Citrus Sinensis ID: 023415


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGWSKA
cHHHHcccccccccccccccEEEcccccHHHHHHHHHHHHcccccccccccccEEEEccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccEEEcccccccccccccEEEcccccccccccccccccccccEEEccHHHHHHHHHccccccEEEEccccHHHHHHHHHcccccccEEccccHHHccccccccccccccccccccccHHHcccccccEEEcccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHccccc
cHHHHHccccEEEEcccccccEEcccccHHHHHHHHHHHHHEHccccEEccccEEEEEHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccEEEccccccccEEEEEEEEEccccccHHHHHHHcccEEEEEEcccHHHHHHHHccccccEEEEEEcccHHHHHHHHHHHcccEEEEEccccccccccccccccccccccHHHHHHHHHHHccEEEEEEEccccccccccccccHHHHHHHHHHHcccHHHHHHHHHccccc
MAAAAKHLTPVLLElggkspvvfdsGINLKVACRRMImgkwgcnngqacispdhiittkdYAPKLLESLKNELEnfygknpleskdlsrivnSNHFARLSKlldddkvsgkivhggerdknklriaptllldvprdslimseeifgpllpiltvdkiedsfdiinsgtkPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVhslpfggvqesgmgayhgkfsfdvfshkkavlsrgfigdvpvryppytkgKLRLLKVLISGSLLGIIRALLGWSKA
MAAAAKHLTPVLlelggkspvvfDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKnpleskdlsrIVNSNHFARlsklldddkvsgkivhggerdknklriaptLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLsrgfigdvpvryppytKGKLRLLKVLISGSLLGIIRallgwska
MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPklleslknelenFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGWSKA
*******LTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKN******LSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW***
MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGWSKA
MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGWSKA
*****KHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGWSK*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSRGFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGWSKA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q70DU8484 Aldehyde dehydrogenase fa yes no 0.985 0.574 0.730 1e-122
Q8VXQ2479 Aldehyde dehydrogenase OS N/A no 0.992 0.584 0.617 1e-102
Q8W033550 Aldehyde dehydrogenase fa no no 0.975 0.5 0.629 1e-101
Q70E96484 Aldehyde dehydrogenase fa no no 0.985 0.574 0.487 1e-75
P11883453 Aldehyde dehydrogenase, d yes no 0.875 0.545 0.476 8e-67
P30839484 Fatty aldehyde dehydrogen no no 0.921 0.537 0.468 1e-66
P47740484 Fatty aldehyde dehydrogen yes no 0.921 0.537 0.464 2e-65
P30838453 Aldehyde dehydrogenase, d yes no 0.875 0.545 0.472 7e-65
P47739453 Aldehyde dehydrogenase, d no no 0.875 0.545 0.476 1e-64
A3RF36453 Aldehyde dehydrogenase, d no no 0.875 0.545 0.464 5e-64
>sp|Q70DU8|AL3H1_ARATH Aldehyde dehydrogenase family 3 member H1 OS=Arabidopsis thaliana GN=ALDH3H1 PE=2 SV=2 Back     alignment and function desciption
 Score =  436 bits (1122), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 203/278 (73%), Positives = 243/278 (87%)

Query: 1   MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKD 60
           MAAAAKHLTPV+LELGGKSPVV DS  +LKV  RR+I+GKWGCNNGQAC+SPD+I+TTK+
Sbjct: 205 MAAAAKHLTPVVLELGGKSPVVVDSDTDLKVTVRRIIVGKWGCNNGQACVSPDYILTTKE 264

Query: 61  YAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDK 120
           YAPKL++++K ELE FYGKNP+ESKD+SRIVNSNHF RLSKLLD+ +VS KIV+GGE+D+
Sbjct: 265 YAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLSKLLDEKEVSDKIVYGGEKDR 324

Query: 121 NKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNK 180
             L+IAPT+LLDVP DSLIMSEEIFGPLLPILT++ +E+SFD+I S  KPLAAYLFT+NK
Sbjct: 325 ENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNK 384

Query: 181 KLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSR 240
           KLK++F  TVSAGG+V+ND AVHLA+H+LPFGGV ESGMGAYHGKFSFD FSHKKAVL R
Sbjct: 385 KLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYR 444

Query: 241 GFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLG 278
              GD  VRYPPY++GKLRLLK L+  ++  + + LLG
Sbjct: 445 SLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLG 482





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 3
>sp|Q8VXQ2|ALDH_CRAPL Aldehyde dehydrogenase OS=Craterostigma plantagineum GN=ALDH PE=1 SV=1 Back     alignment and function description
>sp|Q8W033|AL3I1_ARATH Aldehyde dehydrogenase family 3 member I1, chloroplastic OS=Arabidopsis thaliana GN=ALDH3I1 PE=2 SV=2 Back     alignment and function description
>sp|Q70E96|AL3F1_ARATH Aldehyde dehydrogenase family 3 member F1 OS=Arabidopsis thaliana GN=ALDH3F1 PE=2 SV=2 Back     alignment and function description
>sp|P11883|AL3A1_RAT Aldehyde dehydrogenase, dimeric NADP-preferring OS=Rattus norvegicus GN=Aldh3a1 PE=1 SV=3 Back     alignment and function description
>sp|P30839|AL3A2_RAT Fatty aldehyde dehydrogenase OS=Rattus norvegicus GN=Aldh3a2 PE=1 SV=1 Back     alignment and function description
>sp|P47740|AL3A2_MOUSE Fatty aldehyde dehydrogenase OS=Mus musculus GN=Aldh3a2 PE=2 SV=2 Back     alignment and function description
>sp|P30838|AL3A1_HUMAN Aldehyde dehydrogenase, dimeric NADP-preferring OS=Homo sapiens GN=ALDH3A1 PE=1 SV=3 Back     alignment and function description
>sp|P47739|AL3A1_MOUSE Aldehyde dehydrogenase, dimeric NADP-preferring OS=Mus musculus GN=Aldh3a1 PE=2 SV=2 Back     alignment and function description
>sp|A3RF36|AL3A1_CANFA Aldehyde dehydrogenase, dimeric NADP-preferring OS=Canis familiaris GN=ALDH3A1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
449449751 484 PREDICTED: aldehyde dehydrogenase family 0.992 0.578 0.796 1e-134
449500678 484 PREDICTED: aldehyde dehydrogenase family 0.992 0.578 0.792 1e-133
449449753 462 PREDICTED: LOW QUALITY PROTEIN: aldehyde 0.992 0.606 0.792 1e-133
217074984 488 unknown [Medicago truncatula] 0.992 0.573 0.8 1e-132
356503028 496 PREDICTED: aldehyde dehydrogenase family 0.989 0.562 0.802 1e-130
388516635280 unknown [Medicago truncatula] 0.992 1.0 0.8 1e-130
356552697 487 PREDICTED: aldehyde dehydrogenase family 0.989 0.572 0.813 1e-129
356552695 496 PREDICTED: aldehyde dehydrogenase family 0.989 0.562 0.813 1e-129
442736187 492 fatty aldehyde dehydrogenase [Simmondsia 0.989 0.567 0.777 1e-129
224082306 488 predicted protein [Populus trichocarpa] 0.992 0.573 0.789 1e-129
>gi|449449751|ref|XP_004142628.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis sativus] gi|449500684|ref|XP_004161167.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 223/280 (79%), Positives = 257/280 (91%)

