Citrus Sinensis ID: 023507

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MVLIFERSGSFKINTTPMFIIITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGGSREKAFAYIIQNQGIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDEGLCGIGTRSSYPLA
cEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHcccccccccccccHHHHHHHHHHHHcccccccccccccccEEEEccEEccccccEEEEEcccccccccccEEEEEccccccccccccccccc
cEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccHccccHHHHHHHHcccccccccccccccccccccccccccccccEEcccccccccccEccccEcHHHHHHHHHHHHHHHHHHcccccEcHHHHHHHcHHHcccHHHcEcHHHHHHHHHHHccEcccccccccEEEEEEEEEcEEccEEEEEEEccEcccccEccEEEEEccccccccccccEEEEc
mvlifersgsfkinttPMFIIITLLVSCASqvvssrstheQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEgnrtyklgtnqfsdltNDEFRALYtgykmpspshrsttsstfkyqnlsmtdvptsldwrdkgavtpiknqkecgccWAFAAVAAVEGITKIrsgnliqlseqqlldcstngnngclggsREKAFAYIIQNQGifngvcgtqlDHAVTIVgfgttedgANYWLIKnswgntwgdagyMKIVrdeglcgigtrssypla
mvlifersgsfkintTPMFIIITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKAnkegnrtyklgtnqfsdlTNDEFRALYTGykmpspshrsttsstfkyqNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGGSREKAFAYIIQNQGIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDEGlcgigtrssypla
MVLIFERSGSFKINTTPMFIIITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRsttsstFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGGSREKAFAYIIQNQGIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDEGLCGIGTRSSYPLA
**LIFERSGSFKINTTPMFIIITLLVSCASQVVS*******SVVEIHEKWMAQHG*********EMRLKIFKENLEYIEKANK*GNRTYKLGTNQFSDLTNDEFRALYTGY**********************TDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGGSREKAFAYIIQNQGIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDEGLCGIG********
*V*****SGSFKINTTPMFIIITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTG*********************SMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGGSREKAFAYIIQNQGIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDEGLCGIGTRSSYPLA
MVLIFERSGSFKINTTPMFIIITLLVSCAS************VVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKM***********TFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGGSREKAFAYIIQNQGIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDEGLCGIGTRSSYPLA
MVLIFERSGSFKINTTPMFIIITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYK***************YQ*LSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGGSREKAFAYIIQNQGIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDEGLCGIGTRSSYPLA
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLIFERSGSFKINTTPMFIIITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGGSREKAFAYIIQNQGIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDEGLCGIGTRSSYPLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query281 2.2.26 [Sep-21-2011]
P80884345 Ananain OS=Ananas comosus N/A no 0.921 0.750 0.363 6e-57
O23791351 Fruit bromelain OS=Ananas N/A no 0.921 0.737 0.354 7e-57
O65493355 Xylem cysteine proteinase no no 0.850 0.673 0.370 3e-52
P00784345 Papain OS=Carica papaya P N/A no 0.903 0.736 0.375 2e-49
Q94B08376 Germination-specific cyst no no 0.854 0.638 0.345 8e-45
P25251328 Cysteine proteinase COT44 N/A no 0.839 0.719 0.344 4e-43
P25777 466 Oryzain beta chain OS=Ory no no 0.839 0.506 0.335 6e-43
P43297 462 Cysteine proteinase RD21a no no 0.715 0.435 0.425 1e-42
Q9SUS9371 Probable cysteine protein no no 0.928 0.703 0.323 4e-42
Q9LXW3 376 Probable cysteine protein no no 0.729 0.545 0.423 2e-41
>sp|P80884|ANAN_ANACO Ananain OS=Ananas comosus GN=AN1 PE=1 SV=2 Back     alignment and function desciption
 Score =  221 bits (562), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 120/330 (36%), Positives = 168/330 (50%), Gaps = 71/330 (21%)

Query: 18  MFIIITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEY 77
           +F+ + L V  AS   +S       +++  E+WMA++GR YKD  EK +R +IFK N+ +
Sbjct: 8   VFLFLFLCVMWASPSAASCDEPSDPMMKQFEEWMAEYGRVYKDNDEKMLRFQIFKNNVNH 67

Query: 78  IEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRSTTSSTFKYQNLSMTDVP 137
           IE  N     +Y LG NQF+D+TN+EF A YTG  +P    R    S   + ++ ++ VP
Sbjct: 68  IETFNNRNGNSYTLGINQFTDMTNNEFVAQYTGLSLPLNIKREPVVS---FDDVDISSVP 124

Query: 138 TSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLD------- 190
            S+DWRD GAVT +KNQ  CG CWAFA++A VE I KI+ GNL+ LSEQQ+LD       
Sbjct: 125 QSIDWRDSGAVTSVKNQGRCGSCWAFASIATVESIYKIKRGNLVSLSEQQVLDCAVSYGC 184

Query: 191 --------------------------------CSTNGNNGCLGGSR--------EKAFAY 210
                                           C TNG       +R        E+   Y
Sbjct: 185 KGGWINKAYSFIISNKGVASAAIYPYKAAKGTCKTNGVPNSAYITRYTYVQRNNERNMMY 244

Query: 211 IIQNQ-----------------GIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGN 253
            + NQ                 G+F G CGT+L+HA+ I+G+G    G  +W+++NSWG 
Sbjct: 245 AVSNQPIAAALDASGNFQHYKRGVFTGPCGTRLNHAIVIIGYGQDSSGKKFWIVRNSWGA 304

Query: 254 TWGDAGYMKIVRDE----GLCGIGTRSSYP 279
            WG+ GY+++ RD     GLCGI     YP
Sbjct: 305 GWGEGGYIRLARDVSSSFGLCGIAMDPLYP 334

Ananas comosus (taxid: 4615)
EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: 3EC: 1
>sp|O23791|BROM1_ANACO Fruit bromelain OS=Ananas comosus PE=1 SV=1 Back     alignment and function description
>sp|O65493|XCP1_ARATH Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1 Back     alignment and function description
>sp|P00784|PAPA1_CARPA Papain OS=Carica papaya PE=1 SV=1 Back     alignment and function description
>sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2 Back     alignment and function description
>sp|P25251|CYSP4_BRANA Cysteine proteinase COT44 (Fragment) OS=Brassica napus PE=2 SV=1 Back     alignment and function description
>sp|P25777|ORYB_ORYSJ Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2 Back     alignment and function description
>sp|P43297|RD21A_ARATH Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1 Back     alignment and function description
>sp|Q9SUS9|CPR4_ARATH Probable cysteine proteinase At4g11320 OS=Arabidopsis thaliana GN=At4g11320 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXW3|CPR2_ARATH Probable cysteine proteinase At3g43960 OS=Arabidopsis thaliana GN=At3g43960 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
302143414286 unnamed protein product [Vitis vinifera] 0.903 0.888 0.478 1e-68
400180441344 cysteine protease [Solanum habrochaites] 0.950 0.776 0.405 1e-67
302143412320 unnamed protein product [Vitis vinifera] 0.911 0.8 0.439 2e-67
400180435344 cysteine protease [Solanum pennellii] 0.950 0.776 0.408 3e-67
302143411320 unnamed protein product [Vitis vinifera] 0.911 0.8 0.439 3e-67
400180443345 cysteine protease, partial [Solanum habr 0.950 0.773 0.405 3e-67
400180357344 cysteine protease [Solanum peruvianum] 0.950 0.776 0.405 1e-66
400180422344 cysteine protease [Solanum chmielewskii] 0.950 0.776 0.405 1e-66
400180426344 cysteine protease [Solanum corneliomuell 0.950 0.776 0.405 2e-66
400180345344 cysteine protease [Solanum peruvianum] 0.950 0.776 0.405 3e-66
>gi|302143414|emb|CBI21975.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 134/280 (47%), Positives = 188/280 (67%), Gaps = 26/280 (9%)

Query: 21  IITLLVSCASQVVSSRSTHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEK 80
           ++  L + ASQ  ++R+  E S+ E HE WMAQ+GR YKD  EK  R KIFK+N+  IE 
Sbjct: 14  LLFFLAAWASQA-TARNLLEASMYERHEDWMAQYGRVYKDADEKSKRYKIFKDNVARIES 72

Query: 81  ANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHR-STTSSTFKYQNLSMTDVPTS 139
            NK  +++YKL  N+F+DLTN+EFRA    +K    +H  ST +++FKY++++   VP++
Sbjct: 73  FNKAMDKSYKLSINEFADLTNEEFRASRNRFK----AHICSTEATSFKYEHVAA--VPST 126

Query: 140 LDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGC 199
           +DWR KGAVTPIK+Q +CG CWAF+AVAA+EGIT++ +G LI LSEQ+L+DC T  N+  
Sbjct: 127 VDWRKKGAVTPIKDQGQCGSCWAFSAVAAMEGITQLSTGKLISLSEQELVDCDTKQNHAN 186

Query: 200 LGGSREKA--------------FAYIIQNQGIFNGVCGTQLDHAVTIVGFGTTEDGANYW 245
              + +KA              F +   + G+F G CGT+LDH V  VG+GT++DG  YW
Sbjct: 187 NEKALQKAVAHQPIAVAIDAGGFEFQFYSSGVFTGQCGTELDHGVAAVGYGTSDDGMKYW 246

Query: 246 LIKNSWGNTWGDAGYMKIVRD----EGLCGIGTRSSYPLA 281
           L+KNSWG  WG+ GY+++ RD    EGLCGI  ++SYP A
Sbjct: 247 LVKNSWGTGWGEVGYIRMQRDVTAKEGLCGIAMQASYPTA 286

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|400180441|gb|AFP73357.1| cysteine protease [Solanum habrochaites] Back     alignment and taxonomy information
>gi|302143412|emb|CBI21973.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|400180435|gb|AFP73355.1| cysteine protease [Solanum pennellii] Back     alignment and taxonomy information
>gi|302143411|emb|CBI21972.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|400180443|gb|AFP73358.1| cysteine protease, partial [Solanum habrochaites] Back     alignment and taxonomy information
>gi|400180357|gb|AFP73317.1| cysteine protease [Solanum peruvianum] Back     alignment and taxonomy information
>gi|400180422|gb|AFP73349.1| cysteine protease [Solanum chmielewskii] Back     alignment and taxonomy information
>gi|400180426|gb|AFP73351.1| cysteine protease [Solanum corneliomuelleri] Back     alignment and taxonomy information
>gi|400180345|gb|AFP73311.1| cysteine protease [Solanum peruvianum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
TAIR|locus:2038588348 AT2G27420 [Arabidopsis thalian 0.704 0.568 0.502 6.7e-73
TAIR|locus:2055440345 AT2G34080 [Arabidopsis thalian 0.704 0.573 0.5 2.3e-72
TAIR|locus:2152445346 SAG12 "senescence-associated g 0.708 0.575 0.480 3.3e-69
TAIR|locus:2029924355 AT1G29090 [Arabidopsis thalian 0.718 0.569 0.497 6.8e-69
TAIR|locus:2090614 452 AT3G19390 [Arabidopsis thalian 0.729 0.453 0.428 1.4e-62
TAIR|locus:2167821 463 RD21B "esponsive to dehydratio 0.640 0.388 0.442 9.9e-62
TAIR|locus:2117979356 AT4G23520 [Arabidopsis thalian 0.701 0.553 0.414 3.3e-61
TAIR|locus:2157712361 CEP1 "cysteine endopeptidase 1 0.686 0.534 0.4 7.8e-60
TAIR|locus:505006391364 CEP3 "cysteine endopeptidase 3 0.612 0.472 0.448 9.9e-60
TAIR|locus:2030427356 XCP2 "xylem cysteine peptidase 0.626 0.494 0.447 2.3e-58
TAIR|locus:2038588 AT2G27420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 511 (184.9 bits), Expect = 6.7e-73, Sum P(2) = 6.7e-73
 Identities = 104/207 (50%), Positives = 133/207 (64%)

Query:    18 MFIIITLLVSCASQVVSSR-STHEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLE 76
             +  I+T+ +S  + + +SR S  E S +E HE+WMA+  R Y DE EK  R  IFK+NLE
Sbjct:     5 IIFILTIFLSYRTSLATSRGSLFEASAIEKHEQWMARFNRVYSDETEKRNRFNIFKKNLE 64

Query:    77 YIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPSHRXXXXXX------FKYQN 130
             +++  N     TYK+  N+FSDLT++EFRA +TG  +P    R            F+Y N
Sbjct:    65 FVQNFNMNNKITYKVDINEFSDLTDEEFRATHTGLVVPEAITRISTLSSGKNTVPFRYGN 124

Query:   131 LSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLD 190
             +S  D   S+DWR +GAVTP+K Q  CG CWAF+AVAAVEGITKI  G L+ LSEQQLLD
Sbjct:   125 VS--DNGESMDWRQEGAVTPVKYQGRCGGCWAFSAVAAVEGITKITKGELVSLSEQQLLD 182

Query:   191 CSTNGNNGCLGGSREKAFAYIIQNQGI 217
             C  + N GC GG   KAF YII+NQGI
Sbjct:   183 CDRDYNQGCRGGIMSKAFEYIIKNQGI 209
GO:0006508 "proteolysis" evidence=IEA;ISS
GO:0008234 "cysteine-type peptidase activity" evidence=IEA;ISS
TAIR|locus:2055440 AT2G34080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152445 SAG12 "senescence-associated gene 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2029924 AT1G29090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090614 AT3G19390 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2167821 RD21B "esponsive to dehydration 21B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2117979 AT4G23520 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2157712 CEP1 "cysteine endopeptidase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006391 CEP3 "cysteine endopeptidase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2030427 XCP2 "xylem cysteine peptidase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.220.766

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
scaffold_501917.1
annotation not avaliable (304 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
smart00645175 smart00645, Pept_C1, Papain family cysteine protea 5e-68
cd02248210 cd02248, Peptidase_C1A, Peptidase C1A subfamily (M 3e-61
pfam00112213 pfam00112, Peptidase_C1, Papain family cysteine pr 4e-48
PTZ00200448 PTZ00200, PTZ00200, cysteine proteinase; Provision 4e-47
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 1e-37
PTZ00203348 PTZ00203, PTZ00203, cathepsin L protease; Provisio 5e-29
smart0084857 smart00848, Inhibitor_I29, Cathepsin propeptide in 3e-24
pfam0824658 pfam08246, Inhibitor_I29, Cathepsin propeptide inh 5e-22
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 5e-15
cd02620236 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro 6e-15
PTZ00021489 PTZ00021, PTZ00021, falcipain-2; Provisional 9e-15
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 2e-13
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 6e-13
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 2e-12
PTZ00049693 PTZ00049, PTZ00049, cathepsin C-like protein; Prov 9e-12
cd02698239 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th 2e-11
cd02621243 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al 1e-10
cd02619223 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS 6e-10
PTZ00462 1004 PTZ00462, PTZ00462, Serine-repeat antigen protein; 1e-07
PTZ00364548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 1e-06
COG4870 372 COG4870, COG4870, Cysteine protease [Posttranslati 3e-06
COG4870372 COG4870, COG4870, Cysteine protease [Posttranslati 3e-05
PTZ00364 548 PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs 2e-04
>gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease Back     alignment and domain information 
 Score =  208 bits (532), Expect = 5e-68
 Identities = 81/175 (46%), Positives = 106/175 (60%), Gaps = 31/175 (17%)

Query: 136 VPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNG 195
           +P S DWR KGAVTP+K+Q +CG CWAF+A  A+EG   I++G L+ LSEQQL+DCS  G
Sbjct: 1   LPESFDWRKKGAVTPVKDQGQCGSCWAFSATGALEGRYCIKTGKLVSLSEQQLVDCSGGG 60

Query: 196 NNGCLGGSREKAFAYIIQNQ--------------------------GIFNGV-CGT-QLD 227
           N GC GG  + AF YI +N                           GI++   CG+  LD
Sbjct: 61  NCGCNGGLPDNAFEYIKKNGGLETESCYPYTGSVAIDASDFQFYKSGIYDHPGCGSGTLD 120

Query: 228 HAVTIVGFGTT-EDGANYWLIKNSWGNTWGDAGYMKIVRDE-GLCGI-GTRSSYP 279
           HAV IVG+GT  E+G +YW++KNSWG  WG+ GY +I R +   CGI  + +SYP
Sbjct: 121 HAVLIVGYGTEVENGKDYWIVKNSWGTDWGENGYFRIARGKNNECGIEASVASYP 175

Length = 175
>gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease Back     alignment and domain information
>gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional Back     alignment and domain information
>gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional Back     alignment and domain information
>gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 281
KOG1542372 consensus Cysteine proteinase Cathepsin F [Posttra 100.0
PTZ00203348 cathepsin L protease; Provisional 100.0
PTZ00200448 cysteine proteinase; Provisional 100.0
PTZ00021489 falcipain-2; Provisional 100.0
KOG1543325 consensus Cysteine proteinase Cathepsin L [Posttra 100.0
cd02621243 Peptidase_C1A_CathepsinC Cathepsin C; also known a 100.0
cd02698239 Peptidase_C1A_CathepsinX Cathepsin X; the only pap 100.0
smart00645174 Pept_C1 Papain family cysteine protease. 100.0
cd02620236 Peptidase_C1A_CathepsinB Cathepsin B group; compos 100.0
cd02248210 Peptidase_C1A Peptidase C1A subfamily (MEROPS data 100.0
PF00112219 Peptidase_C1: Papain family cysteine protease This 100.0
PTZ00364548 dipeptidyl-peptidase I precursor; Provisional 100.0
PTZ00049693 cathepsin C-like protein; Provisional 100.0
KOG1544470 consensus Predicted cysteine proteinase TIN-ag [Ge 100.0
cd02619223 Peptidase_C1 C1 Peptidase family (MEROPS database 100.0
PTZ00462 1004 Serine-repeat antigen protein; Provisional 100.0
COG4870372 Cysteine protease [Posttranslational modification, 99.93
cd00585 437 Peptidase_C1B Peptidase C1B subfamily (MEROPS data 99.83
PF0824658 Inhibitor_I29: Cathepsin propeptide inhibitor doma 99.72
PF03051 438 Peptidase_C1_2: Peptidase C1-like family This fami 99.66
smart0084857 Inhibitor_I29 Cathepsin propeptide inhibitor domai 99.57
COG3579 444 PepC Aminopeptidase C [Amino acid transport and me 99.08
KOG4128 457 consensus Bleomycin hydrolases and aminopeptidases 97.91
PF0812741 Propeptide_C1: Peptidase family C1 propeptide; Int 96.98
PF05543175 Peptidase_C47: Staphopain peptidase C47; InterPro: 96.85
PF13529144 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 89.47
>KOG1542 consensus Cysteine proteinase Cathepsin F [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=100.00  E-value=2.8e-70  Score=485.82  Aligned_cols=235  Identities=41%  Similarity=0.781  Sum_probs=205.6

Q ss_pred             hHHHHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHHHhcCCCCceEEecccCCCCCHHHHHHHHcCCCCC-CCCCC
Q 023507           41 QSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMP-SPSHR  119 (281)
Q Consensus        41 ~~~~~~f~~f~~~~~K~Y~s~~E~~~R~~~F~~Nl~~I~~~N~~~~~s~~~g~N~FsDlt~eE~~~~~~g~~~~-~~~~~  119 (281)
                      ....+.|..|+.+|+|+|.+.+|...|+.+|+.|+..+++++.+...+.+.|+|+|+|||+|||++++++.+.. .....
T Consensus        65 l~~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~~~~  144 (372)
T KOG1542|consen   65 LGLEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSKLPG  144 (372)
T ss_pred             cchHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHHHHHhhccccccccCcc
Confidence            44588999999999999999999999999999999999999886556999999999999999999999877653 11111


Q ss_pred             CCCCccccccCCCCCCCCCceeccCCCCcCcccCCCCcchhHHHHHHHHHHHHHHHHcCCCCCCCHHHHhhhcCCCCCCC
Q 023507          120 STTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGC  199 (281)
Q Consensus       120 ~~~~~~~~~~~~~~~~lP~~~Dwr~~g~v~pv~dQg~cgsCwAfa~~~~le~~~~~~~~~~~~lS~q~l~dc~~~~~~gC  199 (281)
                      .....+  .  .+...+|++||||++|.||||||||.||||||||+++++|++++++++++++||+|+|+||+. .++||
T Consensus       145 ~~~~~~--~--~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~-~d~gC  219 (372)
T KOG1542|consen  145 DAAEAP--I--EPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDS-CDNGC  219 (372)
T ss_pred             ccccCc--C--CCCCCCCcccchhccCCccccccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhhhcccC-cCCcC
Confidence            111111  1  122489999999999999999999999999999999999999999999999999999999999 79999


Q ss_pred             CCCcchhhHHHHHhcC----------------------------------------------------------------
Q 023507          200 LGGSREKAFAYIIQNQ----------------------------------------------------------------  215 (281)
Q Consensus       200 ~GG~~~~a~~~~~~~g----------------------------------------------------------------  215 (281)
                      +||.+..|++|+++.|                                                                
T Consensus       220 ~GGl~~nA~~~~~~~gGL~~E~dYPY~g~~~~~C~~~~~~~~v~I~~f~~l~~nE~~ia~wLv~~GPi~vgiNa~~mQ~Y  299 (372)
T KOG1542|consen  220 NGGLMDNAFKYIKKAGGLEKEKDYPYTGKKGNQCHFDKSKIVVSIKDFSMLSNNEDQIAAWLVTFGPLSVGINAKPMQFY  299 (372)
T ss_pred             CCCChhHHHHHHHHhCCccccccCCccccCCCccccchhhceEEEeccEecCCCHHHHHHHHHhcCCeEEEEchHHHHHh
Confidence            9999999999976655                                                                


Q ss_pred             --ceecC---ccCCC-CCceEEEEEeeecCCCccEEEEEcCCCCCCCCCcEEEEEcCCCccccCCceeeee
Q 023507          216 --GIFNG---VCGTQ-LDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDEGLCGIGTRSSYPL  280 (281)
Q Consensus       216 --Giy~~---~~~~~-~~Hav~iVGy~~~~~g~~ywivkNSWG~~WG~~Gy~~i~~~~~~Cgi~~~~~~~~  280 (281)
                        ||..+   .|+.. ++|+|+|||||...-.++|||||||||++|||+||+|+.||.|.|||+++++-+.
T Consensus       300 rgGV~~P~~~~Cs~~~~~HaVLlvGyG~~g~~~PYWIVKNSWG~~WGE~GY~~l~RG~N~CGi~~mvss~~  370 (372)
T KOG1542|consen  300 RGGVSCPSKYICSPKLLNHAVLLVGYGSSGYEKPYWIVKNSWGTSWGEKGYYKLCRGSNACGIADMVSSAA  370 (372)
T ss_pred             cccccCCCcccCCccccCceEEEEeecCCCCCCceEEEECCccccccccceEEEeccccccccccchhhhh
Confidence              88887   38875 9999999999987227899999999999999999999999999999999988664

>PTZ00203 cathepsin L protease; Provisional Back     alignment and domain information
>PTZ00200 cysteine proteinase; Provisional Back     alignment and domain information
>PTZ00021 falcipain-2; Provisional Back     alignment and domain information
>KOG1543 consensus Cysteine proteinase Cathepsin L [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access Back     alignment and domain information
>cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity Back     alignment and domain information
>smart00645 Pept_C1 Papain family cysteine protease Back     alignment and domain information
>cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) Back     alignment and domain information
>cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) Back     alignment and domain information
>PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification Back     alignment and domain information
>PTZ00364 dipeptidyl-peptidase I precursor; Provisional Back     alignment and domain information
>PTZ00049 cathepsin C-like protein; Provisional Back     alignment and domain information
>KOG1544 consensus Predicted cysteine proteinase TIN-ag [General function prediction only] Back     alignment and domain information
>cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) Back     alignment and domain information
>PTZ00462 Serine-repeat antigen protein; Provisional Back     alignment and domain information
>COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) Back     alignment and domain information
>PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) Back     alignment and domain information
>COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4128 consensus Bleomycin hydrolases and aminopeptidases of cysteine protease family [Amino acid transport and metabolism] Back     alignment and domain information
>PF08127 Propeptide_C1: Peptidase family C1 propeptide; InterPro: IPR012599 This domain is found at the N-terminal of cathepsin B and cathepsin B-like peptidases that belong to MEROPS peptidase subfamily C1A Back     alignment and domain information
>PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
3tnx_A363 Structure Of The Precursor Of A Thermostable Varian 3e-47
1pci_A322 Procaricain Length = 322 4e-38
1pci_A322 Procaricain Length = 322 9e-09
1pip_A212 Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al 2e-31
1ppp_A212 Crystal Structure Of Papain-E64-C Complex. Binding 3e-31
1khp_A212 Monoclinic Form Of Papain/zlfg-dam Covalent Complex 3e-31
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 1e-30
2c0y_A315 The Crystal Structure Of A Cys25ala Mutant Of Human 3e-10
2cio_A212 The High Resolution X-Ray Structure Of Papain Compl 2e-30
1stf_E212 The Refined 2.4 Angstroms X-Ray Crystal Structure O 2e-30
1iwd_A215 Proposed Amino Acid Sequence And The 1.63 Angstrom 2e-30
3ima_A212 Complex Strcuture Of Tarocystatin And Papain Length 5e-30
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 1e-29
1cs8_A316 Crystal Structure Of Procathepsin L Length = 316 3e-11
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 6e-29
1cjl_A312 Crystal Structure Of A Cysteine Protease Proform Le 5e-12
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 1e-28
7pck_A314 Crystal Structure Of Wild Type Human Procathepsin K 2e-08
3qj3_A331 Structure Of Digestive Procathepsin L2 Proteinase F 9e-28
3qj3_A331 Structure Of Digestive Procathepsin L2 Proteinase F 4e-10
3hwn_A258 Cathepsin L With Az13010160 Length = 258 5e-25
3hwn_A258 Cathepsin L With Az13010160 Length = 258 4e-11
2fo5_A 262 Crystal Structure Of Recombinant Barley Cysteine En 2e-24
2fo5_A262 Crystal Structure Of Recombinant Barley Cysteine En 6e-20
1cqd_A221 The 2.1 Angstrom Structure Of A Cysteine Protease W 2e-24
1cqd_A221 The 2.1 Angstrom Structure Of A Cysteine Protease W 9e-13
2pns_A208 1.9 Angstrom Resolution Crystal Structure Of A Plan 3e-23
2pns_A208 1.9 Angstrom Resolution Crystal Structure Of A Plan 9e-12
1o0e_A208 1.9 Angstrom Crystal Structure Of A Plant Cysteine 3e-23
1o0e_A208 1.9 Angstrom Crystal Structure Of A Plant Cysteine 1e-13
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 3e-23
3qt4_A329 Structure Of Digestive Procathepsin L 3 Of Tenebrio 3e-11
3bcn_A209 Crystal Structure Of A Papain-Like Cysteine Proteas 5e-23
3bcn_A209 Crystal Structure Of A Papain-Like Cysteine Proteas 1e-12
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 1e-22
1s4v_A229 The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst 5e-19
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 5e-22
2o6x_A310 Crystal Structure Of Procathepsin L1 From Fasciola 6e-12
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 2e-21
1fh0_A221 Crystal Structure Of Human Cathepsin V Complexed Wi 2e-11
2bdz_A214 Mexicain From Jacaratia Mexicana Length = 214 2e-21
2bdz_A214 Mexicain From Jacaratia Mexicana Length = 214 1e-12
1meg_A216 Crystal Structure Of A Caricain D158e Mutant In Com 3e-21
1meg_A216 Crystal Structure Of A Caricain D158e Mutant In Com 1e-09
1ppo_A216 Determination Of The Structure Of Papaya Protease O 3e-21
1ppo_A216 Determination Of The Structure Of Papaya Protease O 4e-10
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 4e-21
1ms6_A222 Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L 5e-10
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 5e-21
2fye_A217 Mutant Human Cathepsin S With Irreversible Inhibito 6e-10
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 5e-21
2fq9_A225 Cathepsin S With Nitrile Inhibitor Length = 225 7e-10
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 5e-21
3ovx_A218 Cathepsin S In Complex With A Covalent Inhibitor Wi 6e-10
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 5e-21
3n3g_A217 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri 6e-10
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 5e-21
2g6d_A217 Human Cathepsin S Mutant With Vinyl Sulfone Inhibit 6e-10
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 5e-21
2f1g_A220 Cathepsin S In Complex With Non-Covalent 2-(Benzoxa 6e-10
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 6e-21
1npz_A217 Crystal Structures Of Cathepsin S Inhibitor Complex 6e-10
3of8_A221 Structural Basis For Reversible And Irreversible In 7e-21
3of8_A221 Structural Basis For Reversible And Irreversible In 6e-11
1icf_A175 Crystal Structure Of Mhc Class Ii Associated P41 Ii 9e-21
3h89_A220 A Combined Crystallographic And Molecular Dynamics 1e-20
3h89_A220 A Combined Crystallographic And Molecular Dynamics 7e-11
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 1e-20
3hha_A220 Crystal Structure Of Cathepsin L In Complex With Az 6e-11
3f75_A224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 2e-20
3f75_A224 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 7e-13
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 2e-20
3h6s_A221 Strucure Of Clitocypin - Cathepsin V Complex Length 2e-11
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 4e-20
3p5w_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 4e-18
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 6e-20
1glo_A217 Crystal Structure Of Cys25ser Mutant Of Human Cathe 6e-10
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 6e-20
3mpe_A220 Crystal Structure Of Human Cathepsin-S C25s Mutant 6e-10
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 6e-20
2nqd_B221 Crystal Structure Of Cysteine Protease Inhibitor, C 5e-11
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 6e-20
3kwn_A219 Cathepsin S In Complex With Thioether Acetamide P3 6e-10
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 7e-20
3iej_A222 Pyrazole-Based Cathepsin S Inhibitors With Arylalky 6e-10
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 8e-20
1aec_A218 Crystal Structure Of Actinidin-E-64 Complex+ Length 4e-18
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 9e-20
3iv2_A220 Crystal Structure Of Mature Apo-Cathepsin L C25a Mu 6e-11
1yal_A218 Carica Papaya Chymopapain At 1.7 Angstroms Resoluti 1e-19
1yal_A218 Carica Papaya Chymopapain At 1.7 Angstroms Resoluti 2e-16
1mhw_A175 Design Of Non-covalent Inhibitors Of Human Cathepsi 1e-19
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 1e-19
3kse_A220 Unreduced Cathepsin L In Complex With Stefin A Leng 6e-11
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 1e-19
3bc3_A220 Exploring Inhibitor Binding At The S Subsites Of Ca 6e-11
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 1e-19
3h7d_A215 The Crystal Structure Of The Cathepsin K Variant M5 7e-09
1gec_E216 Glycyl Endopeptidase-complex With Benzyloxycarbonyl 3e-19
1gec_E216 Glycyl Endopeptidase-complex With Benzyloxycarbonyl 1e-09
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 3e-19
2f7d_A215 A Mutant Rabbit Cathepsin K With A Nitrile Inhibito 2e-08
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 3e-19
1u9v_A217 Crystal Structure Of The Cysteine Protease Human Ca 2e-08
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 3e-19
1mem_A215 Crystal Structure Of Cathepsin K Complexed With A P 2e-08
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 3e-19
1snk_A214 Cathepsin K Complexed With Carbamate Derivatized No 2e-08
2act_A220 Crystallographic Refinement Of The Structure Of Act 5e-19
2act_A220 Crystallographic Refinement Of The Structure Of Act 2e-17
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 5e-19
3p5u_A220 Actinidin From Actinidia Arguta Planch (Sarusashi) 4e-18
3u8e_A222 Crystal Structure Of Cysteine Protease From Bulbs O 6e-19
3u8e_A222 Crystal Structure Of Cysteine Protease From Bulbs O 2e-09
2vhs_A217 Cathsilicatein, A Chimera Length = 217 7e-19
2vhs_A217 Cathsilicatein, A Chimera Length = 217 2e-10
8pch_A220 Crystal Structure Of Porcine Cathepsin H Determined 9e-19
8pch_A220 Crystal Structure Of Porcine Cathepsin H Determined 5e-10
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 3e-18
1vsn_A215 Crystal Structure Of A Potent Small Molecule Inhibi 6e-09
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 3e-18
3ovz_A213 Cathepsin K In Complex With A Covalent Inhibitor Wi 2e-08
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 2e-16
2p7u_A215 The Crystal Structure Of Rhodesain, The Major Cyste 1e-07
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 2e-15
2b1m_A246 Crystal Structure Of A Papain-Fold Protein Without 8e-10
1yvb_A241 The Plasmodium Falciparum Cysteine Protease Falcipa 4e-15
1yvb_A241 The Plasmodium Falciparum Cysteine Protease Falcipa 3e-12
3ioq_A213 Crystal Structure Of The Carica Candamarcensis Cyst 6e-15
3ioq_A213 Crystal Structure Of The Carica Candamarcensis Cyst 1e-11
3bpm_A243 Crystal Structure Of Falcipain-3 With Its Inhibitor 7e-15
3bpm_A243 Crystal Structure Of Falcipain-3 With Its Inhibitor 4e-09
3pnr_A240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 4e-14
3pnr_A240 Structure Of Pbicp-C In Complex With Falcipain-2 Le 2e-12
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 3e-13
1aim_A215 Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor 7e-06
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 3e-13
1ewp_A215 Cruzain Bound To Mor-Leu-Hpq Length = 215 1e-06
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 6e-13
3iut_A221 The Crystal Structure Of Cruzain In Complex With A 7e-07
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 6e-13
3hd3_A215 High Resolution Crystal Structure Of Cruzain Bound 7e-07
3d6s_A223 Crystal Structure Of Mite Allergen Der F 1 Length = 4e-12
3d6s_A223 Crystal Structure Of Mite Allergen Der F 1 Length = 3e-07
1xkg_A312 Crystal Structure Of The Major House Dust Mite Alle 2e-11
1xkg_A312 Crystal Structure Of The Major House Dust Mite Alle 3e-05
3rvw_A222 Crystal Structure Of Der P 1 Complexed With Fab 4c1 3e-10
3rvw_A222 Crystal Structure Of Der P 1 Complexed With Fab 4c1 5e-05
2as8_A222 Crystal Structure Of Mature And Fully Active Der P 4e-10
2as8_A222 Crystal Structure Of Mature And Fully Active Der P 5e-05
1pbh_A317 Crystal Structure Of Human Recombinant Procathepsin 1e-09
3ai8_B256 Cathepsin B In Complex With The Nitroxoline Length 2e-09
3cbj_A266 Chagasin-cathepsin B Complex Length = 266 2e-09
1gmy_A261 Cathepsin B Complexed With Dipeptidyl Nitrile Inhib 2e-09
3k9m_A254 Cathepsin B In Complex With Stefin A Length = 254 2e-09
1huc_B205 The Refined 2.15 Angstroms X-Ray Crystal Structure 3e-09
1qdq_A253 X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 3e-09
1ito_A256 Crystal Structure Analysis Of Bovine Spleen Catheps 4e-09
1sp4_B205 Crystal Structure Of Ns-134 In Complex With Bovine 4e-09
3f5v_A222 C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 7e-09
3f5v_A222 C2 Crystal Form Of Mite Allergen Der P 1 Length = 2 5e-05
1deu_A277 Crystal Structure Of Human Procathepsin X: A Cystei 8e-09
1m6d_A214 Crystal Structure Of Human Cathepsin F Length = 214 1e-08
1ef7_A242 Crystal Structure Of Human Cathepsin X Length = 242 1e-08
1k3b_C69 Crystal Structure Of Human Dipeptidyl Peptidase I ( 2e-08
3mor_A317 Crystal Structure Of Cathepsin B From Trypanosoma B 2e-08
3hhi_A325 Crystal Structure Of Cathepsin B From T. Brucei In 2e-08
4hwy_A340 Trypanosoma Brucei Procathepsin B Solved From 40 Fs 2e-08
3f75_P106 Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In 3e-08
1mir_A322 Rat Procathepsin B Length = 322 3e-08
1cpj_A260 Crystal Structures Of Recombinant Rat Cathepsin B A 4e-08
1cte_A254 Crystal Structures Of Recombinant Rat Cathepsin B A 4e-08
3pdf_A441 Discovery Of Novel Cyanamide-Based Inhibitors Of Ca 5e-08
3qsd_A254 Structure Of Cathepsin B1 From Schistosoma Mansoni 7e-08
1jqp_A438 Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric 9e-08
1k3b_B164 Crystal Structure Of Human Dipeptidyl Peptidase I ( 3e-07
2wbf_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 2e-06
3ch2_X265 Crystal Structure Analysis Of Sera5e From Plasmodiu 2e-06
1icf_B42 Crystal Structure Of Mhc Class Ii Associated P41 Ii 7e-06
>pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 Back     alignment and structure 
Iteration: 1

 Score =  185 bits (469), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 116/314 (36%), Positives = 160/314 (50%), Gaps = 80/314 (25%)
Query: 38  THEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFS 97
           T  + ++++ E WM +H + YK+  EK  R +IFK+NL+YI++ NK+ N +Y LG N F+
Sbjct: 57  TSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKK-NNSYWLGLNVFA 115
Query: 98  DLTNDEFRALYTGYKMPSPSHRXXXXXXFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKEC 157
           D++NDEF+  YTG    + ++        +  N    ++P  +DWR KGAVTP+KNQ  C
Sbjct: 116 DMSNDEFKEKYTG--SIAGNYTTTELSYEEVLNDGDVNIPEYVDWRQKGAVTPVKNQGSC 173
Query: 158 GCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGG--------------- 202
           G  WAF+AV+ +E I KIR+GNL + SEQ+LLDC    + GC GG               
Sbjct: 174 GSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDRR-SYGCNGGYPWSALQLVAQYGIH 232
Query: 203 ---------------SREK-------------------AFAYIIQNQ------------- 215
                          SREK                   A  Y I NQ             
Sbjct: 233 YRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDF 292
Query: 216 -----GIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVR----D 266
                GIF G CG ++DHAV  VG+     G NY LI+NSWG  WG+ GY++I R     
Sbjct: 293 QLYRGGIFVGPCGNKVDHAVAAVGY-----GPNYILIRNSWGTGWGENGYIRIKRGTGNS 347
Query: 267 EGLCGIGTRSSYPL 280
            G+CG+ T S YP+
Sbjct: 348 YGVCGLYTSSFYPV 361
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure
>pdb|1PCI|A Chain A, Procaricain Length = 322 Back     alignment and structure
>pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 Back     alignment and structure
>pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 Back     alignment and structure
>pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 Back     alignment and structure
>pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 Back     alignment and structure
>pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 Back     alignment and structure
>pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 Back     alignment and structure
>pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 Back     alignment and structure
>pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 Back     alignment and structure
>pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure
>pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 Back     alignment and structure
>pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 Back     alignment and structure
>pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 Back     alignment and structure
>pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 Back     alignment and structure
>pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 Back     alignment and structure
>pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 Back     alignment and structure
>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 Back     alignment and structure
>pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 Back     alignment and structure
>pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 Back     alignment and structure
>pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 Back     alignment and structure
>pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 Back     alignment and structure
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure
>pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 Back     alignment and structure
>pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 Back     alignment and structure
>pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 Back     alignment and structure
>pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 Back     alignment and structure
>pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 Back     alignment and structure
>pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 Back     alignment and structure
>pdb|1XKG|A Chain A, Crystal Structure Of The Major House Dust Mite Allergen Der P 1 In Its Pro Form At 1.61 A Resolution Length = 312 Back     alignment and structure
>pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 Back     alignment and structure
>pdb|3RVW|A Chain A, Crystal Structure Of Der P 1 Complexed With Fab 4c1 Length = 222 Back     alignment and structure
>pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 Back     alignment and structure
>pdb|2AS8|A Chain A, Crystal Structure Of Mature And Fully Active Der P 1 Allergen Length = 222 Back     alignment and structure
>pdb|1PBH|A Chain A, Crystal Structure Of Human Recombinant Procathepsin B At 3.2 Angstrom Resolution Length = 317 Back     alignment and structure
>pdb|3AI8|B Chain B, Cathepsin B In Complex With The Nitroxoline Length = 256 Back     alignment and structure
>pdb|3CBJ|A Chain A, Chagasin-cathepsin B Complex Length = 266 Back     alignment and structure
>pdb|1GMY|A Chain A, Cathepsin B Complexed With Dipeptidyl Nitrile Inhibitor Length = 261 Back     alignment and structure
>pdb|3K9M|A Chain A, Cathepsin B In Complex With Stefin A Length = 254 Back     alignment and structure
>pdb|1HUC|B Chain B, The Refined 2.15 Angstroms X-Ray Crystal Structure Of Human Liver Cathepsin B: The Structural Basis For Its Specificity Length = 205 Back     alignment and structure
>pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 Back     alignment and structure
>pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 Back     alignment and structure
>pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 Back     alignment and structure
>pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 Back     alignment and structure
>pdb|3F5V|A Chain A, C2 Crystal Form Of Mite Allergen Der P 1 Length = 222 Back     alignment and structure
>pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 Back     alignment and structure
>pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 Back     alignment and structure
>pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 Back     alignment and structure
>pdb|1K3B|C Chain C, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 69 Back     alignment and structure
>pdb|3MOR|A Chain A, Crystal Structure Of Cathepsin B From Trypanosoma Brucei Length = 317 Back     alignment and structure
>pdb|3HHI|A Chain A, Crystal Structure Of Cathepsin B From T. Brucei In Complex With Ca074 Length = 325 Back     alignment and structure
>pdb|4HWY|A Chain A, Trypanosoma Brucei Procathepsin B Solved From 40 Fs Free-electron Laser Pulse Data By Serial Femtosecond X-ray Crystallography Length = 340 Back     alignment and structure
>pdb|3F75|P Chain P, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 106 Back     alignment and structure
>pdb|1MIR|A Chain A, Rat Procathepsin B Length = 322 Back     alignment and structure
>pdb|1CPJ|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 260 Back     alignment and structure
>pdb|1CTE|A Chain A, Crystal Structures Of Recombinant Rat Cathepsin B And A Cathepsin B-Inhibitor Complex: Implications For Structure- Based Inhibitor Design Length = 254 Back     alignment and structure
>pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 Back     alignment and structure
>pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 Back     alignment and structure
>pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 Back     alignment and structure
>pdb|1K3B|B Chain B, Crystal Structure Of Human Dipeptidyl Peptidase I (Cathepsin C): Exclusion Domain Added To An Endopeptidase Framework Creates The Machine For Activation Of Granular Serine Proteases Length = 164 Back     alignment and structure
>pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 Back     alignment and structure
>pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 Back     alignment and structure
>pdb|1ICF|B Chain B, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 42 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 5e-93
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 4e-29
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 1e-91
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 8e-26
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 1e-91
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 1e-28
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 1e-90
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 6e-27
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 3e-89
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 9e-25
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 2e-87
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 2e-25
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 3e-83
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 5e-26
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 1e-82
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 5e-28
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 6e-67
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 7e-67
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 4e-66
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 8e-56
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 1e-54
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 1e-22
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 2e-52
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 2e-29
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 1e-51
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 2e-31
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 1e-51
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 4e-30
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 3e-51
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 4e-32
1cqd_A221 Protein (protease II); cysteine protease, glycopro 1e-50
1cqd_A221 Protein (protease II); cysteine protease, glycopro 2e-30
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 2e-50
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 2e-30
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 4e-50
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 7e-31
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 5e-49
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 9e-29
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 8e-49
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 7e-28
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 2e-48
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 2e-26
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 5e-48
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 7e-33
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 5e-48
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 2e-30
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 9e-48
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 3e-25
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 2e-47
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 3e-28
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 3e-47
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 2e-30
3hhi_A 325 Cathepsin B-like cysteine protease; occluding loop 1e-46
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 6e-24
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 6e-46
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 7e-31
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 6e-46
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 2e-29
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 2e-44
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 1e-32
3u8e_A222 Papain-like cysteine protease; papain-like cystein 1e-40
3u8e_A222 Papain-like cysteine protease; papain-like cystein 9e-25
2wbf_X 265 Serine-repeat antigen protein; SERA, malaria, vacu 7e-40
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 1e-25
3pbh_A 317 Procathepsin B; thiol protease, cysteine protease, 2e-39
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 3e-23
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 7e-36
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 1e-35
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 2e-23
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 1e-33
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 5e-25
3cbj_A 266 Cathepsin B; cathepsin B, occluding loop, chagas d 5e-29
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 5e-23
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 3e-28
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 6e-16
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 6e-26
3pw3_A383 Aminopeptidase C; bleomycin, cysteine proteinase f 9e-08
3pw3_A 383 Aminopeptidase C; bleomycin, cysteine proteinase f 3e-06
2e01_A457 Cysteine proteinase 1; bleomycin hydrolase, thiol 8e-04
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
 Score =  276 bits (709), Expect = 5e-93
 Identities = 82/210 (39%), Positives = 122/210 (58%), Gaps = 18/210 (8%)

Query: 38  THEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFS 97
           T  + ++++   WM  H + Y++  EK  R +IFK+NL YI++ NK+ N +Y LG N+F+
Sbjct: 13  TSTERLIQLFNSWMLNHNKFYENVDEKLYRFEIFKDNLNYIDETNKK-NNSYWLGLNEFA 71

Query: 98  DLTNDEFRALYTGYKMPSPSHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKEC 157
           DL+NDEF   Y G  + +   +S      ++ N  + ++P ++DWR KGAVTP+++Q  C
Sbjct: 72  DLSNDEFNEKYVGSLIDATIEQSYDE---EFINEDIVNLPENVDWRKKGAVTPVRHQGSC 128

Query: 158 GCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNNGCLGGSREKAFAYIIQNQGI 217
           G CWAF+AVA VEGI KIR+G L++LSEQ+L+DC    ++GC GG    A  Y+ +N GI
Sbjct: 129 GSCWAFSAVATVEGINKIRTGKLVELSEQELVDCER-RSHGCKGGYPPYALEYVAKN-GI 186

Query: 218 ----------FNGVC--GTQLDHAVTIVGF 235
                       G C         V   G 
Sbjct: 187 HLRSKYPYKAKQGTCRAKQVGGPIVKTSGV 216
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 Back     alignment and structure
>3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 Back     alignment and structure
>3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Length = 80 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Length = 383 Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Length = 457 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
3tnx_A363 Papain; hydrolase, cytoplasm for recombinant expre 100.0
3qj3_A331 Cathepsin L-like protein; hydrolase, proteinase, l 100.0
3qt4_A329 Cathepsin-L-like midgut cysteine proteinase; hydro 100.0
1pci_A322 Procaricain; zymogen, hydrolase, thiol protease; 3 100.0
1by8_A314 Protein (procathepsin K); hydrolase(sulfhydryl pro 100.0
2c0y_A315 Procathepsin S; proenzyme, proteinase, hydrolase, 100.0
1cs8_A316 Human procathepsin L; prosegment, propeptide, inhi 100.0
2o6x_A310 Procathepsin L1, secreted cathepsin L 1; hydrolase 100.0
1xkg_A312 DER P I, major mite fecal allergen DER P 1; major 100.0
3pdf_A441 Cathepsin C, dipeptidyl peptidase 1; two domains, 100.0
3hhi_A325 Cathepsin B-like cysteine protease; occluding loop 100.0
3pbh_A317 Procathepsin B; thiol protease, cysteine protease, 100.0
3p5u_A220 Actinidin; SAD, cysteine proteinases, hydrolase; 1 100.0
3kwz_A215 Cathepsin K; enzyme inhibitor, covalent reversible 100.0
3i06_A215 Cruzipain; autocatalytic cleavage, glycoprotein, p 100.0
1ppo_A216 Protease omega; hydrolase(thiol protease); 1.80A { 100.0
1iwd_A215 Ervatamin B; cysteine protease, alpha-beta protein 100.0
3ovx_A218 Cathepsin S; hydrolase, covalent inhibitor, aldehy 100.0
1cqd_A221 Protein (protease II); cysteine protease, glycopro 100.0
1yal_A218 Chymopapain; hydrolase, thiol protease; 1.70A {Car 100.0
1s4v_A229 Cysteine endopeptidase; KDEL ER retention signal, 100.0
1m6d_A214 Cathepsin F, catsf; papain family cysteine proteas 100.0
3f75_A224 Toxopain-2, cathepsin L protease; medical structur 100.0
3ioq_A213 CMS1MS2; caricaceae, cysteine protease, papain fam 100.0
8pch_A220 Cathepsin H; hydrolase, protease, cysteine protein 100.0
2xu3_A220 Cathepsin L1; hydrolase, drug design, thiol protea 100.0
2cio_A212 Papain; hydrolase/inhibitor, complex hydrolase/inh 100.0
3f5v_A222 DER P 1 allergen; allergy, asthma, DUST mites, gly 100.0
2fo5_A262 Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst 100.0
1o0e_A208 Ervatamin C; plant cysteine protease, two domain, 100.0
3u8e_A222 Papain-like cysteine protease; papain-like cystein 100.0
2bdz_A214 Mexicain; cysteine protease, peptidase_C1, papain- 100.0
2oul_A241 Falcipain 2; cysteine protease, inhibitor, macromo 100.0
2b1m_A246 SPE31; papain-like, sugar binding protein; HET: NA 100.0
3bwk_A243 Cysteine protease falcipain-3; malaria, hydrolase; 100.0
3qsd_A254 Cathepsin B-like peptidase (C01 family); cysteine 100.0
3cbj_A266 Cathepsin B; cathepsin B, occluding loop, chagas d 100.0
1deu_A277 Procathepsin X; cysteine protease, proregion, pros 100.0
2wbf_X265 Serine-repeat antigen protein; SERA, malaria, vacu 100.0
3ois_A291 Cysteine protease; alpha and beta, hydrolase; HET: 100.0
2e01_A 457 Cysteine proteinase 1; bleomycin hydrolase, thiol 100.0
2cb5_A 453 Protein (bleomycin hydrolase); aminopeptidase, cys 99.98
3pw3_A 383 Aminopeptidase C; bleomycin, cysteine proteinase f 99.97
3f75_P106 Toxopain-2, cathepsin L propeptide; medical struct 99.8
2l95_A80 Crammer, LP06209P; cysteine proteinase inhibitor, 99.74
1pxv_A183 Cysteine protease; hydrolase; 1.80A {Staphylococcu 97.31
1cv8_A174 Staphopain; cysteine protease, thiol protease, pap 97.18
1x9y_A367 Cysteine proteinase; half-barrel, barrel-sandwich- 97.01
>3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} Back     alignment and structure
Probab=100.00  E-value=9.5e-73  Score=521.80  Aligned_cols=235  Identities=46%  Similarity=0.868  Sum_probs=208.1

Q ss_pred             CChhHHHHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHHHhcCCCCceEEecccCCCCCHHHHHHHHcCCCCCCCC
Q 023507           38 THEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKEGNRTYKLGTNQFSDLTNDEFRALYTGYKMPSPS  117 (281)
Q Consensus        38 ~~~~~~~~~f~~f~~~~~K~Y~s~~E~~~R~~~F~~Nl~~I~~~N~~~~~s~~~g~N~FsDlt~eE~~~~~~g~~~~~~~  117 (281)
                      ..++.+.++|++|+++|+|+|.+.+|+.+|+++|++|+++|++||++ +.+|++|+|+|+|||.+||++++++..++...
T Consensus        57 ~s~~~~~~lf~~f~~~~~K~Y~~~~E~~~R~~iF~~Nl~~I~~~N~~-~~sy~~g~N~FaDlT~eEf~~~~~~~~~~~~~  135 (363)
T 3tnx_A           57 TSTERLIQLFESWMLKHNKIYKNIDEKIYRFEIFKDNLKYIDETNKK-NNSYWLGLNVFADMSNDEFKEKYTGSIAGNYT  135 (363)
T ss_dssp             SCHHHHHHHHHHHHHHTTCCCSSHHHHHHHHHHHHHHHHHHHHHTTS-CCSEEECSCTTTTSCHHHHHHHHSCSSCSCCC
T ss_pred             cCHHHHHHHHHHHHHHcCCcCCCHHHHHHHHHHHHHHHHHHHHHHcC-CCCeEEeccccccCCHHHHHHHhccccccccc
Confidence            45788999999999999999999999999999999999999999984 67999999999999999999999876553322


Q ss_pred             CCCCCCccccccCCCCCCCCCceeccCCCCcCcccCCCCcchhHHHHHHHHHHHHHHHHcCCCCCCCHHHHhhhcCCCCC
Q 023507          118 HRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNGNN  197 (281)
Q Consensus       118 ~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~v~pv~dQg~cgsCwAfa~~~~le~~~~~~~~~~~~lS~q~l~dc~~~~~~  197 (281)
                      ...........  ....+||++||||++|+|+||||||.||||||||+++++|+++++++++.+.||+|+|+||+. .+.
T Consensus       136 ~~~~~~~~~~~--~~~~~lP~s~DWR~~g~VtpVkdQG~CGSCWAFsa~~alE~~~~i~tg~~~~LSeQ~LvdC~~-~~~  212 (363)
T 3tnx_A          136 TTELSYEEVLN--DGDVNIPEYVDWRQKGAVTPVKNQGSCGSAWAFSAVSTIESIIKIRTGNLNEYSEQELLDCDR-RSY  212 (363)
T ss_dssp             CSSSSSSCCCC--CSCCCCCSCEEGGGGTCCCCCCBCCSSBCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCT-TSC
T ss_pred             ccccccccccC--cccCCCCcceecccCCCCCCCccCCcCCchhhhhhcccHHHHHHHHcCCCCCcCHHHHhcccC-CCC
Confidence            11111111111  112379999999999999999999999999999999999999999999999999999999998 688


Q ss_pred             CCCCCcchhhHHHHHhcC--------------------------------------------------------------
Q 023507          198 GCLGGSREKAFAYIIQNQ--------------------------------------------------------------  215 (281)
Q Consensus       198 gC~GG~~~~a~~~~~~~g--------------------------------------------------------------  215 (281)
                      ||+||.+..|++|+.++|                                                              
T Consensus       213 GC~GG~~~~a~~yi~~~Gi~~e~~yPY~~~~~~c~~~~~~~~~~~~~~~~~~~~~~e~~l~~~v~~gPvsvai~a~~~~F  292 (363)
T 3tnx_A          213 GCNGGYPWSALQLVAQYGIHYRNTYPYEGVQRYCRSREKGPYAAKTDGVRQVQPYNEGALLYSIANQPVSVVLEAAGKDF  292 (363)
T ss_dssp             TTBCCCHHHHHHHHHHTCBCBTTTSCCCSSCCCCCGGGGCSCSBCCCEEEEECSSCHHHHHHHHTTSCEEEEECCCSHHH
T ss_pred             CCCCCChHHHHhHHHhcCccccccCCCcCcCCCcccCCCCCceeeccceEEcchhhHHHHHHHHHcCCcEEEEEecchhh
Confidence            999999999999999888                                                              


Q ss_pred             -----ceecCccCCCCCceEEEEEeeecCCCccEEEEEcCCCCCCCCCcEEEEEcCC----CccccCCceeeeeC
Q 023507          216 -----GIFNGVCGTQLDHAVTIVGFGTTEDGANYWLIKNSWGNTWGDAGYMKIVRDE----GLCGIGTRSSYPLA  281 (281)
Q Consensus       216 -----Giy~~~~~~~~~Hav~iVGy~~~~~g~~ywivkNSWG~~WG~~Gy~~i~~~~----~~Cgi~~~~~~~~~  281 (281)
                           |||.++|....+|||+|||||+     +|||||||||+.|||+|||||+|+.    |.|||++.|+||+.
T Consensus       293 ~~Y~sGVy~~~~~~~lnHaV~iVGyG~-----~YWIVKNSWGt~WGe~GY~rI~Rg~~~~~~~CGI~~~a~yPik  362 (363)
T 3tnx_A          293 QLYRGGIFVGPCGNKVDHAVAAVGYGP-----NYILIRNSWGTGWGENGYIRIKRGTGNSYGVCGLYTSSFYPVK  362 (363)
T ss_dssp             HTEEEEEECCCCCSCCCEEEEEEEEET-----TEEEEECSBCTTSTBTTEEEEECCSCCSSCGGGTTSCEEEEEC
T ss_pred             hCCCCCEECCCCCCCCCeEEEEEEcCC-----CcEEEEeCCCCccccCcEEEEEcCCCCCCCcCCccceeeeccc
Confidence                 9999999889999999999985     5999999999999999999999984    56999999999983
>3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 Back     alignment and structure
>3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Back     alignment and structure
>1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Back     alignment and structure
>1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Back     alignment and structure
>2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Back     alignment and structure
>1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Back     alignment and structure
>2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Back     alignment and structure
>1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Back     alignment and structure
>3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Back     alignment and structure
>3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* Back     alignment and structure
>3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Back     alignment and structure
>3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Back     alignment and structure
>3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Back     alignment and structure
>1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Back     alignment and structure
>1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Back     alignment and structure
>3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Back     alignment and structure
>1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Back     alignment and structure
>1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Back     alignment and structure
>1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Back     alignment and structure
>1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Back     alignment and structure
>3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 Back     alignment and structure
>3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 Back     alignment and structure
>8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Back     alignment and structure
>2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Back     alignment and structure
>2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Back     alignment and structure
>2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Back     alignment and structure
>1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Back     alignment and structure
>3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 Back     alignment and structure
>2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Back     alignment and structure
>2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Back     alignment and structure
>2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Back     alignment and structure
>3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Back     alignment and structure
>3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* Back     alignment and structure
>3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Back     alignment and structure
>1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Back     alignment and structure
>2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Back     alignment and structure
>3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Back     alignment and structure
>2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A Back     alignment and structure
>2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A Back     alignment and structure
>3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} Back     alignment and structure
>3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Back     alignment and structure
>2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Back     alignment and structure
>1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A Back     alignment and structure
>1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 Back     alignment and structure
>1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 281
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 3e-37
d1cs8a_316 d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens 4e-20
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 7e-33
d1xkga1302 d.3.1.1 (A:4-305) Major mite fecal allergen der p 3e-20
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 2e-26
d1cqda_216 d.3.1.1 (A:) Proline-specific cysteine protease {G 3e-17
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 8e-26
d2oula1241 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip 1e-19
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 9e-26
d1o0ea_208 d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv 3e-18
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 1e-25
d1iwda_215 d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia 2e-16
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 1e-24
d1m6da_214 d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta 3e-18
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 1e-24
d2h7ja1217 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa 1e-19
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 4e-24
d1s4va_224 d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor 6e-20
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 1e-23
g8pch.1228 d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax 2e-19
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 2e-23
d2r6na1215 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa 5e-17
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 4e-23
d1khqa_212 d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId 2e-16
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 5e-23
d1yala_218 d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ 2e-20
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 1e-22
d1ppoa_216 d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca 5e-19
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 2e-22
d1aeca_218 d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi 8e-19
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 1e-21
d1gmya_254 d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens 3e-18
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 1e-21
d1fh0a_221 d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens 7e-16
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 1e-20
d1me4a_215 d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 4e-18
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 5e-18
d1deua_275 d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens 5e-15
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 2e-17
g1k3b.1233 d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase 4e-17
d3gcba_458 d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S 2e-08
d2cb5a_453 d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi 2e-06
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin L
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  132 bits (332), Expect = 3e-37
 Identities = 70/186 (37%), Positives = 104/186 (55%), Gaps = 11/186 (5%)

Query: 38  THEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKE---GNRTYKLGTN 94
           T + S+     KW A H R Y    E+  R  ++++N++ IE  N+E   G  ++ +  N
Sbjct: 3   TFDHSLEAQWTKWKAMHNRLYGMN-EEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMN 61

Query: 95  QFSDLTNDEFRALYTGYKMPSPSHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQ 154
            F D+T++EFR +  G++   P           +Q     + P S+DWR+KG VTP+KNQ
Sbjct: 62  AFGDMTSEEFRQVMNGFQNRKPRKGKV------FQEPLFYEAPRSVDWREKGYVTPVKNQ 115

Query: 155 KECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTNG-NNGCLGGSREKAFAYIIQ 213
            +CG CWAF+A  A+EG    ++G LI LSEQ L+DCS    N GC GG  + AF Y+  
Sbjct: 116 GQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEGCNGGLMDYAFQYVQD 175

Query: 214 NQGIFN 219
           N G+ +
Sbjct: 176 NGGLDS 181
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
d1cs8a_316 (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 100.0
d1xkga1302 Major mite fecal allergen der p 1 {House-dust mite 100.0
d1cqda_216 Proline-specific cysteine protease {Ginger rhizome 100.0
d1ppoa_216 Caricain (protease omega) {Papaya (Carica papaya) 100.0
d2h7ja1217 (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 100.0
d1yala_218 Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d1m6da_214 Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s4va_224 Vignain (bean endopeptidase) {Castor bean (Ricinus 100.0
d2r6na1215 (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 100.0
d1iwda_215 Ervatamin B {Adam's apple (Ervatamia coronaria) [T 100.0
d1aeca_218 Actinidin {Chinese gooseberry or kiwifruit (Actini 100.0
d1o0ea_208 Ervatamin C {East indian rosebay (Ervatamia corona 100.0
d1fh0a_221 (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 100.0
d2oula1241 Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} 100.0
d1khqa_212 Papain {Papaya (Carica papaya) [TaxId: 3649]} 100.0
d1me4a_215 Cruzain {Trypanosoma cruzi [TaxId: 5693]} 100.0
g8pch.1228 Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1gmya_254 (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 100.0
g1k3b.1233 Cathepsin C (dipeptidyl peptidase I), catalytic do 100.0
d1deua_275 (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 100.0
d3gcba_ 458 Bleomycin hydrolase {Baker's yeast (Saccharomyces 99.7
d2cb5a_ 453 Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 99.63
d1cv8a_173 Staphopain StpA {Staphylococcus aureus [TaxId: 128 97.38
d1pxva_183 Staphopain SspB {Staphylococcus aureus [TaxId: 128 96.31
>d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Papain-like
domain: (Pro)cathepsin L
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=7.8e-70  Score=494.84  Aligned_cols=236  Identities=42%  Similarity=0.871  Sum_probs=206.2

Q ss_pred             ChhHHHHHHHHHHHHhCCccCCHHHHHHHHHHHHHHHHHHHHHhcC---CCCceEEecccCCCCCHHHHHHHHcCCCCCC
Q 023507           39 HEQSVVEIHEKWMAQHGRSYKDELEKEMRLKIFKENLEYIEKANKE---GNRTYKLGTNQFSDLTNDEFRALYTGYKMPS  115 (281)
Q Consensus        39 ~~~~~~~~f~~f~~~~~K~Y~s~~E~~~R~~~F~~Nl~~I~~~N~~---~~~s~~~g~N~FsDlt~eE~~~~~~g~~~~~  115 (281)
                      .+..++++|++||++|+|+|.+. |+.+|+++|.+|++.|++||++   ++.+|++|+|+|+|||.|||.+++++...+.
T Consensus         4 ~~~~l~~~F~~f~~~~~K~Y~~~-ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~~~   82 (316)
T d1cs8a_           4 FDHSLEAQWTKWKAMHNRLYGMN-EEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQNRK   82 (316)
T ss_dssp             CCGGGHHHHHHHHHHTTCCCCTT-HHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCCCC
T ss_pred             ccHHHHHHHHHHHHHhCCcCCCH-HHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhccccccc
Confidence            34778899999999999999775 6789999999999999999985   5679999999999999999999987665433


Q ss_pred             CCCCCCCCccccccCCCCCCCCCceeccCCCCcCcccCCCCcchhHHHHHHHHHHHHHHHHcCCCCCCCHHHHhhhcCC-
Q 023507          116 PSHRSTTSSTFKYQNLSMTDVPTSLDWRDKGAVTPIKNQKECGCCWAFAAVAAVEGITKIRSGNLIQLSEQQLLDCSTN-  194 (281)
Q Consensus       116 ~~~~~~~~~~~~~~~~~~~~lP~~~Dwr~~g~v~pv~dQg~cgsCwAfa~~~~le~~~~~~~~~~~~lS~q~l~dc~~~-  194 (281)
                      ....    ......  ...+||++||||++|+|+||+|||.||||||||+++++|++++++++..+.||+|+|+||+.. 
T Consensus        83 ~~~~----~~~~~~--~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~~~~  156 (316)
T d1cs8a_          83 PRKG----KVFQEP--LFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQ  156 (316)
T ss_dssp             CSCC----EECCCC--TTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGGG
T ss_pred             cccC----ccccCc--ccccCCCceECCcCCcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhccccc
Confidence            2211    111111  123899999999999999999999999999999999999999999999999999999999864 


Q ss_pred             CCCCCCCCcchhhHHHHHhcC-----------------------------------------------------------
Q 023507          195 GNNGCLGGSREKAFAYIIQNQ-----------------------------------------------------------  215 (281)
Q Consensus       195 ~~~gC~GG~~~~a~~~~~~~g-----------------------------------------------------------  215 (281)
                      .+.+|+||.+..|++|++.+|                                                           
T Consensus       157 ~~~~c~gg~~~~a~~y~~~~g~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~gpv~v~i~~~~  236 (316)
T d1cs8a_         157 GNEGCNGGLMDYAFQYVQDNGGLDSEESYPYEATEESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGH  236 (316)
T ss_dssp             TCCGGGCBCHHHHHHHHHHHTCEEBTTTSCCCSSCCCCCCCGGGEEECCCCEEECCSCHHHHHHHHHHHCCEEEEECCCS
T ss_pred             cCCCCCCCchHHHHHHHHhcCcccccccccccccccccccccccccccccccccccCcHHHHHHHHHHhCCeEEEEEecc
Confidence            578999999999999999987                                                           


Q ss_pred             --------ceecCc-cCC-CCCceEEEEEeeec---CCCccEEEEEcCCCCCCCCCcEEEEEcC-CCccccCCceeeeeC
Q 023507          216 --------GIFNGV-CGT-QLDHAVTIVGFGTT---EDGANYWLIKNSWGNTWGDAGYMKIVRD-EGLCGIGTRSSYPLA  281 (281)
Q Consensus       216 --------Giy~~~-~~~-~~~Hav~iVGy~~~---~~g~~ywivkNSWG~~WG~~Gy~~i~~~-~~~Cgi~~~~~~~~~  281 (281)
                              |||..+ |.. .++|||+|||||.+   .++.+|||||||||++|||+|||||+|+ .|.|||++.|+||+|
T Consensus       237 ~~f~~y~~Gi~~~~~c~~~~~nHaV~iVGyG~d~~~~~g~~YWIikNSWG~~WGe~GY~ri~r~~~n~CGI~~~~~yP~v  316 (316)
T d1cs8a_         237 ESFLFYKEGIYFEPDCSSEDMDHGVLVVGYGFESTESDNNKYWLVKNSWGEEWGMGGYVKMAKDRRNHCGIASAASYPTV  316 (316)
T ss_dssp             HHHHTEEEEEECCTTCCSSCCCEEEEEEEEEEECCSSCCEEEEEEECSBCTTSTBTTEEEEECSSSSGGGTTTSCEEECC
T ss_pred             chhccccCCcccCCCCCCCcCCEEEEEEEEcccccCCCCCeEEEEEeCCCCCcccCCEEEEeeCCCCcCccCCeeeeeeC
Confidence                    888775 764 68999999999975   4688999999999999999999999998 599999999999986
>d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Back     information, alignment and structure
>d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Back     information, alignment and structure
>d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Back     information, alignment and structure
>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Back     information, alignment and structure
>d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Back     information, alignment and structure
>d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Back     information, alignment and structure
>d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Back     information, alignment and structure
>d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cv8a_ d.3.1.1 (A:) Staphopain StpA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pxva_ d.3.1.1 (A:) Staphopain SspB {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure