | 0.707 | 2e-96 | |
| 255587064 | 266 | ef-hand calcium binding protein, putativ | 0.819 | 0.872 | 0.761 | 3e-96 | |
| 222616606 | 263 | hypothetical protein OsJ_35159 [Oryza sa | 0.795 | 0.855 | 0.697 | 5e-96 | |
| 224086944 | 263 | predicted protein [Populus trichocarpa] | 0.833 | 0.897 | 0.730 | 5e-96 |
| >gi|224137810|ref|XP_002322657.1| predicted protein [Populus trichocarpa] gi|118481712|gb|ABK92796.1| unknown [Populus trichocarpa] gi|222867287|gb|EEF04418.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 378 bits (971), Expect = e-102, Method: Compositional matrix adjust.
Identities = 214/312 (68%), Positives = 240/312 (76%), Gaps = 34/312 (10%)
Query: 1 MSGYPQPP--------PGYGYGSAQPPSSQGYASHHGGPPSSQPYSAQYG-APPTAQPY- 50
MSGYPQ P P S S+Q Y+S +G PP QP SA YG AP PY
Sbjct: 1 MSGYPQQPAGYGYGQGPPPPQQSQPYGSAQPYSSAYGAPP--QP-SAPYGTAPQPTAPYG 57
Query: 51 SAQYGAP----PTAQPYGARPHAAP--SAPSYGGPSAAP------------ASAPGGYPP 92
SAQ+ AP A PYG+ HAAP +A +YG P AAP S PGGYPP
Sbjct: 58 SAQHAAPYGTAQQAAPYGSSQHAAPYGTAQAYGSPYAAPPPGTKPPKDKPQGSTPGGYPP 117
Query: 93 APGSYGN-PFASLMPSTFPPGTDPNIVACFQLADRDNSGLIDDKELQGALSSYNQSFSLR 151
AP YG+ PFA+L+PSTFPPGTDP+IVACFQ+AD+D SG+IDDKELQ ALS YNQSFSLR
Sbjct: 118 AP--YGSSPFAALLPSTFPPGTDPSIVACFQVADQDGSGIIDDKELQRALSGYNQSFSLR 175
Query: 152 TVRLLMYTFTNTNARKIGPKEFIQVFHSLQNWRAMFEKVDRDRSGKIDSNELREALMSLG 211
TV LLMY FTN+NARKIGPKEF ++F+SLQNWRA+FE+ DRDRSG+ID NELREAL+SLG
Sbjct: 176 TVHLLMYLFTNSNARKIGPKEFTELFYSLQNWRAIFERFDRDRSGRIDINELREALLSLG 235
Query: 212 FAVSPVVLDLLVTKFDKTGGKSKAIEYDNFIECCLTVKGLTEKFKERDTTYSGSATFTYE 271
F+VSPVVLDLLV+KFDKTGGK+KAIEYDNFIECCLTVKGLTEKFKERDT YSGSA+FTYE
Sbjct: 236 FSVSPVVLDLLVSKFDKTGGKNKAIEYDNFIECCLTVKGLTEKFKERDTAYSGSASFTYE 295
Query: 272 NFMLAVLPFLIA 283
NFMLAVLPFLIA
Sbjct: 296 NFMLAVLPFLIA 307
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225441918|ref|XP_002284505.1| PREDICTED: probable calcium-binding protein CML49 [Vitis vinifera] gi|308194329|gb|ADO16596.1| EF-hand calcium-binding protein [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|296087059|emb|CBI33386.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|346703263|emb|CBX25361.1| hypothetical_protein [Oryza brachyantha] | Back alignment and taxonomy information |
|---|
| >gi|115484099|ref|NP_001065711.1| Os11g0140600 [Oryza sativa Japonica Group] gi|77548608|gb|ABA91405.1| EF hand family protein, expressed [Oryza sativa Japonica Group] gi|113644415|dbj|BAF27556.1| Os11g0140600 [Oryza sativa Japonica Group] gi|215737137|dbj|BAG96066.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|449449801|ref|XP_004142653.1| PREDICTED: probable calcium-binding protein CML49-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|115487238|ref|NP_001066106.1| Os12g0137100 [Oryza sativa Japonica Group] gi|77552964|gb|ABA95760.1| EF hand family protein, expressed [Oryza sativa Japonica Group] gi|113648613|dbj|BAF29125.1| Os12g0137100 [Oryza sativa Japonica Group] gi|125535715|gb|EAY82203.1| hypothetical protein OsI_37406 [Oryza sativa Indica Group] gi|215765243|dbj|BAG86940.1| unnamed protein product [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|255587064|ref|XP_002534120.1| ef-hand calcium binding protein, putative [Ricinus communis] gi|223525823|gb|EEF28264.1| ef-hand calcium binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|222616606|gb|EEE52738.1| hypothetical protein OsJ_35159 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
| >gi|224086944|ref|XP_002308014.1| predicted protein [Populus trichocarpa] gi|222853990|gb|EEE91537.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 283 | ||||||
| TAIR|locus:2146703 | 354 | AT5G04170 [Arabidopsis thalian | 0.890 | 0.711 | 0.629 | 1.9e-87 | |
| TAIR|locus:2076229 | 335 | AT3G10300 [Arabidopsis thalian | 0.901 | 0.761 | 0.624 | 6.4e-83 | |
| TAIR|locus:2038653 | 228 | AT2G27480 [Arabidopsis thalian | 0.611 | 0.758 | 0.448 | 1.3e-36 | |
| ZFIN|ZDB-GENE-040801-259 | 270 | pef1 "penta-EF-hand domain con | 0.607 | 0.637 | 0.344 | 1.3e-34 | |
| MGI|MGI:1915148 | 275 | Pef1 "penta-EF hand domain con | 0.579 | 0.596 | 0.373 | 3e-31 | |
| RGD|1359536 | 283 | Pef1 "penta-EF hand domain con | 0.579 | 0.579 | 0.367 | 2.6e-30 | |
| UNIPROTKB|Q641Z8 | 283 | Pef1 "Peflin" [Rattus norvegic | 0.579 | 0.579 | 0.367 | 2.6e-30 | |
| UNIPROTKB|H9KZ63 | 272 | PEF1 "Uncharacterized protein" | 0.628 | 0.654 | 0.331 | 6.8e-30 | |
| UNIPROTKB|Q9UBV8 | 284 | PEF1 "Peflin" [Homo sapiens (t | 0.579 | 0.577 | 0.355 | 1.8e-29 | |
| UNIPROTKB|F1Q385 | 279 | PEF1 "Uncharacterized protein" | 0.579 | 0.587 | 0.349 | 5.9e-29 |
| TAIR|locus:2146703 AT5G04170 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 818 (293.0 bits), Expect = 1.9e-87, Sum P(2) = 1.9e-87
Identities = 168/267 (62%), Positives = 193/267 (72%)
Query: 31 PPSSQPYSAQYGAPPTA--QPYSAQYGAPPT-AQP------YGARP-HXXXXXXXXXXX- 79
PP +PY YGAPP + Y + YGA P +QP YGA P H
Sbjct: 89 PPKEKPYGGGYGAPPPSGSSDYGS-YGAGPRPSQPSGHGGGYGATPPHGVSDYGSYGGAP 147
Query: 80 ---XXXXXXXXXXXXXXXXXXXNPFASLMPSTFPPGTDPNIVACFQLADRDNSGLIDDKE 136
+PFASL+PS F PGTDPNIVACFQ AD+D SG IDDKE
Sbjct: 148 PRPASSGHGGGYGGYPPQASYGSPFASLIPSGFAPGTDPNIVACFQAADQDGSGFIDDKE 207
Query: 137 LQGALSSYNQSFSLRTVRLLMYTFTNTNARKIGPKEFIQVFHSLQNWRAMFEKVDRDRSG 196
LQGALSSY Q FS+RTV LLMY FTN+NA KIGPKEF +F+SLQNWR++FE+ D+DRSG
Sbjct: 208 LQGALSSYQQRFSMRTVHLLMYLFTNSNAMKIGPKEFTALFYSLQNWRSIFERSDKDRSG 267
Query: 197 KIDSNELREALMSLGFAVSPVVLDLLVTKFDKTGGKSKAIEYDNFIECCLTVKGLTEKFK 256
+ID NELR+AL+SLGF+VSPVVLDLLV+KFDK+GGK++AIEYDNFIECCLTVKGLTEKFK
Sbjct: 268 RIDVNELRDALLSLGFSVSPVVLDLLVSKFDKSGGKNRAIEYDNFIECCLTVKGLTEKFK 327
Query: 257 ERDTTYSGSATFTYENFMLAVLPFLIA 283
E+DT YSGSATF YE+FML VLPFLIA
Sbjct: 328 EKDTAYSGSATFNYESFMLTVLPFLIA 354
|
|
| TAIR|locus:2076229 AT3G10300 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2038653 AT2G27480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040801-259 pef1 "penta-EF-hand domain containing 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1915148 Pef1 "penta-EF hand domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1359536 Pef1 "penta-EF hand domain containing 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q641Z8 Pef1 "Peflin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H9KZ63 PEF1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UBV8 PEF1 "Peflin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q385 PEF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| COG5126 | 160 | COG5126, FRQ1, Ca2+-binding protein (EF-Hand super | 4e-15 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 6e-10 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 7e-09 | |
| pfam00036 | 29 | pfam00036, efhand, EF hand | 2e-07 | |
| smart00054 | 29 | smart00054, EFh, EF-hand, calcium binding motif | 4e-07 | |
| pfam13405 | 30 | pfam13405, EF_hand_4, EF-hand domain | 5e-07 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 9e-07 | |
| PTZ00183 | 158 | PTZ00183, PTZ00183, centrin; Provisional | 2e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 4e-05 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-05 | |
| pfam13202 | 25 | pfam13202, EF_hand_3, EF hand | 5e-05 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 1e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 1e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 1e-04 | |
| COG5126 | 160 | COG5126, FRQ1, Ca2+-binding protein (EF-Hand super | 2e-04 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 3e-04 | |
| PTZ00183 | 158 | PTZ00183, PTZ00183, centrin; Provisional | 4e-04 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 4e-04 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 4e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 5e-04 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 7e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 8e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 9e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.001 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.001 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 0.001 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| pfam13202 | 25 | pfam13202, EF_hand_3, EF hand | 0.002 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.002 | |
| PTZ00184 | 149 | PTZ00184, PTZ00184, calmodulin; Provisional | 0.002 | |
| PRK12270 | 1228 | PRK12270, kgd, alpha-ketoglutarate decarboxylase; | 0.003 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.003 | |
| pfam04487 | 206 | pfam04487, CITED, CITED | 0.003 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 0.003 | |
| pfam13405 | 30 | pfam13405, EF_hand_4, EF-hand domain | 0.004 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.004 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 0.004 |
| >gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
Score = 70.8 bits (174), Expect = 4e-15
Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 12/134 (8%)
Query: 121 FQLADRDNSGLIDDKELQGALSSYNQSFSLRTVRLLMYTFTNTNARKIGPKEFIQV---- 176
FQL DRD+ GLID EL L S + S + L + + EF+ V
Sbjct: 26 FQLFDRDSDGLIDRNELGKILRSLGFNPSEAEINKLFEEI-DAGNETVDFPEFLTVMSVK 84
Query: 177 ---FHSLQNWRAMFEKVDRDRSGKIDSNELREALMSLGFAVSPVVLDLLVTKFDKTG-GK 232
+ R F+ D+D G I ELR L SLG +S ++ L+ ++D+ G G+
Sbjct: 85 LKRGDKEEELREAFKLFDKDHDGYISIGELRRVLKSLGERLSDEEVEKLLKEYDEDGDGE 144
Query: 233 SKAIEYDNFIECCL 246
I+Y+ F +
Sbjct: 145 ---IDYEEFKKLIK 155
|
Length = 160 |
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >gnl|CDD|200946 pfam00036, efhand, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|205383 pfam13202, EF_hand_3, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185503 PTZ00183, PTZ00183, centrin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|205383 pfam13202, EF_hand_3, EF hand | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218108 pfam04487, CITED, CITED | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205583 pfam13405, EF_hand_4, EF-hand domain | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 100.0 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.93 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.91 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 99.89 | |
| PTZ00183 | 158 | centrin; Provisional | 99.84 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 99.83 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.83 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 99.82 | |
| KOG0037 | 221 | consensus Ca2+-binding protein, EF-Hand protein su | 99.74 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 99.7 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 99.68 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.67 | |
| KOG0044 | 193 | consensus Ca2+ sensor (EF-Hand superfamily) [Signa | 99.48 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 99.46 | |
| PTZ00183 | 158 | centrin; Provisional | 99.45 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 99.44 | |
| PTZ00184 | 149 | calmodulin; Provisional | 99.43 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 99.39 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 99.37 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 99.37 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 99.33 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 99.33 | |
| KOG4223 | 325 | consensus Reticulocalbin, calumenin, DNA supercoil | 99.3 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 99.26 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 99.23 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 99.2 | |
| KOG0031 | 171 | consensus Myosin regulatory light chain, EF-Hand p | 99.2 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 99.2 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 99.18 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 99.15 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 99.15 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 99.14 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 99.14 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 99.13 | |
| KOG0030 | 152 | consensus Myosin essential light chain, EF-Hand pr | 99.12 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 99.1 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 99.08 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 99.07 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.06 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 99.04 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 99.04 | |
| KOG0034 | 187 | consensus Ca2+/calmodulin-dependent protein phosph | 99.03 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 99.02 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 99.0 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.99 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 98.97 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.97 | |
| KOG0036 | 463 | consensus Predicted mitochondrial carrier protein | 98.97 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.96 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 98.95 | |
| PLN02964 | 644 | phosphatidylserine decarboxylase | 98.94 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 98.94 | |
| KOG1924 | 1102 | consensus RhoA GTPase effector DIA/Diaphanous [Sig | 98.91 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.9 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.9 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 98.87 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 98.87 | |
| KOG0751 | 694 | consensus Mitochondrial aspartate/glutamate carrie | 98.84 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 98.82 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.81 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 98.8 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 98.76 | |
| KOG2643 | 489 | consensus Ca2+ binding protein, contains EF-hand m | 98.74 | |
| PF14658 | 66 | EF-hand_9: EF-hand domain | 98.73 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.72 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 98.72 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 98.69 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 98.68 | |
| KOG0041 | 244 | consensus Predicted Ca2+-binding protein, EF-Hand | 98.64 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 98.59 | |
| cd05030 | 88 | calgranulins Calgranulins: S-100 domain found in p | 98.58 | |
| KOG2562 | 493 | consensus Protein phosphatase 2 regulatory subunit | 98.51 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 98.46 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.46 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 98.44 | |
| cd05024 | 91 | S-100A10 S-100A10: A subgroup of the S-100A10 doma | 98.42 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 98.36 | |
| KOG0377 | 631 | consensus Protein serine/threonine phosphatase RDG | 98.31 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 98.29 | |
| KOG4251 | 362 | consensus Calcium binding protein [General functio | 98.26 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 98.26 | |
| PF13405 | 31 | EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J | 98.24 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 98.14 | |
| PF12763 | 104 | EF-hand_4: Cytoskeletal-regulatory complex EF hand | 98.13 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 98.13 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 98.12 | |
| PF14788 | 51 | EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA | 98.12 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 98.08 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 98.0 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 97.94 | |
| PRK12309 | 391 | transaldolase/EF-hand domain-containing protein; P | 97.92 | |
| PF13202 | 25 | EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ | 97.91 | |
| KOG0040 | 2399 | consensus Ca2+-binding actin-bundling protein (spe | 97.89 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 97.85 | |
| KOG0038 | 189 | consensus Ca2+-binding kinase interacting protein | 97.71 | |
| KOG4666 | 412 | consensus Predicted phosphate acyltransferase, con | 97.56 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 97.47 | |
| KOG0169 | 746 | consensus Phosphoinositide-specific phospholipase | 97.47 | |
| PF10591 | 113 | SPARC_Ca_bdg: Secreted protein acidic and rich in | 97.42 | |
| KOG0046 | 627 | consensus Ca2+-binding actin-bundling protein (fim | 97.26 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 97.05 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 96.89 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 96.87 | |
| smart00054 | 29 | EFh EF-hand, calcium binding motif. EF-hands are c | 96.84 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 96.8 | |
| KOG0035 | 890 | consensus Ca2+-binding actin-bundling protein (act | 96.8 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 96.71 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 96.63 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 96.58 | |
| PF09279 | 83 | EF-hand_like: Phosphoinositide-specific phospholip | 96.37 | |
| KOG1029 | 1118 | consensus Endocytic adaptor protein intersectin [S | 96.34 | |
| KOG4065 | 144 | consensus Uncharacterized conserved protein [Funct | 96.21 | |
| KOG2243 | 5019 | consensus Ca2+ release channel (ryanodine receptor | 96.16 | |
| KOG3555 | 434 | consensus Ca2+-binding proteoglycan Testican [Gene | 96.07 | |
| PF05517 | 154 | p25-alpha: p25-alpha ; InterPro: IPR008907 This fa | 95.8 | |
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 95.66 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 95.63 | |
| KOG1265 | 1189 | consensus Phospholipase C [Lipid transport and met | 95.58 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 95.52 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 95.42 | |
| PF05517 | 154 | p25-alpha: p25-alpha ; InterPro: IPR008907 This fa | 95.37 | |
| KOG3866 | 442 | consensus DNA-binding protein of the nucleobindin | 95.15 | |
| KOG4347 | 671 | consensus GTPase-activating protein VRP [General f | 94.81 | |
| KOG0819 | 321 | consensus Annexin [Intracellular trafficking, secr | 94.8 | |
| KOG1955 | 737 | consensus Ral-GTPase effector RALBP1 [Intracellula | 94.55 | |
| KOG0998 | 847 | consensus Synaptic vesicle protein EHS-1 and relat | 94.08 | |
| PF05042 | 174 | Caleosin: Caleosin related protein; InterPro: IPR0 | 94.01 | |
| KOG4578 | 421 | consensus Uncharacterized conserved protein, conta | 93.96 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 93.93 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 93.58 | |
| KOG1707 | 625 | consensus Predicted Ras related/Rac-GTP binding pr | 93.58 | |
| PF09069 | 90 | EF-hand_3: EF-hand; InterPro: IPR015154 Like other | 93.0 | |
| PF09069 | 90 | EF-hand_3: EF-hand; InterPro: IPR015154 Like other | 93.0 | |
| KOG4849 | 498 | consensus mRNA cleavage factor I subunit/CPSF subu | 92.99 | |
| KOG0819 | 321 | consensus Annexin [Intracellular trafficking, secr | 92.7 | |
| PF08726 | 69 | EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr | 92.55 | |
| KOG3866 | 442 | consensus DNA-binding protein of the nucleobindin | 92.25 | |
| PF11116 | 85 | DUF2624: Protein of unknown function (DUF2624); In | 92.12 | |
| KOG0035 | 890 | consensus Ca2+-binding actin-bundling protein (act | 92.11 | |
| KOG0042 | 680 | consensus Glycerol-3-phosphate dehydrogenase [Ener | 92.1 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 91.91 | |
| KOG3449 | 112 | consensus 60S acidic ribosomal protein P2 [Transla | 91.89 | |
| KOG4578 | 421 | consensus Uncharacterized conserved protein, conta | 91.75 | |
| KOG4347 | 671 | consensus GTPase-activating protein VRP [General f | 91.34 | |
| KOG4286 | 966 | consensus Dystrophin-like protein [Cell motility; | 91.15 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 90.95 | |
| PRK09430 | 267 | djlA Dna-J like membrane chaperone protein; Provis | 90.26 | |
| TIGR01639 | 61 | P_fal_TIGR01639 Plasmodium falciparum uncharacteri | 89.83 | |
| PF12486 | 148 | DUF3702: ImpA domain protein ; InterPro: IPR021069 | 89.54 | |
| KOG1923 | 830 | consensus Rac1 GTPase effector FRL [Signal transdu | 89.34 | |
| cd07313 | 104 | terB_like_2 tellurium resistance terB-like protein | 89.28 | |
| PF09068 | 127 | EF-hand_2: EF hand; InterPro: IPR015153 Like other | 88.03 | |
| PF13929 | 292 | mRNA_stabil: mRNA stabilisation | 87.71 | |
| PF14513 | 138 | DAG_kinase_N: Diacylglycerol kinase N-terminus; PD | 87.59 | |
| KOG1264 | 1267 | consensus Phospholipase C [Lipid transport and met | 86.84 | |
| KOG4301 | 434 | consensus Beta-dystrobrevin [Cytoskeleton] | 86.49 | |
| COG2818 | 188 | Tag 3-methyladenine DNA glycosylase [DNA replicati | 86.43 | |
| PF06511 | 337 | IpaD: Invasion plasmid antigen IpaD; InterPro: IPR | 86.18 | |
| PRK15330 | 343 | cell invasion protein SipD; Provisional | 85.88 | |
| KOG3077 | 260 | consensus Uncharacterized conserved protein [Funct | 85.81 | |
| TIGR02553 | 308 | SipD_IpaD_SspD type III effector protein IpaD/SipD | 85.76 | |
| KOG2243 | 5019 | consensus Ca2+ release channel (ryanodine receptor | 85.68 | |
| PF12995 | 186 | DUF3879: Domain of unknown function, E. rectale Ge | 85.42 | |
| cd08315 | 96 | Death_TRAILR_DR4_DR5 Death domain of Tumor necrosi | 85.31 | |
| COG2818 | 188 | Tag 3-methyladenine DNA glycosylase [DNA replicati | 84.79 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 84.74 | |
| PF08414 | 100 | NADPH_Ox: Respiratory burst NADPH oxidase; InterPr | 84.68 | |
| PTZ00373 | 112 | 60S Acidic ribosomal protein P2; Provisional | 84.54 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 84.37 | |
| PTZ00373 | 112 | 60S Acidic ribosomal protein P2; Provisional | 84.04 | |
| PF12174 | 70 | RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: I | 83.84 | |
| PF12207 | 162 | DUF3600: Domain of unknown function (DUF3600); Int | 83.56 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 83.55 | |
| COG4807 | 155 | Uncharacterized protein conserved in bacteria [Fun | 83.46 | |
| KOG3449 | 112 | consensus 60S acidic ribosomal protein P2 [Transla | 83.01 | |
| PF14513 | 138 | DAG_kinase_N: Diacylglycerol kinase N-terminus; PD | 82.86 | |
| KOG0869 | 168 | consensus CCAAT-binding factor, subunit A (HAP3) [ | 82.57 | |
| cd07313 | 104 | terB_like_2 tellurium resistance terB-like protein | 82.06 | |
| KOG0871 | 156 | consensus Class 2 transcription repressor NC2, bet | 81.68 | |
| KOG1925 | 817 | consensus Rac1 GTPase effector FHOS [Signal transd | 81.46 | |
| PF05099 | 140 | TerB: Tellurite resistance protein TerB; InterPro: | 81.46 | |
| COG4359 | 220 | Uncharacterized conserved protein [Function unknow | 81.43 | |
| PRK03968 | 399 | DNA primase large subunit; Validated | 81.08 | |
| cd04411 | 105 | Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and | 80.87 | |
| cd05833 | 109 | Ribosomal_P2 Ribosomal protein P2. This subfamily | 80.45 | |
| TIGR01848 | 107 | PHA_reg_PhaR polyhydroxyalkanoate synthesis repres | 80.36 | |
| COG2058 | 109 | RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Tr | 80.11 |
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.2e-34 Score=218.93 Aligned_cols=166 Identities=45% Similarity=0.776 Sum_probs=158.1
Q ss_pred CchhHHHHHHHHccCCCCccCHHHHHHHHHhc-CccCCHHHHHHHHHHhcCCCCCccCHHHHHHHHHhHHHHHHHHHHhc
Q 023338 113 TDPNIVACFQLADRDNSGLIDDKELQGALSSY-NQSFSLRTVRLLMYTFTNTNARKIGPKEFIQVFHSLQNWRAMFEKVD 191 (283)
Q Consensus 113 ~~~~l~~~F~~~d~d~~g~i~~~el~~~l~~~-~~~~~~~~~~~l~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~f~~~D 191 (283)
+..++..+|..+|+|+++.|+.+||..+|... ...++.++|+.|+.++|.+.+|.|+++||+.+|+.++.|+.+|+.||
T Consensus 55 ~~~~~~~~f~~vD~d~sg~i~~~eLq~aLsn~~~~~Fs~~TcrlmI~mfd~~~~G~i~f~EF~~Lw~~i~~Wr~vF~~~D 134 (221)
T KOG0037|consen 55 TFPQLAGWFQSVDRDRSGRILAKELQQALSNGTWSPFSIETCRLMISMFDRDNSGTIGFKEFKALWKYINQWRNVFRTYD 134 (221)
T ss_pred ccHHHHHHHHhhCccccccccHHHHHHHhhcCCCCCCCHHHHHHHHHHhcCCCCCccCHHHHHHHHHHHHHHHHHHHhcc
Confidence 55789999999999999999999999999854 56789999999999999999999999999999999999999999999
Q ss_pred cCCCCccCHHHHHHHHHHcCCCCCHHHHHHHHHHHhhCCCCCCcccHHHHHHHHHHHHHHHHHhhhcCCCCCceeeeeHH
Q 023338 192 RDRSGKIDSNELREALMSLGFAVSPVVLDLLVTKFDKTGGKSKAIEYDNFIECCLTVKGLTEKFKERDTTYSGSATFTYE 271 (283)
Q Consensus 192 ~~~~G~i~~~el~~~l~~l~~~~~~~~i~~l~~~~d~~~d~~g~i~~~eF~~~~~~~~~~~~~f~~~d~~~~g~i~~~~~ 271 (283)
+|++|.|+..||+.+|..+|++++.+.++.|+++++... +|+|.|++|+.+|..+.++.++|+++|.+..|.|+++++
T Consensus 135 ~D~SG~I~~sEL~~Al~~~Gy~Lspq~~~~lv~kyd~~~--~g~i~FD~FI~ccv~L~~lt~~Fr~~D~~q~G~i~~~y~ 212 (221)
T KOG0037|consen 135 RDRSGTIDSSELRQALTQLGYRLSPQFYNLLVRKYDRFG--GGRIDFDDFIQCCVVLQRLTEAFRRRDTAQQGSITISYD 212 (221)
T ss_pred cCCCCcccHHHHHHHHHHcCcCCCHHHHHHHHHHhcccc--CCceeHHHHHHHHHHHHHHHHHHHHhccccceeEEEeHH
Confidence 999999999999999999999999999999999999775 389999999999999999999999999999999999999
Q ss_pred HHHHHhccc
Q 023338 272 NFMLAVLPF 280 (283)
Q Consensus 272 ~~~~~~~~~ 280 (283)
+|+.+++.+
T Consensus 213 dfl~~t~~~ 221 (221)
T KOG0037|consen 213 DFLQMTMSI 221 (221)
T ss_pred HHHHHhhcC
Confidence 999998863
|
|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
| >PLN02964 phosphatidylserine decarboxylase | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >KOG1924 consensus RhoA GTPase effector DIA/Diaphanous [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0751 consensus Mitochondrial aspartate/glutamate carrier protein Aralar/Citrin (contains EF-hand Ca2+-binding domains) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF14658 EF-hand_9: EF-hand domain | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 | Back alignment and domain information |
|---|
| >KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG4251 consensus Calcium binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK12309 transaldolase/EF-hand domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A | Back alignment and domain information |
|---|
| >KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0169 consensus Phosphoinositide-specific phospholipase C [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins | Back alignment and domain information |
|---|
| >KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >smart00054 EFh EF-hand, calcium binding motif | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C | Back alignment and domain information |
|---|
| >KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4065 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only] | Back alignment and domain information |
|---|
| >PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] | Back alignment and domain information |
|---|
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1265 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] | Back alignment and domain information |
|---|
| >KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4347 consensus GTPase-activating protein VRP [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0998 consensus Synaptic vesicle protein EHS-1 and related EH domain proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin | Back alignment and domain information |
|---|
| >KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions | Back alignment and domain information |
|---|
| >PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions | Back alignment and domain information |
|---|
| >KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0819 consensus Annexin [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes | Back alignment and domain information |
|---|
| >KOG3866 consensus DNA-binding protein of the nucleobindin family [General function prediction only] | Back alignment and domain information |
|---|
| >PF11116 DUF2624: Protein of unknown function (DUF2624); InterPro: IPR020277 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >KOG0035 consensus Ca2+-binding actin-bundling protein (actinin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG3449 consensus 60S acidic ribosomal protein P2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4347 consensus GTPase-activating protein VRP [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4286 consensus Dystrophin-like protein [Cell motility; Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09430 djlA Dna-J like membrane chaperone protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01639 P_fal_TIGR01639 Plasmodium falciparum uncharacterized domain TIGR01639 | Back alignment and domain information |
|---|
| >PF12486 DUF3702: ImpA domain protein ; InterPro: IPR021069 This entry represents a conserved region located towards the C-terminal end of ImpA and related proteins | Back alignment and domain information |
|---|
| >KOG1923 consensus Rac1 GTPase effector FRL [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd07313 terB_like_2 tellurium resistance terB-like protein, subgroup 2 | Back alignment and domain information |
|---|
| >PF09068 EF-hand_2: EF hand; InterPro: IPR015153 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions | Back alignment and domain information |
|---|
| >PF13929 mRNA_stabil: mRNA stabilisation | Back alignment and domain information |
|---|
| >PF14513 DAG_kinase_N: Diacylglycerol kinase N-terminus; PDB: 1TUZ_A | Back alignment and domain information |
|---|
| >KOG1264 consensus Phospholipase C [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4301 consensus Beta-dystrobrevin [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG2818 Tag 3-methyladenine DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF06511 IpaD: Invasion plasmid antigen IpaD; InterPro: IPR009483 This family consists of several invasion plasmid antigen IpaD proteins | Back alignment and domain information |
|---|
| >PRK15330 cell invasion protein SipD; Provisional | Back alignment and domain information |
|---|
| >KOG3077 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02553 SipD_IpaD_SspD type III effector protein IpaD/SipD/SspD | Back alignment and domain information |
|---|
| >KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12995 DUF3879: Domain of unknown function, E | Back alignment and domain information |
|---|
| >cd08315 Death_TRAILR_DR4_DR5 Death domain of Tumor necrosis factor-Related Apoptosis-Inducing Ligand Receptors | Back alignment and domain information |
|---|
| >COG2818 Tag 3-methyladenine DNA glycosylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF08414 NADPH_Ox: Respiratory burst NADPH oxidase; InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism | Back alignment and domain information |
|---|
| >PTZ00373 60S Acidic ribosomal protein P2; Provisional | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PTZ00373 60S Acidic ribosomal protein P2; Provisional | Back alignment and domain information |
|---|
| >PF12174 RST: RCD1-SRO-TAF4 (RST) plant domain; InterPro: IPR022003 This domain is found in many plant proteins including SROs and RCD1s; it is required for interaction with multiple plant transcription factors | Back alignment and domain information |
|---|
| >PF12207 DUF3600: Domain of unknown function (DUF3600); InterPro: IPR022019 This family of proteins is found in bacteria | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >COG4807 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG3449 consensus 60S acidic ribosomal protein P2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF14513 DAG_kinase_N: Diacylglycerol kinase N-terminus; PDB: 1TUZ_A | Back alignment and domain information |
|---|
| >KOG0869 consensus CCAAT-binding factor, subunit A (HAP3) [Transcription] | Back alignment and domain information |
|---|
| >cd07313 terB_like_2 tellurium resistance terB-like protein, subgroup 2 | Back alignment and domain information |
|---|
| >KOG0871 consensus Class 2 transcription repressor NC2, beta subunit (Dr1) [Transcription] | Back alignment and domain information |
|---|
| >KOG1925 consensus Rac1 GTPase effector FHOS [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF05099 TerB: Tellurite resistance protein TerB; InterPro: IPR007791 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] | Back alignment and domain information |
|---|
| >COG4359 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK03968 DNA primase large subunit; Validated | Back alignment and domain information |
|---|
| >cd04411 Ribosomal_P1_P2_L12p Ribosomal protein P1, P2, and L12p | Back alignment and domain information |
|---|
| >cd05833 Ribosomal_P2 Ribosomal protein P2 | Back alignment and domain information |
|---|
| >TIGR01848 PHA_reg_PhaR polyhydroxyalkanoate synthesis repressor PhaR | Back alignment and domain information |
|---|
| >COG2058 RPP1A Ribosomal protein L12E/L44/L45/RPP1/RPP2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 283 | ||||
| 1hqv_A | 191 | Structure Of Apoptosis-Linked Protein Alg-2 Length | 2e-24 | ||
| 2zn8_A | 190 | Crystal Structure Of Zn2+-Bound Form Of Alg-2 Lengt | 2e-24 | ||
| 2zn9_A | 172 | Crystal Structure Of Ca2+-bound Form Of Des3-20alg- | 2e-24 | ||
| 2zne_A | 169 | Crystal Structure Of Zn2+-Bound Form Of Des3-23alg- | 3e-24 | ||
| 2zrs_A | 168 | Crystal Structure Of Ca2+-Bound Form Of Des3-23alg- | 3e-24 | ||
| 3aak_A | 172 | Crystal Structure Of Zn2+-Bound Form Of Des3-20alg- | 4e-24 | ||
| 3aaj_A | 167 | Crystal Structure Of Ca2+-Bound Form Of Des3-23alg- | 9e-23 | ||
| 2jc2_A | 198 | The Crystal Structure Of The Natural F112l Human So | 1e-21 | ||
| 1juo_A | 198 | Crystal Structure Of Calcium-Free Human Sorcin: A M | 3e-21 | ||
| 1gjy_A | 167 | The X-Ray Structure Of The Sorcin Calcium Binding D | 1e-20 | ||
| 1f4o_A | 165 | Crystal Structure Of Grancalcin With Bound Calcium | 2e-20 | ||
| 1k95_A | 165 | Crystal Structure Of Des(1-52)grancalcin With Bound | 2e-20 | ||
| 1y1x_A | 191 | Structural Analysis Of A Homolog Of Programmed Cell | 9e-18 | ||
| 1kfx_L | 699 | Crystal Structure Of Human M-Calpain Form I Length | 1e-11 | ||
| 1df0_A | 700 | Crystal Structure Of M-Calpain Length = 700 | 1e-11 | ||
| 1u5i_A | 700 | Crystal Structure Analysis Of Rat M-Calpain Mutant | 1e-11 | ||
| 3df0_A | 714 | Calcium-Dependent Complex Between M-Calpain And Cal | 1e-11 | ||
| 1alw_A | 173 | Inhibitor And Calcium Bound Domain Vi Of Porcine Ca | 3e-11 | ||
| 1df0_B | 184 | Crystal Structure Of M-Calpain Length = 184 | 4e-11 | ||
| 1aj5_A | 173 | Calpain Domain Vi Apo Length = 173 | 5e-11 | ||
| 1dvi_A | 184 | Calpain Domain Vi With Calcium Bound Length = 184 | 6e-11 | ||
| 1qxp_A | 900 | Crystal Structure Of A Mu-Like Calpain Length = 900 | 7e-11 | ||
| 1kfx_S | 184 | Crystal Structure Of Human M-Calpain Form I Length | 2e-10 | ||
| 1np8_A | 159 | 18-K C-Terminally Trunucated Small Subunit Of Calpa | 2e-10 | ||
| 2bl0_B | 145 | Physarum Polycephalum Myosin Ii Regulatory Domain L | 6e-06 | ||
| 2joj_A | 77 | Nmr Solution Structure Of N-Terminal Domain Of Eupl | 5e-05 | ||
| 3sib_A | 220 | Crystal Structure Of Ure3-Binding Protein, Wild-Typ | 3e-04 |
| >pdb|1HQV|A Chain A, Structure Of Apoptosis-Linked Protein Alg-2 Length = 191 | Back alignment and structure |
|
| >pdb|2ZN8|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Alg-2 Length = 190 | Back alignment and structure |
| >pdb|2ZN9|A Chain A, Crystal Structure Of Ca2+-bound Form Of Des3-20alg-2 Length = 172 | Back alignment and structure |
| >pdb|2ZNE|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Des3-23alg-2 Complexed With Alix Abs Peptide Length = 169 | Back alignment and structure |
| >pdb|2ZRS|A Chain A, Crystal Structure Of Ca2+-Bound Form Of Des3-23alg-2 Length = 168 | Back alignment and structure |
| >pdb|3AAK|A Chain A, Crystal Structure Of Zn2+-Bound Form Of Des3-20alg-2f122a Length = 172 | Back alignment and structure |
| >pdb|3AAJ|A Chain A, Crystal Structure Of Ca2+-Bound Form Of Des3-23alg-2deltagf122 Length = 167 | Back alignment and structure |
| >pdb|2JC2|A Chain A, The Crystal Structure Of The Natural F112l Human Sorcin Mutant Length = 198 | Back alignment and structure |
| >pdb|1JUO|A Chain A, Crystal Structure Of Calcium-Free Human Sorcin: A Member Of The Penta-Ef-Hand Protein Family Length = 198 | Back alignment and structure |
| >pdb|1GJY|A Chain A, The X-Ray Structure Of The Sorcin Calcium Binding Domain (Scbd) Provides Insight Into The Phosphorylation And Calcium Dependent Processess Length = 167 | Back alignment and structure |
| >pdb|1F4O|A Chain A, Crystal Structure Of Grancalcin With Bound Calcium Length = 165 | Back alignment and structure |
| >pdb|1K95|A Chain A, Crystal Structure Of Des(1-52)grancalcin With Bound Calcium Length = 165 | Back alignment and structure |
| >pdb|1Y1X|A Chain A, Structural Analysis Of A Homolog Of Programmed Cell Death 6 Protein From Leishmania Major Friedlin Length = 191 | Back alignment and structure |
| >pdb|1KFX|L Chain L, Crystal Structure Of Human M-Calpain Form I Length = 699 | Back alignment and structure |
| >pdb|1DF0|A Chain A, Crystal Structure Of M-Calpain Length = 700 | Back alignment and structure |
| >pdb|1U5I|A Chain A, Crystal Structure Analysis Of Rat M-Calpain Mutant Lys10 Thr Length = 700 | Back alignment and structure |
| >pdb|3DF0|A Chain A, Calcium-Dependent Complex Between M-Calpain And Calpastatin Length = 714 | Back alignment and structure |
| >pdb|1ALW|A Chain A, Inhibitor And Calcium Bound Domain Vi Of Porcine Calpain Length = 173 | Back alignment and structure |
| >pdb|1DF0|B Chain B, Crystal Structure Of M-Calpain Length = 184 | Back alignment and structure |
| >pdb|1AJ5|A Chain A, Calpain Domain Vi Apo Length = 173 | Back alignment and structure |
| >pdb|1DVI|A Chain A, Calpain Domain Vi With Calcium Bound Length = 184 | Back alignment and structure |
| >pdb|1QXP|A Chain A, Crystal Structure Of A Mu-Like Calpain Length = 900 | Back alignment and structure |
| >pdb|1KFX|S Chain S, Crystal Structure Of Human M-Calpain Form I Length = 184 | Back alignment and structure |
| >pdb|1NP8|A Chain A, 18-K C-Terminally Trunucated Small Subunit Of Calpain Length = 159 | Back alignment and structure |
| >pdb|2BL0|B Chain B, Physarum Polycephalum Myosin Ii Regulatory Domain Length = 145 | Back alignment and structure |
| >pdb|2JOJ|A Chain A, Nmr Solution Structure Of N-Terminal Domain Of Euplotes Octocarinatus Centrin Length = 77 | Back alignment and structure |
| >pdb|3SIB|A Chain A, Crystal Structure Of Ure3-Binding Protein, Wild-Type Length = 220 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 283 | |||
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 7e-70 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 2e-64 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 9e-63 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 2e-13 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 8e-60 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 2e-57 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 7e-57 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 2e-54 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 1e-43 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 2e-40 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 1e-36 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 3e-36 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 4e-31 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 1e-21 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 1e-14 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 4e-07 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 3e-15 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 3e-07 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 7e-04 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 5e-15 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 1e-10 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 2e-14 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 2e-08 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 7e-14 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 1e-06 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 9e-05 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 2e-13 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 6e-13 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 3e-08 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 3e-13 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 3e-10 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 3e-13 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 2e-10 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 2e-04 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 6e-13 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 2e-09 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 2e-04 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 6e-13 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 5e-10 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 1e-04 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 7e-13 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 2e-10 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 7e-05 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 9e-13 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 5e-09 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 1e-12 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 1e-09 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 3e-04 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 1e-12 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 3e-08 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 1e-12 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 3e-09 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 3e-04 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 1e-12 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 4e-04 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-12 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 4e-07 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 2e-04 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 2e-12 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 9e-07 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 1e-05 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 3e-12 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 4e-08 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 3e-05 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 3e-12 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 7e-07 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 4e-12 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 2e-09 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 7e-05 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 4e-12 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 2e-09 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 4e-12 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 2e-10 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 5e-07 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 5e-12 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 3e-10 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 5e-12 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 8e-09 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 6e-12 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 6e-10 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 1e-04 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 6e-12 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 1e-04 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 7e-12 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 3e-09 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 3e-04 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 8e-12 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 3e-08 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 1e-04 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 1e-11 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 3e-06 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 2e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-11 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 9e-08 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-07 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 2e-11 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 4e-08 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 7e-06 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 3e-11 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 4e-07 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 4e-11 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 2e-08 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 4e-11 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 2e-09 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 4e-11 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 8e-10 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 8e-04 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 4e-11 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 8e-09 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 5e-11 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 7e-05 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 6e-11 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 8e-08 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 6e-11 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 2e-09 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 6e-11 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 7e-11 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 8e-07 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 3e-04 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 8e-11 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 2e-09 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 3e-05 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 9e-11 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 5e-07 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 2e-04 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 1e-10 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 1e-04 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 1e-10 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 9e-08 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 1e-04 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 1e-10 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 2e-06 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 3e-05 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 2e-10 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 3e-07 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 2e-10 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 3e-05 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 3e-10 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 3e-09 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 4e-10 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 3e-07 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 9e-05 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 4e-10 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 5e-05 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 4e-10 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 8e-06 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 4e-05 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 5e-10 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 3e-04 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 6e-10 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 6e-10 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 2e-06 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 1e-09 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 1e-09 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 9e-08 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 1e-09 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 1e-09 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 8e-06 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 2e-09 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 1e-04 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 2e-09 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 2e-04 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 2e-09 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 3e-09 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 1e-05 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 3e-05 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 3e-09 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 3e-09 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 3e-09 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 1e-04 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 4e-09 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 3e-06 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 4e-09 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 4e-09 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 2e-08 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 7e-09 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 1e-04 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 7e-09 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 9e-09 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 2e-08 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 3e-06 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 3e-08 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 4e-08 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 1e-06 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 4e-08 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 6e-08 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 4e-05 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 7e-08 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 5e-05 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 7e-08 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 1e-06 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 1e-07 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 3e-04 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 1e-07 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 2e-07 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 2e-07 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 8e-06 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 2e-07 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 4e-06 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 3e-07 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 2e-06 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 3e-07 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 3e-04 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 4e-07 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 3e-06 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 4e-07 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 5e-07 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 3e-05 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 8e-07 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 2e-05 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 9e-07 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 2e-06 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 1e-06 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 2e-06 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 1e-06 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-06 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 6e-06 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 1e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 3e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 4e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 5e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 6e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 8e-05 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 3e-04 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 4e-04 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 2e-06 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 3e-05 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 6e-06 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 9e-06 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 3e-05 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 3e-05 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 7e-04 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 1e-05 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 1e-04 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 1e-05 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 2e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 4e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 9e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 3e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 6e-04 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 4e-05 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 6e-05 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 7e-05 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 2e-04 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 2e-04 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 4e-04 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-04 |
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 | Back alignment and structure |
|---|
Score = 213 bits (544), Expect = 7e-70
Identities = 58/196 (29%), Positives = 92/196 (46%), Gaps = 6/196 (3%)
Query: 86 APGGYPPAPGSYGNPFASLMPSTFPPGTDPNIVACFQLADRDNSGLIDDKELQGALSSYN 145
A + P S G PS + ++ F+ D D SG I EL ALSS
Sbjct: 2 AHHHHHHMPTSTGVY----APSARHMNDNQELMEWFRAVDTDGSGAISVPELNAALSSAG 57
Query: 146 QSFSLRTVRLLMYTFTNTNARKIGPKEFIQVFHSLQNWRAMFEKVDRDRSGKIDSNELRE 205
FSL T L++ + ++ +I EF + H + + R F K D G++DSNE+R
Sbjct: 58 VPFSLATTEKLLHMYDKNHSGEITFDEFKDLHHFILSMREGFRKRDSSGDGRLDSNEVRA 117
Query: 206 ALMSLGFAVSPVVLDLLVTKFDKTGGKSKAIEYDNFIECCLTVKGLTEKFKERDTTYSGS 265
AL+S G+ VS L+ KFD+ ++ +D+++E + V + F D +G
Sbjct: 118 ALLSSGYQVSEQTFQALMRKFDRQR--RGSLGFDDYVELSIFVCRVRNVFAFYDRERTGQ 175
Query: 266 ATFTYENFMLAVLPFL 281
TFT++ F+ + L
Sbjct: 176 VTFTFDTFIGGSVSIL 191
|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Length = 174 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.97 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.97 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.97 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.97 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.96 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.96 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.96 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.96 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.93 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.93 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.93 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.92 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.92 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.92 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.92 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.91 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.91 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.9 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.9 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.9 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.9 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.9 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.9 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.9 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.9 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.9 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.89 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.89 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.89 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.89 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.89 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.89 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.88 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.88 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.88 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.88 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.88 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.88 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.88 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.88 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.88 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.88 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.88 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 99.88 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.88 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.87 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.87 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.87 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.87 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.87 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.87 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.87 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.87 | |
| 1qxp_A | 900 | MU-like calpain; M-calpain, MU-calpain, catalytic | 99.86 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.86 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.86 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.86 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.86 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.86 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.86 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.86 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.86 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 99.86 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.85 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.85 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.85 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.85 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.85 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.85 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.85 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.84 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.84 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.84 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.84 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 99.84 | |
| 2d8n_A | 207 | Recoverin; structural genomics, NPPSFA, national p | 99.83 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.83 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 99.83 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.82 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.82 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.82 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.82 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.82 | |
| 2f33_A | 263 | Calbindin; EF-hand, Ca2+-binding, metal binding pr | 99.81 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 99.81 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.81 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 99.8 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.8 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 99.79 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.79 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 99.79 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 99.79 | |
| 1fpw_A | 190 | Yeast frequenin, calcium-binding protein NCS-1; EF | 99.78 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 99.75 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 99.75 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 99.75 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.75 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 99.75 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.73 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.72 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.72 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.71 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.7 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.7 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 99.69 | |
| 1jba_A | 204 | GCAP-2, protein (guanylate cyclase activating prot | 99.69 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.68 | |
| 2r2i_A | 198 | Guanylyl cyclase-activating protein 1; EF hand, GC | 99.67 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 99.66 | |
| 2ehb_A | 207 | Calcineurin B-like protein 4; protein complex, Ca( | 99.66 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.66 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 99.65 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.65 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 99.65 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 99.63 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 99.63 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.63 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.62 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 99.61 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 99.61 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 99.61 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 99.6 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 99.6 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 99.6 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.59 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 99.59 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 99.58 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 99.58 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 99.58 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 99.57 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 99.57 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 99.57 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 99.56 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 99.56 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 99.56 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 99.56 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 99.56 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 99.56 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 99.56 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 99.56 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.55 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 99.55 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.55 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 99.55 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 99.54 | |
| 3sg6_A | 450 | Gcamp2, myosin light chain kinase, green fluoresce | 99.54 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 99.54 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 99.54 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 99.54 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 99.53 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 99.53 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 99.53 | |
| 1s6i_A | 188 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.53 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.53 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 99.52 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 99.52 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 99.51 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 99.51 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 99.51 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 99.51 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 99.51 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 99.5 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 99.5 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.5 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 99.5 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.49 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 99.49 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.48 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 99.48 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 99.47 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 99.47 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.47 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 99.46 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 99.46 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 99.46 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 99.44 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 99.43 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 99.43 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 99.42 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 99.42 | |
| 3bow_A | 714 | Calpain-2 catalytic subunit; cysteine protease, in | 99.41 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 99.4 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 99.39 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.39 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 99.38 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 99.37 | |
| 2hps_A | 186 | Coelenterazine-binding protein with bound coelent; | 99.37 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 99.37 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 99.37 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 99.36 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 99.36 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 99.36 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 99.35 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 99.35 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 99.34 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 99.33 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 99.33 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 99.33 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.33 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 99.32 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.32 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 99.32 | |
| 1sjj_A | 863 | Actinin; 3-helix bundle, calponin homology domain, | 99.32 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 99.31 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 99.3 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 99.3 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 99.3 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 99.3 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 99.3 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 99.29 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 99.29 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 99.29 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 99.29 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 99.28 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 99.28 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.28 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 99.28 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.28 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 99.28 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 99.28 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 99.27 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 99.27 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 99.27 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 99.27 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.26 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 99.26 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 99.26 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.26 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 99.25 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 99.25 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 99.25 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 99.24 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.24 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 99.24 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 99.24 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.24 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 99.24 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 99.23 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 99.23 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 99.23 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 99.23 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 99.23 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 99.22 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 99.22 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 99.22 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 99.22 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 99.22 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.22 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 99.21 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 99.21 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.21 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 99.2 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 99.2 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 99.2 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 99.2 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 99.2 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 99.2 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 99.19 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 99.19 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 99.19 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.19 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 99.19 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 99.18 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 99.18 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 99.18 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 99.18 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.17 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 99.16 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 99.16 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 99.15 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 99.15 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 99.15 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 99.15 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 99.15 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 99.15 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 99.15 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 99.14 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 99.14 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 99.14 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 99.14 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 99.13 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 99.13 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 99.13 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 99.13 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 99.12 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 99.11 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 99.1 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 99.1 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 99.09 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 99.08 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 99.08 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 99.08 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 99.08 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 99.07 | |
| 1eg3_A | 261 | Dystrophin; EF-hand like domain, WW domain, struct | 99.06 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 99.05 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 99.05 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 99.04 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 99.03 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 99.01 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.0 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 98.99 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 98.95 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 98.92 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 98.91 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.86 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 98.85 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 98.75 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 98.54 | |
| 2kld_A | 123 | Polycystin-2; PC2, PKD2, calcium binding domain, E | 98.43 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 98.36 | |
| 1sra_A | 151 | Sparc; extracellular matrix protein, calcium-bindi | 98.22 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 97.87 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 97.77 | |
| 1nub_A | 229 | Basement membrane protein BM-40; extracellular mod | 97.67 | |
| 1tuz_A | 118 | Diacylglycerol kinase alpha; transferase, HR532, n | 97.51 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 96.95 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 96.66 | |
| 2qpt_A | 550 | EH domain-containing protein-2; protein-nucleotide | 96.62 | |
| 4gba_A | 221 | DCN1-like protein 3; E3 ligase, ligase-peptide com | 96.52 | |
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 96.47 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 96.23 | |
| 3kev_A | 199 | Galieria sulfuraria DCUN1 domain-containing prote; | 96.17 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 96.1 | |
| 1pul_A | 125 | Hypothetical protein C32E8.3 in chromosome I; alph | 96.01 | |
| 3tdu_A | 200 | DCN1-like protein 1; E2:E3, ligase-protein binding | 95.96 | |
| 2jrf_A | 184 | Tubulin polymerization-promoting protein family me | 95.84 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 95.81 | |
| 1wlm_A | 151 | Protein CGI-38; structural genomics, NPPSFA, natio | 95.78 | |
| 4gba_A | 221 | DCN1-like protein 3; E3 ligase, ligase-peptide com | 95.77 | |
| 2jrf_A | 184 | Tubulin polymerization-promoting protein family me | 95.24 | |
| 2l5y_A | 150 | Stromal interaction molecule 2; EF-hand, SAM domai | 95.1 | |
| 1wlm_A | 151 | Protein CGI-38; structural genomics, NPPSFA, natio | 94.61 | |
| 2k60_A | 150 | Protein (stromal interaction molecule 1); EF-hand, | 94.23 | |
| 2k60_A | 150 | Protein (stromal interaction molecule 1); EF-hand, | 94.12 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 93.11 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 92.3 | |
| 4fl4_A | 88 | Glycoside hydrolase family 9; structural genomics, | 92.25 | |
| 3uo9_A | 534 | Glutaminase kidney isoform, mitochondrial; hydrola | 91.61 | |
| 3bux_B | 329 | E3 ubiquitin-protein ligase CBL; TKB, signal trans | 90.69 | |
| 4dh2_B | 82 | Dockerin type 1; cellulosome, cohesin, type I cohe | 90.14 | |
| 4fl4_A | 88 | Glycoside hydrolase family 9; structural genomics, | 90.12 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 89.51 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 88.17 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 87.82 | |
| 2ccl_B | 63 | Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d | 87.22 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 87.13 | |
| 2keb_A | 101 | DNA polymerase subunit alpha B; DNA polymerase alp | 86.89 | |
| 4dh2_B | 82 | Dockerin type 1; cellulosome, cohesin, type I cohe | 86.87 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 86.5 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 86.24 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 86.08 | |
| 3osj_A | 147 | Phycobilisome LCM core-membrane linker polypeptid; | 86.01 | |
| 3op0_A | 323 | Signal transduction protein CBL-C; structural geno | 84.76 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 84.57 | |
| 3fh3_A | 158 | Putative ECF-type sigma factor negative effector; | 83.64 | |
| 3uo9_A | 534 | Glutaminase kidney isoform, mitochondrial; hydrola | 83.63 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 83.24 | |
| 2y3n_B | 71 | Cellulosomal family-48 processive glycoside hydro; | 83.01 | |
| 2jg6_A | 186 | DNA-3-methyladenine glycosidase; 3-methyladenine-D | 82.97 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 82.67 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 82.49 | |
| 2y3n_B | 71 | Cellulosomal family-48 processive glycoside hydro; | 82.36 | |
| 3ohw_B | 148 | Phycobilisome LCM core-membrane linker polypeptid; | 82.21 | |
| 2j0o_A | 318 | Invasin IPAD; type III secretion, cell invasion, T | 81.94 | |
| 2vn6_B | 64 | Endoglucanase A; cell adhesion, carbohydrate metab | 81.89 | |
| 2ky4_A | 149 | Phycobilisome linker polypeptide; NESG, PSI, struc | 81.57 | |
| 2ccl_B | 63 | Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/d | 81.52 | |
| 3nhi_A | 296 | D7 protein; all helical, odorant-binding protein, | 81.46 | |
| 1jfi_B | 179 | DR1 protein, transcription regulator NC2 beta chai | 80.96 |
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
Probab=99.97 E-value=3.3e-30 Score=204.87 Aligned_cols=166 Identities=31% Similarity=0.510 Sum_probs=159.1
Q ss_pred chhHHHHHHHHccCCCCccCHHHHHHHHHhcCccCCHHHHHHHHHHhcCCCCCccCHHHHHHHHHhHHHHHHHHHHhccC
Q 023338 114 DPNIVACFQLADRDNSGLIDDKELQGALSSYNQSFSLRTVRLLMYTFTNTNARKIGPKEFIQVFHSLQNWRAMFEKVDRD 193 (283)
Q Consensus 114 ~~~l~~~F~~~d~d~~g~i~~~el~~~l~~~~~~~~~~~~~~l~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~f~~~D~~ 193 (283)
.++++++|+.+|+|++|.|+.+||+.+|..++..++.++++.+++.+|.+++|.|+++||+.++..+..++.+|+.+|.|
T Consensus 26 ~~~l~~~F~~~D~d~~G~I~~~El~~~l~~~~~~~~~~~~~~l~~~~D~d~dG~I~~~EF~~~~~~~~~~~~~F~~~D~d 105 (191)
T 1y1x_A 26 NQELMEWFRAVDTDGSGAISVPELNAALSSAGVPFSLATTEKLLHMYDKNHSGEITFDEFKDLHHFILSMREGFRKRDSS 105 (191)
T ss_dssp TSCHHHHHHHHCTTCSSSBCHHHHHHHHCBTTBCCCHHHHHHHHHHHCTTCSSSBCHHHHHHHHHHHHHHHHHHHHHCTT
T ss_pred HHHHHHHHHHHcCCCCCcCcHHHHHHHHHHcCCCCCHHHHHHHHHHhCCCCCCeEcHHHHHHHHHHHHHHHHHHHHhCCC
Confidence 47899999999999999999999999998888889999999999999999999999999999999999999999999999
Q ss_pred CCCccCHHHHHHHHHHcCCCCCHHHHHHHHHHHhhCCCCCCcccHHHHHHHHHHHHHHHHHhhhcCCCCCceeeeeHHHH
Q 023338 194 RSGKIDSNELREALMSLGFAVSPVVLDLLVTKFDKTGGKSKAIEYDNFIECCLTVKGLTEKFKERDTTYSGSATFTYENF 273 (283)
Q Consensus 194 ~~G~i~~~el~~~l~~l~~~~~~~~i~~l~~~~d~~~d~~g~i~~~eF~~~~~~~~~~~~~f~~~d~~~~g~i~~~~~~~ 273 (283)
++|.|+.+||+.+|..++..+++++++.+++.+|.+++ |.|+++||+.++..+..+..+|+.+|.+++|.|++++++|
T Consensus 106 ~~G~i~~~e~~~~l~~~g~~~~~~~~~~~~~~~D~d~d--g~i~~~eF~~~~~~~~~~~~~F~~~D~d~dG~i~~~~~eF 183 (191)
T 1y1x_A 106 GDGRLDSNEVRAALLSSGYQVSEQTFQALMRKFDRQRR--GSLGFDDYVELSIFVCRVRNVFAFYDRERTGQVTFTFDTF 183 (191)
T ss_dssp SSSCBCHHHHHHHHHTTSCCCCHHHHHHHHHHHCTTCS--SSBCHHHHHHHHHHHHHHHHHHHHHCTTCCSEEEEEHHHH
T ss_pred CCCeEcHHHHHHHHHHhCCCCCHHHHHHHHHHhCCCCC--CeEeHHHHHHHHHHHHHHHHHHHHhCcCCCceEEeeHHHH
Confidence 99999999999999999999999999999999999985 9999999999999999999999999999999999999999
Q ss_pred HHHhcccc
Q 023338 274 MLAVLPFL 281 (283)
Q Consensus 274 ~~~~~~~~ 281 (283)
+.+++.+|
T Consensus 184 ~~~~~~~~ 191 (191)
T 1y1x_A 184 IGGSVSIL 191 (191)
T ss_dssp HHHHHHHC
T ss_pred HHHHHhhC
Confidence 99998753
|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* | Back alignment and structure |
|---|
| >1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} | Back alignment and structure |
|---|
| >4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* | Back alignment and structure |
|---|
| >3kev_A Galieria sulfuraria DCUN1 domain-containing prote; cullin, neddylation, DCN-1, center for eukaryotic structural genomics, PSI; HET: CSO MSE; 1.30A {Galdieria sulphuraria} | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >3tdu_A DCN1-like protein 1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_A 4gao_A* | Back alignment and structure |
|---|
| >2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >4gba_A DCN1-like protein 3; E3 ligase, ligase-peptide complex; HET: AME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l5y_A Stromal interaction molecule 2; EF-hand, SAM domain, store OPE calcium entry, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k60_A Protein (stromal interaction molecule 1); EF-hand, SAM domain, EF-SAM, STIM1, store operated calcium entry regulator, SOCE; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A | Back alignment and structure |
|---|
| >4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A | Back alignment and structure |
|---|
| >3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* | Back alignment and structure |
|---|
| >3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* | Back alignment and structure |
|---|
| >4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A | Back alignment and structure |
|---|
| >2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A | Back alignment and structure |
|---|
| >2keb_A DNA polymerase subunit alpha B; DNA polymerase alpha, DNA replication, nucleus, phosphoprote binding protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dh2_B Dockerin type 1; cellulosome, cohesin, type I cohesin-dockerin, Pro protein interaction, cell adhesion; 1.75A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A | Back alignment and structure |
|---|
| >3osj_A Phycobilisome LCM core-membrane linker polypeptid; structural genomics, PSI-biology; 2.30A {Synechocystis SP} PDB: 2l06_A | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3fh3_A Putative ECF-type sigma factor negative effector; putative anti-sigma W factor, MCSG, PSI, structural genomics; HET: MSE; 2.10A {Bacillus anthracis str} PDB: 3fgg_A | Back alignment and structure |
|---|
| >3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A | Back alignment and structure |
|---|
| >2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} | Back alignment and structure |
|---|
| >2jg6_A DNA-3-methyladenine glycosidase; 3-methyladenine-DNA-glycosylase-I, hydrolase; 1.70A {Staphylococcus aureus} PDB: 4aia_A* 4ai5_A* 4ai4_A | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A | Back alignment and structure |
|---|
| >2y3n_B Cellulosomal family-48 processive glycoside hydro; structrual protein-hydrolase complex, cellulosome; 1.90A {Bacteroides cellulosolvens} | Back alignment and structure |
|---|
| >3ohw_B Phycobilisome LCM core-membrane linker polypeptid; structural genomics, PSI-biology; 2.70A {Synechocystis SP} | Back alignment and structure |
|---|
| >2j0o_A Invasin IPAD; type III secretion, cell invasion, T3SS, plasmid, virulence; 3.00A {Shigella flexneri} SCOP: a.250.1.1 | Back alignment and structure |
|---|
| >2vn6_B Endoglucanase A; cell adhesion, carbohydrate metabolism, polysaccharide degradation, hydrolase, glycosidase, cellulose degradation; 1.49A {Clostridium cellulolyticum} PDB: 2vn5_B | Back alignment and structure |
|---|
| >2ky4_A Phycobilisome linker polypeptide; NESG, PSI, structural genomics, protein structure initiative northeast structural genomics consortium; NMR {Nostoc SP} | Back alignment and structure |
|---|
| >2ccl_B Endo-1,4-beta-xylanase Y; cell adhesion, cohesin/dockerin complex, cellulosome, cohesi dockerin, scaffolding, cellulose degradation; 2.03A {Clostridium thermocellum} SCOP: a.139.1.1 PDB: 1ohz_B | Back alignment and structure |
|---|
| >3nhi_A D7 protein; all helical, odorant-binding protein, ligand-binding protein transport protein; HET: EAH; 1.43A {Anopheles stephensi} PDB: 3ngv_A* 3nht_A* | Back alignment and structure |
|---|
| >1jfi_B DR1 protein, transcription regulator NC2 beta chain; histone, H2A/H2B, tata-DNA, transcription initiation, NC2, negative cofactor, structural genomics, PSI; 2.62A {Homo sapiens} SCOP: a.22.1.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 283 | ||||
| d1k94a_ | 165 | a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta | 4e-42 | |
| d1qxpa2 | 188 | a.39.1.8 (A:515-702) Calpain large subunit, C-term | 2e-39 | |
| d1juoa_ | 172 | a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: | 2e-38 | |
| d1df0a1 | 186 | a.39.1.8 (A:515-700) Calpain large subunit, C-term | 2e-33 | |
| d1alva_ | 173 | a.39.1.8 (A:) Calpain small (regulatory) subunit ( | 2e-28 | |
| d1y1xa_ | 182 | a.39.1.8 (A:) Programmed cell death 6 protein-like | 3e-24 | |
| d1hqva_ | 181 | a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous | 7e-20 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 2e-16 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 1e-06 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 0.004 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 2e-16 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 4e-05 | |
| d1lkja_ | 146 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 0.001 | |
| d1w7jb1 | 139 | a.39.1.5 (B:11-149) Myosin Essential Chain {Human | 3e-15 | |
| d1w7jb1 | 139 | a.39.1.5 (B:11-149) Myosin Essential Chain {Human | 2e-05 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 5e-15 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 3e-06 | |
| d1exra_ | 146 | a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr | 2e-05 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 5e-13 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-04 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 1e-04 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 4e-11 | |
| d1bjfa_ | 181 | a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId | 4e-04 | |
| d1g8ia_ | 187 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 7e-11 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 2e-10 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 3e-07 | |
| d1s6ca_ | 178 | a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera | 3e-10 | |
| d1s6ca_ | 178 | a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera | 3e-06 | |
| d1wdcb_ | 142 | a.39.1.5 (B:) Myosin Essential Chain {Bay scallop | 4e-10 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 5e-10 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 8e-06 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 6e-10 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 6e-10 | |
| d1fpwa_ | 190 | a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 | 3e-04 | |
| d1ggwa_ | 140 | a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo | 9e-10 | |
| d1ggwa_ | 140 | a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharo | 7e-04 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 2e-09 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 1e-07 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 2e-09 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 2e-07 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 6e-07 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 3e-06 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 3e-09 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 3e-07 | |
| d1wdcc_ | 152 | a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop | 3e-09 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 4e-09 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 1e-06 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 4e-09 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 2e-04 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 4e-09 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 2e-08 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 4e-09 | |
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 7e-06 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 6e-09 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 2e-05 | |
| d1jfja_ | 134 | a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly | 9e-09 | |
| d1jfja_ | 134 | a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly | 4e-06 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 1e-08 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 1e-04 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 2e-08 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 7e-05 | |
| d1nyaa_ | 176 | a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth | 3e-04 | |
| d2scpa_ | 174 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 2e-08 | |
| d2scpa_ | 174 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 2e-04 | |
| d2scpa_ | 174 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 0.001 | |
| d1s6ia_ | 182 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 2e-08 | |
| d1s6ia_ | 182 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 2e-05 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 2e-08 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 5e-05 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 3e-08 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 2e-06 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 3e-08 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 2e-07 | |
| d2zfda1 | 183 | a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { | 3e-08 | |
| d2zfda1 | 183 | a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { | 1e-05 | |
| d2zfda1 | 183 | a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { | 4e-05 | |
| d1jbaa_ | 189 | a.39.1.5 (A:) Guanylate cyclase activating protein | 3e-08 | |
| d1jbaa_ | 189 | a.39.1.5 (A:) Guanylate cyclase activating protein | 6e-06 | |
| d1jbaa_ | 189 | a.39.1.5 (A:) Guanylate cyclase activating protein | 6e-05 | |
| d1omra_ | 201 | a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: | 7e-08 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 8e-08 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 0.001 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 8e-08 | |
| d1snla_ | 99 | a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo | 2e-06 | |
| d1m45a_ | 146 | a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye | 1e-07 | |
| d1m45a_ | 146 | a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye | 2e-07 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 1e-07 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 3e-06 | |
| d1uhka1 | 187 | a.39.1.5 (A:3-189) Calcium-regulated photoprotein | 2e-07 | |
| d1uhka1 | 187 | a.39.1.5 (A:3-189) Calcium-regulated photoprotein | 2e-04 | |
| d1uhka1 | 187 | a.39.1.5 (A:3-189) Calcium-regulated photoprotein | 0.001 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 4e-07 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 6e-04 | |
| d1qx2a_ | 76 | a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax | 5e-07 | |
| d1qx2a_ | 76 | a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax | 9e-05 | |
| d1cb1a_ | 78 | a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax | 7e-07 | |
| d1cb1a_ | 78 | a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax | 9e-04 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 9e-07 | |
| d1wrka1 | 82 | a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) | 1e-06 | |
| d1wrka1 | 82 | a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) | 4e-04 | |
| d2hf5a1 | 33 | a.39.1.5 (A:81-113) Troponin C {Human (Homo sapien | 2e-05 | |
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 2e-05 | |
| d1xo5a_ | 180 | a.39.1.5 (A:) Calcium- and integrin-binding protei | 1e-04 | |
| d1qv0a_ | 189 | a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr | 2e-05 | |
| d1qv0a_ | 189 | a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr | 4e-05 | |
| d1qv0a_ | 189 | a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr | 0.001 | |
| d2zkmx1 | 170 | a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human | 4e-05 | |
| d2sasa_ | 185 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 1e-04 | |
| d2sasa_ | 185 | a.39.1.5 (A:) Sarcoplasmic calcium-binding protein | 4e-04 | |
| d1wlza1 | 83 | a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H | 1e-04 | |
| d1wlza1 | 83 | a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H | 0.002 | |
| d1yuta1 | 98 | a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa | 3e-04 | |
| d1yuta1 | 98 | a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa | 3e-04 | |
| d1auib_ | 165 | a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch | 0.001 | |
| d1auib_ | 165 | a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch | 0.001 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 0.002 | |
| d1zfsa1 | 93 | a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no | 0.004 |
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Penta-EF-hand proteins domain: Grancalcin species: Human (Homo sapiens) [TaxId: 9606]
Score = 140 bits (354), Expect = 4e-42
Identities = 50/162 (30%), Positives = 91/162 (56%), Gaps = 11/162 (6%)
Query: 122 QLADRDNSGLIDDKELQGALSS-----YNQSFSLRTVRLLMYTFTNTNARKIGPKEFIQV 176
+A +D G +D +ELQ L+ FSL T R+++ + K+G F ++
Sbjct: 8 AVAGQD--GEVDAEELQRCLTQSGINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKEL 65
Query: 177 FHSLQNWRAMFEKVDRDRSGKIDSNELREALMSLGFAVSPVVLDLLVTKFDKTGGKSKAI 236
+ +L W+ F VD+D SG ++ +ELR+A+ +G+ +SP L +V ++ K G I
Sbjct: 66 WAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNG----RI 121
Query: 237 EYDNFIECCLTVKGLTEKFKERDTTYSGSATFTYENFMLAVL 278
+D+++ CC+ ++ LT+ F++RD GSA F Y++F+ +
Sbjct: 122 FFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTM 163
|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Length = 173 | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 142 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 140 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 185 | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 283 | |||
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.98 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.97 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.96 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.96 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.96 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.91 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.9 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.9 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.9 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.89 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.89 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.88 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.87 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.87 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.86 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.86 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.85 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.83 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.83 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.8 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.8 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.78 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.78 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 99.77 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.77 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.77 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.76 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 99.76 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 99.76 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 99.75 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 99.74 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.73 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.72 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 99.71 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.69 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 99.67 | |
| d1omra_ | 201 | Recoverin {Cow (Bos taurus) [TaxId: 9913]} | 99.67 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.65 | |
| d1jbaa_ | 189 | Guanylate cyclase activating protein 2, GCAP-2 {Co | 99.64 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 99.63 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.63 | |
| d1k94a_ | 165 | Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | 99.62 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.61 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.58 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 99.57 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 99.57 | |
| d1ij5a_ | 321 | Cbp40 (plasmodial specific CaII-binding protein LA | 99.57 | |
| d1qxpa2 | 188 | Calpain large subunit, C-terminal domain (domain I | 99.55 | |
| d1df0a1 | 186 | Calpain large subunit, C-terminal domain (domain I | 99.55 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 99.54 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 99.54 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 99.52 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.51 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 99.51 | |
| d1alva_ | 173 | Calpain small (regulatory) subunit (domain VI) {Pi | 99.5 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.49 | |
| d1juoa_ | 172 | Sorcin {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.49 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.48 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.47 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.47 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.47 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 99.47 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 99.46 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.46 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 99.46 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 99.46 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 99.46 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.45 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.45 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.45 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 99.45 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 99.44 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.44 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.43 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 99.43 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 99.43 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.42 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.42 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.42 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 99.42 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 99.42 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 99.42 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 99.41 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.38 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 99.38 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.37 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.37 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 99.36 | |
| d1s6ia_ | 182 | Calcium-dependent protein kinase sk5 CLD {Soybean | 99.35 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 99.35 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 99.33 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 99.33 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 99.31 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 99.3 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 99.3 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 99.29 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 99.28 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 99.27 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.27 | |
| d1wdcc_ | 152 | Myosin Regulatory Chain {Bay scallop (Aequipecten | 99.27 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 99.25 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 99.25 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 99.25 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 99.24 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 99.22 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 99.21 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 99.2 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 99.18 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.18 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 99.16 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 99.16 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 99.15 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 99.14 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.13 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.13 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 99.12 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 99.11 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 99.11 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 99.11 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 99.11 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 99.1 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 99.08 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 99.06 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d2zkmx1 | 170 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 99.02 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 99.01 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 99.0 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 98.99 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.98 | |
| d1k8ua_ | 89 | Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta | 98.97 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 98.97 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 98.96 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 98.95 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 98.93 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.93 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.92 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.91 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 98.91 | |
| d1xk4a1 | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.9 | |
| d1psra_ | 100 | Calcyclin (S100) {Human (Homo sapiens), psoriasin | 98.83 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 98.81 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.78 | |
| d2hf5a1 | 33 | Troponin C {Human (Homo sapiens), cardiac isoform | 98.72 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 98.65 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 98.6 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 98.46 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.46 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 98.42 | |
| d1qlsa_ | 95 | Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 | 98.42 | |
| d1j55a_ | 94 | Calcyclin (S100) {Human (Homo sapiens), s100p [Tax | 98.4 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 98.29 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 98.21 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 98.1 | |
| d1ctda_ | 34 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 98.07 | |
| d1tuza_ | 118 | Diacylglycerol kinase alpha, N-terminal domain {Hu | 97.86 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 97.48 | |
| d1j7qa_ | 86 | Calcium vector protein {Amphioxus (Branchiostoma l | 97.03 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 96.9 | |
| d1sraa_ | 151 | C-terminal (EC) domain of BM-40/SPARC/osteonectin | 96.81 | |
| d1pula1 | 103 | Hypothetical protein c32e8.3 {Caenorhabditis elega | 96.42 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 96.25 | |
| d1qasa1 | 94 | Phosphoinositide-specific phospholipase C, isozyme | 96.0 | |
| d1pula1 | 103 | Hypothetical protein c32e8.3 {Caenorhabditis elega | 94.87 | |
| d1wlma1 | 138 | Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 | 94.78 | |
| d1wlma1 | 138 | Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090 | 94.71 | |
| d1h8ba_ | 73 | alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | 94.42 | |
| d1eg3a1 | 125 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 92.72 | |
| d1eg3a2 | 97 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 92.62 | |
| d1h8ba_ | 73 | alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | 91.92 | |
| d1hm6a_ | 343 | Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | 91.74 | |
| d1eg3a2 | 97 | Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | 90.79 | |
| d1hm6a_ | 343 | Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | 90.62 | |
| d1axna_ | 323 | Annexin III {Human (Homo sapiens) [TaxId: 9606]} | 88.91 | |
| d2cclb1 | 59 | Endo-1,4-beta-xylanase Y {Clostridium thermocellum | 88.51 | |
| d2cclb1 | 59 | Endo-1,4-beta-xylanase Y {Clostridium thermocellum | 87.78 | |
| d1n00a_ | 318 | Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 | 85.78 | |
| d1avca1 | 341 | Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | 84.49 | |
| d1axna_ | 323 | Annexin III {Human (Homo sapiens) [TaxId: 9606]} | 83.04 | |
| d1dava_ | 71 | Cellulosome endoglucanase SS {Clostridium thermoce | 82.42 | |
| d1w7ba_ | 319 | Annexin II {Human (Homo sapiens) [TaxId: 9606]} | 82.3 | |
| d1w7ba_ | 319 | Annexin II {Human (Homo sapiens) [TaxId: 9606]} | 82.25 | |
| d1dava_ | 71 | Cellulosome endoglucanase SS {Clostridium thermoce | 81.17 |
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Penta-EF-hand proteins domain: Programmed cell death 6 protein-like protein species: Leishmania major [TaxId: 5664]
Probab=99.98 E-value=9.9e-31 Score=204.27 Aligned_cols=168 Identities=31% Similarity=0.505 Sum_probs=161.3
Q ss_pred CCchhHHHHHHHHccCCCCccCHHHHHHHHHhcCccCCHHHHHHHHHHhcCCCCCccCHHHHHHHHHhHHHHHHHHHHhc
Q 023338 112 GTDPNIVACFQLADRDNSGLIDDKELQGALSSYNQSFSLRTVRLLMYTFTNTNARKIGPKEFIQVFHSLQNWRAMFEKVD 191 (283)
Q Consensus 112 ~~~~~l~~~F~~~d~d~~g~i~~~el~~~l~~~~~~~~~~~~~~l~~~~d~~~~g~i~~~ef~~~~~~~~~~~~~f~~~D 191 (283)
.+.++|+++|+.+|+|++|.|+.+||+.+|+.++..++..+++.|++.+|.+.+|.|++++|+..+.....++.+|+.+|
T Consensus 15 ~~~~~l~~~F~~~D~d~dG~Is~~El~~~l~~l~~~~s~~~~~~l~~~~d~d~~~~i~~~ef~~~~~~~~~~~~~F~~~D 94 (182)
T d1y1xa_ 15 NDNQELMEWFRAVDTDGSGAISVPELNAALSSAGVPFSLATTEKLLHMYDKNHSGEITFDEFKDLHHFILSMREGFRKRD 94 (182)
T ss_dssp CTTSCHHHHHHHHCTTCSSSBCHHHHHHHHCBTTBCCCHHHHHHHHHHHCTTCSSSBCHHHHHHHHHHHHHHHHHHHHHC
T ss_pred CcHHHHHHHHHHHcCCCcCCCCHHHHHHHHHHhcccCchhhhhhhhccccccccccccccccccccccccccccchhccc
Confidence 34468999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCCccCHHHHHHHHHHcCCCCCHHHHHHHHHHHhhCCCCCCcccHHHHHHHHHHHHHHHHHhhhcCCCCCceeeeeHH
Q 023338 192 RDRSGKIDSNELREALMSLGFAVSPVVLDLLVTKFDKTGGKSKAIEYDNFIECCLTVKGLTEKFKERDTTYSGSATFTYE 271 (283)
Q Consensus 192 ~~~~G~i~~~el~~~l~~l~~~~~~~~i~~l~~~~d~~~d~~g~i~~~eF~~~~~~~~~~~~~f~~~d~~~~g~i~~~~~ 271 (283)
.+++|.|+.+||+++|..++..+++++++.+++.+|.+++ |.|+++||+.++..+.++.+.|+.+|.+.+|.|+++++
T Consensus 95 ~~~~g~I~~~el~~~l~~~g~~ls~~e~~~i~~~~d~~~d--g~I~~~eF~~~~~~l~~~~~~F~~~D~~~~G~is~~~~ 172 (182)
T d1y1xa_ 95 SSGDGRLDSNEVRAALLSSGYQVSEQTFQALMRKFDRQRR--GSLGFDDYVELSIFVCRVRNVFAFYDRERTGQVTFTFD 172 (182)
T ss_dssp TTSSSCBCHHHHHHHHHTTSCCCCHHHHHHHHHHHCTTCS--SSBCHHHHHHHHHHHHHHHHHHHHHCTTCCSEEEEEHH
T ss_pred cccchhhhhHHHHHHHHHhCCchhHHHHHHHHhhcccCCC--CCcCHHHHHHHHHHHHHHHHHHHHhCCCCCCcEEeeHH
Confidence 9999999999999999999999999999999999999986 99999999999999999999999999999999999999
Q ss_pred HHHHHhcccc
Q 023338 272 NFMLAVLPFL 281 (283)
Q Consensus 272 ~~~~~~~~~~ 281 (283)
+|+..++.+|
T Consensus 173 ~f~~~~~~~~ 182 (182)
T d1y1xa_ 173 TFIGGSVSIL 182 (182)
T ss_dssp HHHHHHHHHC
T ss_pred HHHHHHHhhC
Confidence 9999998765
|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} | Back information, alignment and structure |
|---|
| >d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wlma1 a.39.1.11 (A:8-145) Protein cgi-38 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eg3a1 a.39.1.7 (A:85-209) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} | Back information, alignment and structure |
|---|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dava_ a.139.1.1 (A:) Cellulosome endoglucanase SS {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|