Query: 1   MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKD 60
           MAAAAKHLTPV+LELGGKSPVV DS INL+VA RR+I GKWGCNNGQACI+PD++ITTK+
Sbjct: 205 MAAAAKHLTPVVLELGGKSPVVVDSKINLQVASRRIIAGKWGCNNGQACIAPDYVITTKE 264

Query: 61  YAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDK 120
           +APKL+E +K ELE FYGKNPLE+KDLSRIVN+NHF RL++LLDDDK+SGKIVHGGE+DK
Sbjct: 265 FAPKLVECMKQELEKFYGKNPLETKDLSRIVNANHFDRLTRLLDDDKISGKIVHGGEKDK 324

Query: 121 NKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNK 180
           +KL+IAPTLLLDVPRDSLIM+EEIFGPLLPILTVDK+EDSFDI+NSGTKPLAAYLFTNNK
Sbjct: 325 SKLQIAPTLLLDVPRDSLIMTEEIFGPLLPILTVDKVEDSFDIVNSGTKPLAAYLFTNNK 384

Query: 181 KLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSR 240
           KLK++FV  +SAGG+ IN+TA+HL + +LPFGGV ESGMGAYHGKFSFD FSHKKAVL R
Sbjct: 385 KLKERFVACISAGGVAINETALHLTISTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYR 444

Query: 241 GFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGWS 280
            F GD P+RYPPYTKGKLR+LK L+ G +L +IRALLGWS
Sbjct: 445 SFAGDAPMRYPPYTKGKLRILKALLGGGILALIRALLGWS 484




Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449500678|ref|XP_004161166.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449449753|ref|XP_004142629.1| PREDICTED: LOW QUALITY PROTEIN: aldehyde dehydrogenase family 3 member H1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|217074984|gb|ACJ85852.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356503028|ref|XP_003520314.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like [Glycine max] Back     alignment and taxonomy information
>gi|388516635|gb|AFK46379.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|356552697|ref|XP_003544699.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|356552695|ref|XP_003544698.1| PREDICTED: aldehyde dehydrogenase family 3 member H1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|442736187|gb|AGC65583.1| fatty aldehyde dehydrogenase [Simmondsia chinensis] Back     alignment and taxonomy information
>gi|224082306|ref|XP_002306641.1| predicted protein [Populus trichocarpa] gi|222856090|gb|EEE93637.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
TAIR|locus:2205851484 ALDH3H1 "AT1G44170" [Arabidops 0.985 0.574 0.708 2.5e-106
TAIR|locus:2116134550 ALDH3I1 "AT4G34240" [Arabidops 0.996 0.510 0.608 5.1e-90
TAIR|locus:2122224484 ALDH3F1 "AT4G36250" [Arabidops 0.982 0.572 0.482 4e-67
WB|WBGene00000110494 alh-4 [Caenorhabditis elegans 0.918 0.524 0.468 2.4e-60
UNIPROTKB|E2RPP8599 ALDH3A2 "Uncharacterized prote 0.921 0.434 0.456 9.9e-60
UNIPROTKB|D4A137507 Aldh3a2 "Aldehyde dehydrogenas 0.921 0.512 0.460 5.7e-59
RGD|61866484 Aldh3a2 "aldehyde dehydrogenas 0.921 0.537 0.460 7.3e-59
UNIPROTKB|P30839484 Aldh3a2 "Fatty aldehyde dehydr 0.921 0.537 0.460 7.3e-59
UNIPROTKB|F1NH33490 ALDH3A2 "Aldehyde dehydrogenas 0.968 0.557 0.456 1.5e-58
MGI|MGI:1353452484 Aldh3a2 "aldehyde dehydrogenas 0.921 0.537 0.456 5.1e-58
TAIR|locus:2205851 ALDH3H1 "AT1G44170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1052 (375.4 bits), Expect = 2.5e-106, P = 2.5e-106
 Identities = 197/278 (70%), Positives = 233/278 (83%)

Query:     1 MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKD 60
             MAAAAKHLTPV+LELGGKSPVV DS  +LKV  RR+I+GKWGCNNGQAC+SPD+I+TTK+
Sbjct:   205 MAAAAKHLTPVVLELGGKSPVVVDSDTDLKVTVRRIIVGKWGCNNGQACVSPDYILTTKE 264

Query:    61 YAPXXXXXXXXXXXXFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDK 120
             YAP            FYGKNP+ESKD+SRIVNSNHF RLSKLLD+ +VS KIV+GGE+D+
Sbjct:   265 YAPKLIDAMKLELEKFYGKNPIESKDMSRIVNSNHFDRLSKLLDEKEVSDKIVYGGEKDR 324

Query:   121 NKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNK 180
               L+IAPT+LLDVP DSLIMSEEIFGPLLPILT++ +E+SFD+I S  KPLAAYLFT+NK
Sbjct:   325 ENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNK 384

Query:   181 KLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSR 240
             KLK++F  TVSAGG+V+ND AVHLA+H+LPFGGV ESGMGAYHGKFSFD FSHKKAVL R
Sbjct:   385 KLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYR 444

Query:   241 GFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLG 278
                GD  VRYPPY++GKLRLLK L+  ++  + + LLG
Sbjct:   445 SLFGDSAVRYPPYSRGKLRLLKALVDSNIFDLFKVLLG 482




GO:0004028 "3-chloroallyl aldehyde dehydrogenase activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISM
GO:0006081 "cellular aldehyde metabolic process" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0004029 "aldehyde dehydrogenase (NAD) activity" evidence=ISS;IDA
GO:0009536 "plastid" evidence=ISS
GO:0005773 "vacuole" evidence=IDA
GO:0009269 "response to desiccation" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0009506 "plasmodesma" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
TAIR|locus:2116134 ALDH3I1 "AT4G34240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122224 ALDH3F1 "AT4G36250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
WB|WBGene00000110 alh-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPP8 ALDH3A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D4A137 Aldh3a2 "Aldehyde dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|61866 Aldh3a2 "aldehyde dehydrogenase 3 family, member A2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P30839 Aldh3a2 "Fatty aldehyde dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH33 ALDH3A2 "Aldehyde dehydrogenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1353452 Aldh3a2 "aldehyde dehydrogenase family 3, subfamily A2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q70DU8AL3H1_ARATH1, ., 2, ., 1, ., 30.73020.98580.5743yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
PLN02174484 PLN02174, PLN02174, aldehyde dehydrogenase family 1e-153
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 1e-149
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 1e-126
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 1e-125
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 1e-120
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 1e-115
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 1e-112
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 1e-98
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 4e-97
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 7e-97
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 5e-68
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 2e-59
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 3e-52
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 5e-46
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 1e-38
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 4e-37
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 1e-36
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 1e-34
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 1e-34
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 3e-33
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 2e-32
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 7e-32
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 8e-32
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 3e-31
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 3e-31
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 3e-31
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 5e-30
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 2e-29
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 2e-29
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 4e-29
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 6e-29
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 7e-29
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 5e-28
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 6e-28
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 4e-27
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 6e-27
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 7e-27
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 2e-26
cd07097473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 3e-26
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 4e-26
cd07112462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 7e-26
cd07131478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 7e-26
cd07113477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 1e-25
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 2e-25
TIGR01804467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 4e-25
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 1e-24
cd07143481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 1e-24
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 2e-24
PRK10090409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 2e-24
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 1e-23
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 2e-23
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 4e-23
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 5e-23
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 1e-22
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 2e-22
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 5e-22
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 2e-21
cd07559480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 6e-21
cd07117475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 7e-21
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 8e-21
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 9e-21
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 2e-20
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 7e-20
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 2e-19
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 2e-19
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 2e-19
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 2e-19
cd07119482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 2e-19
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 1e-18
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 2e-18
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 2e-18
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 4e-18
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 8e-17
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 4e-16
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 5e-16
cd07140486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 7e-16
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 9e-16
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 2e-15
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 2e-15
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 2e-15
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 3e-15
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 1e-14
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 3e-14
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 6e-14
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 6e-14
cd07116479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 2e-13
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 2e-13
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 8e-13
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 3e-11
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 7e-10
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 8e-10
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 2e-09
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 4e-08
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 1e-07
PLN02419604 PLN02419, PLN02419, methylmalonate-semialdehyde de 2e-07
COG4230 769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 1e-06
PLN02315508 PLN02315, PLN02315, aldehyde dehydrogenase family 2e-06
TIGR02278 663 TIGR02278, PaaN-DH, phenylacetic acid degradation 6e-06
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 8e-06
TIGR01238500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 2e-05
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 3e-05
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 1e-04
>gnl|CDD|177831 PLN02174, PLN02174, aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
 Score =  436 bits (1123), Expect = e-153
 Identities = 204/280 (72%), Positives = 242/280 (86%)

Query: 1   MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKD 60
           MAAAAKHLTPV+LELGGKSPVV DS  +LKV  RR+I GKWGCNNGQACISPD+I+TTK+
Sbjct: 205 MAAAAKHLTPVVLELGGKSPVVVDSDTDLKVTVRRIIAGKWGCNNGQACISPDYILTTKE 264

Query: 61  YAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDK 120
           YAPK+++++K ELE FYGKNP+ESKD+SRIVNS HF RLSKLLD+ +VS KIV+GGE+D+
Sbjct: 265 YAPKVIDAMKKELETFYGKNPMESKDMSRIVNSTHFDRLSKLLDEKEVSDKIVYGGEKDR 324

Query: 121 NKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNK 180
             L+IAPT+LLDVP DSLIMSEEIFGPLLPILT++ +E+SFD+I S  KPLAAYLFT+NK
Sbjct: 325 ENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNK 384

Query: 181 KLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSR 240
           KLK++F  TVSAGG+V+ND AVHLA+H+LPFGGV ESGMGAYHGKFSFD FSHKKAVL R
Sbjct: 385 KLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYR 444

Query: 241 GFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGWS 280
              GD  VRYPPY++GKLRLLK L+  ++  I + LLG S
Sbjct: 445 SLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKVLLGLS 484


Length = 484

>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|131331 TIGR02278, PaaN-DH, phenylacetic acid degradation protein paaN Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
PLN02174484 aldehyde dehydrogenase family 3 member H1 100.0
KOG2456477 consensus Aldehyde dehydrogenase [Energy productio 100.0
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 100.0
PLN02203484 aldehyde dehydrogenase 100.0
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 100.0
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 100.0
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 100.0
KOG2450501 consensus Aldehyde dehydrogenase [Energy productio 100.0
PLN02766501 coniferyl-aldehyde dehydrogenase 100.0
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 100.0
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 100.0
PRK10090409 aldehyde dehydrogenase A; Provisional 100.0
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 100.0
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 100.0
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 100.0
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 100.0
PLN02278498 succinic semialdehyde dehydrogenase 100.0
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 100.0
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 100.0
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 100.0
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 100.0
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 100.0
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 100.0
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 100.0
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 100.0
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 100.0
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 100.0
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 100.0
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 100.0
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 100.0
PLN02466538 aldehyde dehydrogenase family 2 member 100.0
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 100.0
PRK13252488 betaine aldehyde dehydrogenase; Provisional 100.0
KOG2451503 consensus Aldehyde dehydrogenase [Energy productio 100.0
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 100.0
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 100.0
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 100.0
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 100.0
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 100.0
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 100.0
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 100.0
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 100.0
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 100.0
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 100.0
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 100.0
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 100.0
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 100.0
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 100.0
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 100.0
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 100.0
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 100.0
PLN02467503 betaine aldehyde dehydrogenase 100.0
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 100.0
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 100.0
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 100.0
PLN02315508 aldehyde dehydrogenase family 7 member 100.0
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 100.0
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 100.0
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 100.0
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 100.0
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 100.0
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 100.0
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 100.0
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 100.0
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 100.0
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 100.0
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 100.0
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 100.0
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 100.0
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 100.0
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 100.0
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 100.0
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 100.0
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 100.0
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 100.0
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 100.0
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 100.0
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 100.0
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 100.0
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 100.0
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 100.0
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 100.0
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 100.0
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 100.0
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 100.0
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 100.0
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 100.0
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 100.0
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 100.0
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 100.0
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 100.0
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 100.0
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 100.0
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 100.0
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 100.0
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 100.0
PRK11903521 aldehyde dehydrogenase; Provisional 100.0
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 100.0
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 100.0
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 100.0
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 100.0
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 100.0
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
KOG2454583 consensus Betaine aldehyde dehydrogenase [Energy p 100.0
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 100.0
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 100.0
PRK11809 1318 putA trifunctional transcriptional regulator/proli 100.0
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 100.0
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 100.0
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 100.0
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 100.0
PRK15398465 aldehyde dehydrogenase EutE; Provisional 100.0
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 100.0
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 100.0
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 100.0
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 100.0
KOG2452881 consensus Formyltetrahydrofolate dehydrogenase [Nu 100.0
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 100.0
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 100.0
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 100.0
KOG2455561 consensus Delta-1-pyrroline-5-carboxylate dehydrog 100.0
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 100.0
KOG2453507 consensus Aldehyde dehydrogenase [Energy productio 100.0
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 100.0
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 100.0
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 100.0
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 100.0
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 100.0
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.75
KOG2449157 consensus Methylmalonate semialdehyde dehydrogenas 99.58
cd07080422 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac 99.49
PF07368215 DUF1487: Protein of unknown function (DUF1487); In 99.47
KOG4165433 consensus Gamma-glutamyl phosphate reductase [Amin 99.31
PF05893399 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086 97.76
PF00815412 Histidinol_dh: Histidinol dehydrogenase; InterPro: 87.7
COG0141425 HisD Histidinol dehydrogenase [Amino acid transpor 86.33
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
Probab=100.00  E-value=1e-66  Score=493.09  Aligned_cols=277  Identities=72%  Similarity=1.176  Sum_probs=256.5

Q ss_pred             hhhhhcCCcEEEeCCCCCceEEcCCCCHHHHHHHHHHHhccc-CCCCccccCCeEEEeCCcHHHHHHHHHHHHhhccCCC
Q 023415            2 AAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGC-NNGQACISPDHIITTKDYAPKLLESLKNELENFYGKN   80 (282)
Q Consensus         2 ~~aa~~~~~~~lElgG~np~iV~~dADl~~aa~~i~~~~~~~-~~GQ~C~a~~~v~V~~~i~d~f~~~l~~~~~~~~~g~   80 (282)
                      ++|++++||++||||||||+||++|||++.|++.+++++| . |+||.|++++|||||++++|+|+++|++++++++.|+
T Consensus       206 ~~aa~~l~~v~LELGGk~p~iV~~dADl~~Aa~~i~~g~f-~~n~GQ~C~a~~rv~V~~~i~d~f~~~l~~~~~~~~~G~  284 (484)
T PLN02174        206 AAAAKHLTPVVLELGGKSPVVVDSDTDLKVTVRRIIAGKW-GCNNGQACISPDYILTTKEYAPKVIDAMKKELETFYGKN  284 (484)
T ss_pred             HHHHhcCCcEEEecCCCCeEEEcCCCCHHHHHHHHHHHHh-hCCCCCCCCcCcEEEEeHHHHHHHHHHHHHHHHhhcCCC
Confidence            5688999999999999999999999999999999999998 7 9999999999999999999999999999999999999


Q ss_pred             CCCCCcccccCCHHHHHHHHHHHHHHHhcCeEeeCCccCCCCceecceEEeeCCCCCcccccccccceeeEEeeCCHHHH
Q 023415           81 PLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDS  160 (282)
Q Consensus        81 ~~~~~~~gpli~~~~~~~i~~~i~~a~~~~~~~~gg~~~~~g~~~~Ptv~~~~~~~~~i~~~E~fgPvl~v~~~~~~~ea  160 (282)
                      |.+++++||++++.+++++.++|+++.+++++++||..+..|+|++|||+.+++++|++++||+||||++|++|+|++||
T Consensus       285 p~~~~~~Gpli~~~~~~~v~~~i~~a~~ga~~~~GG~~~~~g~~~~PTvl~~v~~~~~i~~eEiFGPVl~v~~~~~~~ea  364 (484)
T PLN02174        285 PMESKDMSRIVNSTHFDRLSKLLDEKEVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEES  364 (484)
T ss_pred             CcccCCcCCCCCHHHHHHHHHHHHHHHcCCEEEECCCcCCCCCEEEEEEEecCCCCChhhcCCcCCCeEEEecCCCHHHH
Confidence            97788999999999999999999998778899999976556899999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCceEEEecCCHHHHHHHHhhcccceEEECCCCcccCCCCCCcccCCCCCCCCcchHHHHHHhhhccEEeEe
Q 023415          161 FDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSR  240 (282)
Q Consensus       161 i~~~n~~~~gL~a~i~t~d~~~~~~~~~~l~~g~v~iN~~~~~~~~~~~pfGG~~~SG~G~~~g~~~l~~~~~~k~v~~~  240 (282)
                      |+++|+++|||++||||+|.++++++++++++|.|+||++..+...+.+||||+|.||+|+++|.+++++||+.|+|+++
T Consensus       365 i~~aN~~~~gLaa~vft~d~~~a~~~~~~l~aG~v~IN~~~~~~~~~~~PfGG~k~SG~Gr~~G~~gl~~ft~~K~v~~~  444 (484)
T PLN02174        365 FDVIRSRPKPLAAYLFTHNKKLKERFAATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYR  444 (484)
T ss_pred             HHHHhCCCCCeEEEEEcCCHHHHHHHHHcCCcceEEECCCcCCCCCCCCCCCCcCccccCccchHHHHHHhcceEEEEEC
Confidence            99999999999999999999999999999999999999987655557899999999999999999999999999999988


Q ss_pred             CCCCCCCCcCCCCchhHHHHHHHHHhhhhHHHHHHHhhc
Q 023415          241 GFIGDVPVRYPPYTKGKLRLLKVLISGSLLGIIRALLGW  279 (282)
Q Consensus       241 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  279 (282)
                      ......+++||||+.++.++++.+++..+.++.+.+.+|
T Consensus       445 ~~~~~~~~~~pp~~~~~~~~~~~~~~~~~~~~~~~~~~~  483 (484)
T PLN02174        445 SLFGDSAVRYPPYSRGKLRLLKALVDSNIFDIFKVLLGL  483 (484)
T ss_pred             CccCcccccCCCCChHHHHHHHHHHhhchhhhhhccccC
Confidence            765677899999999999999999885455555444443



>KOG2456 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>KOG2450 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG2451 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2454 consensus Betaine aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG2452 consensus Formyltetrahydrofolate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>KOG2455 consensus Delta-1-pyrroline-5-carboxylate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>KOG2453 consensus Aldehyde dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2449 consensus Methylmalonate semialdehyde dehydrogenase [Amino acid transport and metabolism; Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC Back     alignment and domain information
>PF07368 DUF1487: Protein of unknown function (DUF1487); InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>KOG4165 consensus Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins Back     alignment and domain information
>PF00815 Histidinol_dh: Histidinol dehydrogenase; InterPro: IPR012131 Histidinol dehydrogenase (HDH) catalyzes the terminal step in the biosynthesis of histidine in bacteria, fungi, and plants, the four-electron oxidation of L-histidinol to histidine Back     alignment and domain information
>COG0141 HisD Histidinol dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
1ad3_A452 Class 3 Aldehyde Dehydrogenase Complex With Nicotin 9e-64
3sza_A469 Crystal Structure Of Human Aldh3a1 - Apo Form Lengt 5e-62
3lv1_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 3e-34
3lns_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 7e-33
4i9b_A517 Structure Of Aminoaldehyde Dehydrogenase 1 From Sol 2e-22
4i8q_A514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 1e-21
3pqa_A486 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 5e-21
3iwj_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 2 1e-20
2hg2_A479 Structure Of Lactaldehyde Dehydrogenase Length = 47 1e-18
2imp_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 1e-18
4a0m_A496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 2e-18
4i8p_A520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 5e-18
2opx_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 6e-18
3iwk_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 1 2e-17
3k2w_A497 Crystal Structure Of Betaine-Aldehyde Dehydrogenase 3e-17
3ty7_A478 Crystal Structure Of Aldehyde Dehydrogenase Family 5e-17
1a4s_A503 Betaine Aldehyde Dehydrogenase From Cod Liver Lengt 6e-17
1euh_A475 Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase 6e-17
2id2_A475 Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 6e-17
3qan_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 1e-16
2esd_A475 Crystal Structure Of Thioacylenzyme Intermediate Of 3e-16
2onn_A500 Arg475gln Mutant Of Human Mitochondrial Aldehyde De 5e-16
3b4w_A495 Crystal Structure Of Mycobacterium Tuberculosis Ald 5e-16
3n81_A500 T244a Mutant Of Human Mitochondrial Aldehyde Dehydr 6e-16
1o05_A500 Apo Form Of Human Mitochondrial Aldehyde Dehydrogen 6e-16
1cw3_A494 Human Mitochondrial Aldehyde Dehydrogenase Complexe 6e-16
1qi1_A475 Ternary Complex Of An Nadp Dependent Aldehyde Dehyd 1e-15
1uzb_A516 1-pyrroline-5-carboxylate Dehydrogenase Length = 51 1e-15
3u4j_A528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 1e-15
2bhp_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 1e-15
3r31_A517 Crystal Structure Of Betaine Aldehyde Dehydrogenase 2e-15
4fr8_A500 Crystal Structure Of Human Aldehyde Dehydrogenase-2 2e-15
3prl_A505 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 4e-15
2bja_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 5e-15
1zum_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 5e-15
2w8n_A487 The Crytal Structure Of The Oxidized Form Of Human 8e-15
1nzw_A500 Cys302ser Mutant Of Human Mitochondrial Aldehyde De 1e-14
3n80_A500 Human Mitochondrial Aldehyde Dehydrogenase, Apo For 1e-14
1ag8_A499 Aldehyde Dehydrogenase From Bovine Mitochondria Len 2e-14
3rjl_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 4e-14
1bxs_A501 Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad 7e-14
3inl_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 9e-14
2w8p_A487 The Crystal Structure Of Human C340a Ssadh Length = 1e-13
4h7n_A474 The Structure Of Putative Aldehyde Dehydrogenase Pu 3e-13
3ed6_A520 1.7 Angstrom Resolution Crystal Structure Of Betain 3e-13
3ifg_A484 Crystal Structure Of Succinate-Semialdehyde Dehydro 5e-13
3ek1_A504 Crystal Structure Of Aldehyde Dehydrogenase From Br 5e-13
3efv_A462 Crystal Structure Of A Putative Succinate-Semialdeh 1e-12
2d4e_A515 Crystal Structure Of The Hpcc From Thermus Thermoph 1e-12
1bi9_A499 Retinal Dehydrogenase Type Two With Nad Bound Lengt 1e-12
1wnb_A495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 2e-12
2wme_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-12
2wox_A489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 2e-12
3jz4_A481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 5e-12
3jz4_C481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 5e-12
2xdr_A489 Crystallographic Structure Of Betaine Aldehyde Dehy 1e-11
3zqa_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-11
2wme_C490 Crystallographic Structure Of Betaine Aldehyde Dehy 5e-11
1o9j_A501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 7e-11
4dng_A485 Crystal Structure Of Putative Aldehyde Dehydrogenas 9e-11
3r64_A508 Crystal Structure Of A Nad-Dependent Benzaldehyde D 1e-10
1t90_A486 Crystal Structure Of Methylmalonate Semialdehyde De 2e-10
3rh9_A506 The Crystal Structure Of Oxidoreductase From Marino 2e-09
3v9h_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 3e-09
3v9g_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 3e-09
3v9i_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 3e-09
3v9j_A563 Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylat 5e-09
3ros_A484 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 5e-09
2o2p_A517 Crystal Structure Of The C-Terminal Domain Of Rat 1 2e-08
3rhm_A517 Crystal Structure Of The E673q Mutant Of C-Terminal 5e-08
3rhj_A517 Crystal Structure Of The E673a Mutant Of The C-Term 1e-07
3i44_A497 Crystal Structure Of Aldehyde Dehydrogenase From Ba 1e-07
3rhr_A517 Crystal Structure Of The C707a Mutant Of The C-Term 3e-07
4gnz_A517 Crystal Structure Of The C707s Mutant Of C-terminal 4e-07
4dal_A498 Crystal Structure Of Putative Aldehyde Dehydrogenas 8e-07
3rhl_A517 Crystal Structure Of The E673aC707A DOUBLE MUTANT O 2e-06
4e4g_A521 Crystal Structure Of Putative Methylmalonate-Semial 3e-05
4f9i_A1026 Crystal Structure Of Proline Utilization A (Puta) F 5e-05
3ju8_A490 Crystal Structure Of Succinylglutamic Semialdehyde 7e-04
>pdb|1AD3|A Chain A, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide- Adenine-Dinucleotide Length = 452 Back     alignment and structure

Iteration: 1

Score = 239 bits (611), Expect = 9e-64, Method: Compositional matrix adjust. Identities = 117/254 (46%), Positives = 163/254 (64%), Gaps = 7/254 (2%) Query: 1 MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKD 60 MAAAAKHLTPV LELGGKSP D +L VACRR+ GK+ N+GQ C++PD+I+ Sbjct: 196 MAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKF-MNSGQTCVAPDYILCDPS 254 Query: 61 YAPXXXXXXXXXXXXFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDK 120 FYG++ +S+D RI+N HF R+ L+D+ KV+ HGG D+ Sbjct: 255 IQNQIVEKLKKSLKDFYGEDAKQSRDYGRIINDRHFQRVKGLIDNQKVA----HGGTWDQ 310 Query: 121 NKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNK 180 + IAPT+L+DV S +M EEIFGP++PI+ V +E++ IN KPLA Y+F+NN+ Sbjct: 311 SSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNE 370 Query: 181 KLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSR 240 K+ ++ + S+GG+ ND VH+ V +LPFGGV SGMGAYHGK SF+ FSH+++ L + Sbjct: 371 KVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVK 430 Query: 241 GFIGDVP--VRYPP 252 + + RYPP Sbjct: 431 SLLNEEAHKARYPP 444
>pdb|3SZA|A Chain A, Crystal Structure Of Human Aldh3a1 - Apo Form Length = 469 Back     alignment and structure
>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ Length = 457 Back     alignment and structure
>pdb|3LNS|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ And Benzoate Adduct Length = 457 Back     alignment and structure
>pdb|4I9B|A Chain A, Structure Of Aminoaldehyde Dehydrogenase 1 From Solanum Lycopersium (slamadh1) With A Thiohemiacetal Intermediate Length = 517 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|3PQA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Gapn From Methanocaldococcus Jannaschii Dsm 2661 Length = 486 Back     alignment and structure
>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From Pisum Sativum (Psamadh2) Length = 503 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|2OPX|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From Escherichia Coli Length = 479 Back     alignment and structure
>pdb|3IWK|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1 From Pisum Sativum (Psamadh1) Length = 503 Back     alignment and structure
>pdb|3K2W|A Chain A, Crystal Structure Of Betaine-Aldehyde Dehydrogenase From Pseudoalteromonas Atlantica T6c Length = 497 Back     alignment and structure
>pdb|3TY7|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase Family Protein From Staphylococcus Aureus Length = 478 Back     alignment and structure
>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver Length = 503 Back     alignment and structure
>pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans Length = 475 Back     alignment and structure
>pdb|2ID2|A Chain A, Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 475 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|2ESD|A Chain A, Crystal Structure Of Thioacylenzyme Intermediate Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|3B4W|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Aldehyde Dehydrogenase Complexed With Nad+ Length = 495 Back     alignment and structure
>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nad+ And Mn2+ Length = 494 Back     alignment and structure
>pdb|1QI1|A Chain A, Ternary Complex Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|1UZB|A Chain A, 1-pyrroline-5-carboxylate Dehydrogenase Length = 516 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure
>pdb|2BHP|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nad. Length = 516 Back     alignment and structure
>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Agrobacterium Tumefaciens Length = 517 Back     alignment and structure
>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In Complex With Nitroglycerin Length = 500 Back     alignment and structure
>pdb|3PRL|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Halodurans C-125 Length = 505 Back     alignment and structure
>pdb|2BJA|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nadh Length = 516 Back     alignment and structure
>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Apo Form Length = 500 Back     alignment and structure
>pdb|2W8N|A Chain A, The Crytal Structure Of The Oxidized Form Of Human Ssadh Length = 487 Back     alignment and structure
>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nadh And Mg2+ Length = 500 Back     alignment and structure
>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1AG8|A Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria Length = 499 Back     alignment and structure
>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Licheniformis (Target Nysgrc-000337) Length = 538 Back     alignment and structure
>pdb|1BXS|A Chain A, Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad Bound Length = 501 Back     alignment and structure
>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Complexed With Agonist Alda-1 Length = 500 Back     alignment and structure
>pdb|2W8P|A Chain A, The Crystal Structure Of Human C340a Ssadh Length = 487 Back     alignment and structure
>pdb|4H7N|A Chain A, The Structure Of Putative Aldehyde Dehydrogenase Puta From Anabaena Variabilis. Length = 474 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|3IFG|A Chain A, Crystal Structure Of Succinate-Semialdehyde Dehydrogenase From Burkholderia Pseudomallei, Part 1 Of 2 Length = 484 Back     alignment and structure
>pdb|3EK1|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Brucella Melitensis Biovar Abortus 2308 Length = 504 Back     alignment and structure
>pdb|3EFV|A Chain A, Crystal Structure Of A Putative Succinate-Semialdehyde Dehydrogenase From Salmonella Typhimurium Lt2 With Bound Nad Length = 462 Back     alignment and structure
>pdb|2D4E|A Chain A, Crystal Structure Of The Hpcc From Thermus Thermophilus Hb8 Length = 515 Back     alignment and structure
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound Length = 499 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|3JZ4|A Chain A, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3JZ4|C Chain C, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|4DNG|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Bacillus Subtilis Subsp. Subtilis Str. 168 Length = 485 Back     alignment and structure
>pdb|3R64|A Chain A, Crystal Structure Of A Nad-Dependent Benzaldehyde Dehydrogenase From Corynebacterium Glutamicum Length = 508 Back     alignment and structure
>pdb|1T90|A Chain A, Crystal Structure Of Methylmalonate Semialdehyde Dehydrogenase From Bacillus Subtilis Length = 486 Back     alignment and structure
>pdb|3RH9|A Chain A, The Crystal Structure Of Oxidoreductase From Marinobacter Aquaeolei Length = 506 Back     alignment and structure
>pdb|3V9H|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352a Length = 566 Back     alignment and structure
>pdb|3V9G|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Length = 566 Back     alignment and structure
>pdb|3V9I|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352l Length = 566 Back     alignment and structure
>pdb|3V9J|A Chain A, Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylate Dehydrogenase Complexed With Sulfate Ion Length = 563 Back     alignment and structure
>pdb|3ROS|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Lactobacillus Acidophilus Length = 484 Back     alignment and structure
>pdb|2O2P|A Chain A, Crystal Structure Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3RHM|A Chain A, Crystal Structure Of The E673q Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3RHJ|A Chain A, Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|3I44|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Bartonella Henselae At 2.0a Resolution Length = 497 Back     alignment and structure
>pdb|3RHR|A Chain A, Crystal Structure Of The C707a Mutant Of The C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadph Length = 517 Back     alignment and structure
>pdb|4GNZ|A Chain A, Crystal Structure Of The C707s Mutant Of C-terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp Length = 517 Back     alignment and structure
>pdb|4DAL|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 498 Back     alignment and structure
>pdb|3RHL|A Chain A, Crystal Structure Of The E673aC707A DOUBLE MUTANT OF THE C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|4E4G|A Chain A, Crystal Structure Of Putative Methylmalonate-Semialdehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 521 Back     alignment and structure
>pdb|4F9I|A Chain A, Crystal Structure Of Proline Utilization A (Puta) From Geobacter Sulfurreducens Pca Length = 1026 Back     alignment and structure
>pdb|3JU8|A Chain A, Crystal Structure Of Succinylglutamic Semialdehyde Dehydrogenase From Pseudomonas Aeruginosa. Length = 490 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 1e-144
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 1e-104
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 3e-42
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 3e-41
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 1e-39
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 2e-38
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 5e-38
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 2e-37
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 1e-36
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 1e-33
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 3e-33
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 3e-33
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 1e-31
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 2e-31
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 3e-31
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 1e-30
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 4e-30
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 4e-30
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 4e-30
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 5e-30
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 6e-30
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 1e-29
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 1e-29
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 1e-29
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 2e-29
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 4e-29
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 2e-28
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 2e-28
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 8e-28
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 4e-27
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 1e-26
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 3e-26
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 3e-26
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 5e-26
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 8e-26
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 2e-25
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 2e-25
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 1e-22
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 2e-20
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 3e-20
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 2e-19
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 7e-19
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 5e-18
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 4e-16
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 6e-16
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 5e-14
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
 Score =  411 bits (1060), Expect = e-144
 Identities = 119/261 (45%), Positives = 169/261 (64%), Gaps = 7/261 (2%)

Query: 1   MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKD 60
           M AAAKHLTPV LELGGKSP   D   +L VACRR+  GK+  N+GQ C++PD+I+    
Sbjct: 213 MTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKF-MNSGQTCVAPDYILCDPS 271

Query: 61  YAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDK 120
              +++E LK  L+ FYG++  +S+D  RI+++ HF R+  L++      K+ +GG  D 
Sbjct: 272 IQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG----QKVAYGGTGDA 327

Query: 121 NKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNK 180
               IAPT+L DV   S +M EEIFGP+LPI+ V  +E++   IN   KPLA Y+F++N 
Sbjct: 328 ATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREKPLALYMFSSND 387

Query: 181 KLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSR 240
           K+ ++ +   S+GG+  ND  VH+ +HSLPFGGV  SGMG+YHGK SF+ FSH+++ L R
Sbjct: 388 KVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVR 447

Query: 241 GFIGD--VPVRYPPYTKGKLR 259
             + D  + VRYPP      +
Sbjct: 448 PLMNDEGLKVRYPPSPAKMTQ 468


>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 100.0
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 100.0
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 100.0
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 100.0
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 100.0
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 100.0
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 100.0
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 100.0
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 100.0
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 100.0
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 100.0
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 100.0
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 100.0
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 100.0
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 100.0
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 100.0
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 100.0
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 100.0
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 100.0
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 100.0
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 100.0
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 100.0
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 100.0
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 100.0
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 100.0
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 100.0
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 100.0
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 100.0
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 100.0
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 100.0
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 100.0
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 100.0
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 100.0
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 100.0
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 100.0
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 100.0
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 100.0
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 100.0
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 100.0
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 100.0
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 100.0
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 100.0
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 100.0
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 100.0
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 100.0
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 100.0
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 100.0
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 100.0
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 100.0
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 100.0
1kae_A434 HDH, histidinol dehydrogenase; L-histidinol dehydr 89.32
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
Probab=100.00  E-value=3.8e-64  Score=475.71  Aligned_cols=252  Identities=46%  Similarity=0.830  Sum_probs=234.5

Q ss_pred             hhhhhcCCcEEEeCCCCCceEEcCCCCHHHHHHHHHHHhcccCCCCccccCCeEEEeCCcHHHHHHHHHHHHhhccCCCC
Q 023415            2 AAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKNP   81 (282)
Q Consensus         2 ~~aa~~~~~~~lElgG~np~iV~~dADl~~aa~~i~~~~~~~~~GQ~C~a~~~v~V~~~i~d~f~~~l~~~~~~~~~g~~   81 (282)
                      ++|++++||+++|||||||+||++|||+|.|++.+++++| .|+||.|++++|||||+++||+|+++|++++++++ |+|
T Consensus       214 ~~aa~~lkpv~lELGGk~p~iV~~dADl~~Aa~~i~~~~~-~n~GQ~C~a~~rvlV~~~i~d~f~~~l~~~~~~~~-g~~  291 (469)
T 3sza_A          214 TAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKF-MNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFY-GED  291 (469)
T ss_dssp             HHHHTTTCCEEEECCCCCEEEECTTSCHHHHHHHHHHHHH-GGGGCCTTSCCEEEECGGGHHHHHHHHHHHHHHHH-CSC
T ss_pred             HHHhhccCceEEecCCCCceEECCCCCHHHHHHHHHHHHH-hcCCCCCCCCcEEEEehhHHHHHHHHHHHHHHHhc-CCC
Confidence            5678999999999999999999999999999999999999 99999999999999999999999999999999986 555


Q ss_pred             -CCCCcccccCCHHHHHHHHHHHHHHHhcCeEeeCCccCCCCceecceEEeeCCCCCcccccccccceeeEEeeCCHHHH
Q 023415           82 -LESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDS  160 (282)
Q Consensus        82 -~~~~~~gpli~~~~~~~i~~~i~~a~~~~~~~~gg~~~~~g~~~~Ptv~~~~~~~~~i~~~E~fgPvl~v~~~~~~~ea  160 (282)
                       ++++++||++++.+++|+++++    +|+++++||..+..|+|++|||+.+++++|++++||+||||++|++|+|+|||
T Consensus       292 ~~~~~~~gpli~~~~~~rv~~~i----~ga~v~~GG~~~~~g~~~~PTvl~~v~~~~~i~~eEiFGPVl~v~~~~~~deA  367 (469)
T 3sza_A          292 AKKSRDYGRIISARHFQRVMGLI----EGQKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEA  367 (469)
T ss_dssp             GGGCTTCCCCSCHHHHHHHHHHH----TTSEEEECCCEETTTTEECCEEEESCCTTSGGGTSCCCSSEEEEEECSSHHHH
T ss_pred             CcccCcccccCCHHHHHHHHHHH----cCCEEEeCCccCCCCceeCCeeecCCCCcchhhhccccCCeEEEEecCCHHHH
Confidence             5789999999999999999998    58899999987778999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCceEEEecCCHHHHHHHHhhcccceEEECCCCcccCCCCCCcccCCCCCCCCcchHHHHHHhhhccEEeEe
Q 023415          161 FDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSR  240 (282)
Q Consensus       161 i~~~n~~~~gL~a~i~t~d~~~~~~~~~~l~~g~v~iN~~~~~~~~~~~pfGG~~~SG~G~~~g~~~l~~~~~~k~v~~~  240 (282)
                      |+++|+++|||+++|||+|.+++++++.++++|.|+||+...+...+.+||||+|.||+|+++|.+++++||+.|+|+++
T Consensus       368 i~~aN~~~~gLaa~v~t~d~~~a~~~~~~l~~G~V~vN~~~~~~~~~~~PfGG~k~SG~Gr~~G~~g~~~ft~~K~v~~~  447 (469)
T 3sza_A          368 IQFINQREKPLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVR  447 (469)
T ss_dssp             HHHHHHSCCCSEEEEECSCHHHHHHHHHHCCCSEEEESCSSGGGSCTTSCBCCCGGGEECCBSTHHHHHHTEEEEEEEEC
T ss_pred             HHHHHcCCCCceEEEECCCHHHHHHHHHhCCcceEEEeCCCCCCCCCCCCcCCccccccCccchHHHHHHhhCeeEEEEC
Confidence            99999999999999999999999999999999999999987666678999999999999999999999999999999999


Q ss_pred             CCCCC--CCCcCCCCchhHHH
Q 023415          241 GFIGD--VPVRYPPYTKGKLR  259 (282)
Q Consensus       241 ~~~~~--~~~~~~~~~~~~~~  259 (282)
                      +++..  .+++||||+.++.+
T Consensus       448 ~~~~~~~~~~~yppy~~~~~~  468 (469)
T 3sza_A          448 PLMNDEGLKVRYPPSPAKMTQ  468 (469)
T ss_dssp             CSSCCGGGGGGSSSCCC----
T ss_pred             CcccccccccccCCCCccccc
Confidence            76544  57899999987654



>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>1kae_A HDH, histidinol dehydrogenase; L-histidinol dehydrogenase, homodimer, rossman fold, 4 domai L-histidine biosynthesis, NAD cofactor; HET: HSO NAD; 1.70A {Escherichia coli} SCOP: c.82.1.2 PDB: 1k75_A* 1kah_A* 1kar_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 282
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-66
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-60
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-60
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 6e-58
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 3e-54
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 1e-48
d1euha_474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 6e-48
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 8e-45
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 2e-16
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-14
d1vlua_436 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 2e-06
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  211 bits (537), Expect = 3e-66
 Identities = 121/256 (47%), Positives = 171/256 (66%), Gaps = 7/256 (2%)

Query: 1   MAAAAKHLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKD 60
           MAAAAKHLTPV LELGGKSP   D   +L VACRR+  GK+  N+GQ C++PD+I+    
Sbjct: 195 MAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKF-MNSGQTCVAPDYILCDPS 253

Query: 61  YAPKLLESLKNELENFYGKNPLESKDLSRIVNSNHFARLSKLLDDDKVSGKIVHGGERDK 120
              +++E LK  L++FYG++  +S+D  RI+N  HF R+  L+D+ KV     HGG  D+
Sbjct: 254 IQNQIVEKLKKSLKDFYGEDAKQSRDYGRIINDRHFQRVKGLIDNQKV----AHGGTWDQ 309

Query: 121 NKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKIEDSFDIINSGTKPLAAYLFTNNK 180
           +   IAPT+L+DV   S +M EEIFGP++PI+ V  +E++   IN   KPLA Y+F+NN+
Sbjct: 310 SSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLEEAIQFINQREKPLALYVFSNNE 369

Query: 181 KLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAVLSR 240
           K+ ++ +   S+GG+  ND  VH+ V +LPFGGV  SGMGAYHGK SF+ FSH+++ L +
Sbjct: 370 KVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVK 429

Query: 241 GFIGDVP--VRYPPYT 254
             + +     RYPP  
Sbjct: 430 SLLNEEAHKARYPPSP 445


>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 100.0
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 100.0
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 100.0
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 100.0
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 100.0
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 100.0
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 100.0
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 100.0
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 100.0
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 99.96
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]
Probab=100.00  E-value=9.6e-59  Score=440.02  Aligned_cols=237  Identities=27%  Similarity=0.430  Sum_probs=224.3

Q ss_pred             hhhhh-cCCcEEEeCCCCCceEEcCCCCHHHHHHHHHHHhcccCCCCccccCCeEEEeCCcHHHHHHHHHHHHhhccCCC
Q 023415            2 AAAAK-HLTPVLLELGGKSPVVFDSGINLKVACRRMIMGKWGCNNGQACISPDHIITTKDYAPKLLESLKNELENFYGKN   80 (282)
Q Consensus         2 ~~aa~-~~~~~~lElgG~np~iV~~dADl~~aa~~i~~~~~~~~~GQ~C~a~~~v~V~~~i~d~f~~~l~~~~~~~~~g~   80 (282)
                      ++|++ ++||+++|||||||+||++|||++.|++.+++++| .|+||.|++++|||||++++|+|+++|++++++++.|+
T Consensus       249 ~~aa~~~~~~~~lElGG~np~iV~~dadl~~a~~~i~~~~~-~~~GQ~C~a~~rv~V~~~~~d~f~~~l~~~~~~~~~g~  327 (494)
T d1bxsa_         249 EAAGKSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQGVF-YHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVLGN  327 (494)
T ss_dssp             HHHHHTTCCEEEEECCCCCEEEECTTSCHHHHHHHHHHHHH-TTTTCCTTCCCEEEEEHHHHHHHHHHHHHHHTCCCBSC
T ss_pred             HHhcccCCCeEEEEcCCcCcEEECcCcchhHhHHHHHHHHh-cCCCcccccceEEecccchhHHHHHHHHhhhhheeeec
Confidence            34564 79999999999999999999999999999999999 99999999999999999999999999999999999999


Q ss_pred             CC-CCCcccccCCHHHHHHHHHHHHHHH-hcCeEeeCCcc-CCCCceecceEEeeCCCCCcccccccccceeeEEeeCCH
Q 023415           81 PL-ESKDLSRIVNSNHFARLSKLLDDDK-VSGKIVHGGER-DKNKLRIAPTLLLDVPRDSLIMSEEIFGPLLPILTVDKI  157 (282)
Q Consensus        81 ~~-~~~~~gpli~~~~~~~i~~~i~~a~-~~~~~~~gg~~-~~~g~~~~Ptv~~~~~~~~~i~~~E~fgPvl~v~~~~~~  157 (282)
                      |. +++++||++++.+++++++++++++ +|+++++||.. ...|+|++|||+.++++++++++||+||||++|++|+|+
T Consensus       328 ~~~~~~~~gpli~~~~~~~~~~~i~~a~~~Ga~~~~gg~~~~~~g~~~~Ptvl~~~~~~~~~~~~E~FGPvl~v~~~~~~  407 (494)
T d1bxsa_         328 PLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSL  407 (494)
T ss_dssp             TTSTTCCBCCCSCHHHHHHHHHHHHHHHHTTCEECSCCSEECSSSCEECCEEEESCCTTSHHHHSCCCSSEEEEEEECCH
T ss_pred             cCCCCCcCCCcCCHHHHHHHHHHHHHHHHcCCEEEeCCCccCCCceeEcCEEEeCCCCCcHHHhccccCceEEEEEECCH
Confidence            85 7899999999999999999999986 57899998875 457899999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCCceEEEecCCHHHHHHHHhhcccceEEECCCCcccCCCCCCcccCCCCCCCCcchHHHHHHhhhccEE
Q 023415          158 EDSFDIINSGTKPLAAYLFTNNKKLKQQFVETVSAGGLVINDTAVHLAVHSLPFGGVQESGMGAYHGKFSFDVFSHKKAV  237 (282)
Q Consensus       158 ~eai~~~n~~~~gL~a~i~t~d~~~~~~~~~~l~~g~v~iN~~~~~~~~~~~pfGG~~~SG~G~~~g~~~l~~~~~~k~v  237 (282)
                      +|||+++|+++|||+++|||+|.++++++++++++|+|+||++..  ..+.+||||+|.||+|+++|.+++++||+.|+|
T Consensus       408 ~eai~~~n~~~~gL~a~i~t~d~~~~~~~~~~l~~G~v~iN~~~~--~~~~~PfGG~~~SG~G~~~g~~~~~~ft~~k~i  485 (494)
T d1bxsa_         408 DDVIKRANNTFYGLSAGIFTNDIDKAITVSSALQSGTVWVNCYSV--VSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTV  485 (494)
T ss_dssp             HHHHHHHHCSSCCSEEEEECSBHHHHHHHHHHSCCSEEEESCCCC--CCTTSCBCCSGGGEESCBSHHHHHHTTEEEEEE
T ss_pred             HHHHHHHhCCCCCCeEEEEeCCHHHHHHHHHhCCEeEEEEcCCCC--cCCCCCcCccccccCChhhHHHHHHHhcceEEE
Confidence            999999999999999999999999999999999999999998764  457899999999999999999999999999999


Q ss_pred             eEeC
Q 023415          238 LSRG  241 (282)
Q Consensus       238 ~~~~  241 (282)
                      +++.
T Consensus       486 ~~~~  489 (494)
T d1bxsa_         486 TIKI  489 (494)
T ss_dssp             EEEC
T ss_pred             EEec
Confidence            9885



>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure