Citrus Sinensis ID: 023518


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEETGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSGMLIFL
cHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHcHHHHHHcccccHHHHHHccccHHHHHHHHHHcccccccEEEEcccEEEEEEEcccccEEEEcccccccccccccEEEEEEcEEEEEEccccccccccccccccccccccccccccccccc
cHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHcccccHHHccccccHccccHHHcccHHHHHHHHccccccHHHcccccEEEEEEEEEccccccEEEEEccEEEEEEEEcccccccEEcccccccccccccEEEEEEEEEEEEEcccccEEcHHcccccccccccccccccEEEEEc
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEkgaslapgdsrFTNLIKECEERIAEETgelqkqpletgptnvvstnnvqpatnisstedVETVMDVSNeaamaaparpkyrhefyqkpEEVVVTVFAkgipaknvtvdfgEQILSVsidvpgeeayhfqprlfgkiipakcryeVLSTKVEIRLAkaepiqwsslefskgavvpqrvnppsgmlifl
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRaielepsmskAYWRKATACMKLEEYETAKVAlekgaslapgdsrFTNLIKECEERIAEEtgelqkqpletgptnvvstnnvqpatnisstedvETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAepiqwsslefskgavvpqrvnppsgmlifl
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEETGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSGMLIFL
***********AFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEK**********FTNLI***************************************************************YRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVV**************
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECE***************************************************MAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWS********************LIFL
********AKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEETGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSGMLIFL
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEETGELQKQPLETGPT***STNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSGMLIFL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEETGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSGMLIFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query281 2.2.26 [Sep-21-2011]
Q0JL44367 Protein SGT1 homolog OS=O yes no 0.939 0.719 0.603 2e-89
Q9SUT5358 Protein SGT1 homolog B OS yes no 0.935 0.734 0.606 7e-84
Q9SUR9350 Protein SGT1 homolog A OS no no 0.879 0.705 0.614 6e-79
Q2KIK0338 Suppressor of G2 allele o yes no 0.750 0.624 0.276 9e-23
Q9CX34336 Suppressor of G2 allele o yes no 0.747 0.625 0.26 1e-21
B0BN85336 Suppressor of G2 allele o yes no 0.782 0.654 0.257 2e-21
Q9Y2Z0365 Suppressor of G2 allele o no no 0.843 0.649 0.272 3e-19
Q84K11 556 Serine/threonine-protein N/A no 0.412 0.208 0.362 3e-15
Q84XU2 538 Serine/threonine-protein no no 0.412 0.215 0.344 4e-14
Q55ED0 387 Protein SUGT1 homolog OS= yes no 0.391 0.284 0.366 2e-12
>sp|Q0JL44|SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica GN=SGT1 PE=1 SV=1 Back     alignment and function desciption
 Score =  328 bits (842), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 166/275 (60%), Positives = 207/275 (75%), Gaps = 11/275 (4%)

Query: 2   ATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANR 61
           A+DLE KAK AF+DD FELA +LY+QAIE SP +AEL+ADRAQA IKL N+TEAVADAN+
Sbjct: 6   ASDLESKAKAAFVDDDFELAAELYTQAIEASPATAELYADRAQAHIKLGNYTEAVADANK 65

Query: 62  AIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEET 121
           AIEL+PSM KAY RK  AC++LEEY+TAK ALE G S A GDSRFT L+KEC+ERIAEE 
Sbjct: 66  AIELDPSMHKAYLRKGAACIRLEEYQTAKAALELGYSFASGDSRFTRLMKECDERIAEEL 125

Query: 122 GELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQK 181
            E+  +  E G       + V+   + ++ ++   +++V          +PKYRH+FY  
Sbjct: 126 SEVPVKKAEDGAAAPSVASFVEEKDDAANMDNTPPMVEV----------KPKYRHDFYNS 175

Query: 182 PEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLS 241
             EVV+T+FAKG+PA+NV VDFGEQ+LSVSI+VPGEE YHFQPRLF KIIP K RY+VLS
Sbjct: 176 ATEVVLTIFAKGVPAENVVVDFGEQMLSVSIEVPGEEPYHFQPRLFSKIIPEKSRYQVLS 235

Query: 242 TKVEIRLAKAEPIQWSSLEFSKG-AVVPQRVNPPS 275
           TKVEIRLAKAE I W+SL++ K    VPQ++ PP+
Sbjct: 236 TKVEIRLAKAEQITWTSLDYDKKPKAVPQKIIPPA 270




Involved in basal disease resistance to bacterial blight (X.oryzae). May act as positive regulator of basal defense. Probably required for SCF-mediated ubiquitination, by coupling HSP90 to SCF complex for ubiquitination of HSP90 client proteins.
Oryza sativa subsp. japonica (taxid: 39947)
>sp|Q9SUT5|SGT1B_ARATH Protein SGT1 homolog B OS=Arabidopsis thaliana GN=SGT1B PE=1 SV=1 Back     alignment and function description
>sp|Q9SUR9|SGT1A_ARATH Protein SGT1 homolog A OS=Arabidopsis thaliana GN=SGT1A PE=1 SV=1 Back     alignment and function description
>sp|Q2KIK0|SUGT1_BOVIN Suppressor of G2 allele of SKP1 homolog OS=Bos taurus GN=SUGT1 PE=2 SV=1 Back     alignment and function description
>sp|Q9CX34|SUGT1_MOUSE Suppressor of G2 allele of SKP1 homolog OS=Mus musculus GN=Sugt1 PE=2 SV=3 Back     alignment and function description
>sp|B0BN85|SUGT1_RAT Suppressor of G2 allele of SKP1 homolog OS=Rattus norvegicus GN=Sugt1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y2Z0|SUGT1_HUMAN Suppressor of G2 allele of SKP1 homolog OS=Homo sapiens GN=SUGT1 PE=1 SV=3 Back     alignment and function description
>sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 Back     alignment and function description
>sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 Back     alignment and function description
>sp|Q55ED0|SUGT1_DICDI Protein SUGT1 homolog OS=Dictyostelium discoideum GN=sugt1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
390985902361 SGT1 [Vitis pseudoreticulata] 0.921 0.717 0.694 1e-103
29468339370 SGT1 [Nicotiana benthamiana] 0.957 0.727 0.684 1e-103
58760268370 SGT1 [Nicotiana benthamiana] 0.957 0.727 0.684 1e-103
225464635361 PREDICTED: protein SGT1 homolog [Vitis v 0.921 0.717 0.691 1e-103
315307974370 SGT1 [Nicotiana attenuata] 0.957 0.727 0.684 1e-102
350535094369 SGT1-2 [Solanum lycopersicum] gi|1192148 0.914 0.696 0.676 1e-102
255545142361 chaperone binding protein, putative [Ric 0.935 0.728 0.681 1e-101
51511450370 SGT1 [Solanum tuberosum] 0.950 0.721 0.667 4e-99
62467587370 Sgt1b [Capsicum annuum] 0.950 0.721 0.667 2e-97
238915472360 SGT1 [Malus hupehensis] 0.932 0.727 0.664 2e-97
>gi|390985902|gb|AFM35697.1| SGT1 [Vitis pseudoreticulata] Back     alignment and taxonomy information
 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 189/272 (69%), Positives = 216/272 (79%), Gaps = 13/272 (4%)

Query: 1   MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADAN 60
           MA+DLE +A +AFIDD+FELA DLY+QAIEI+PN AEL+ +R+QA+IKL NFTEAVADAN
Sbjct: 1   MASDLEIRAGKAFIDDHFELAVDLYNQAIEINPNHAELYVERSQANIKLNNFTEAVADAN 60

Query: 61  RAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEE 120
           RAIEL+P MSKA+ RK TACMKLEEY+TAK A E GASLAPGDSRFTNLIKECEERIAEE
Sbjct: 61  RAIELDPLMSKAFLRKGTACMKLEEYQTAKAAFETGASLAPGDSRFTNLIKECEERIAEE 120

Query: 121 TGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQ 180
           T  L KQ +   P  V S   V  A  +             ++  M   ++PKYRHE+YQ
Sbjct: 121 TDGLPKQSVVQAPEAVESPETVVAAEKV-------------HQVPMVTASKPKYRHEYYQ 167

Query: 181 KPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVL 240
           KP+EVVVT+FAKGIP +NV VDFGEQILSVSIDVPG+ AYHFQPRLFGKIIP KCRYEVL
Sbjct: 168 KPQEVVVTIFAKGIPDENVVVDFGEQILSVSIDVPGDVAYHFQPRLFGKIIPDKCRYEVL 227

Query: 241 STKVEIRLAKAEPIQWSSLEFSKGAVVPQRVN 272
           STK+EIRLAKAE I W+SLEFSK   VPQR+N
Sbjct: 228 STKIEIRLAKAEEIHWTSLEFSKENTVPQRIN 259




Source: Vitis pseudoreticulata

Species: Vitis pseudoreticulata

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|29468339|gb|AAO85509.1| SGT1 [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|58760268|gb|AAW82048.1| SGT1 [Nicotiana benthamiana] Back     alignment and taxonomy information
>gi|225464635|ref|XP_002276170.1| PREDICTED: protein SGT1 homolog [Vitis vinifera] gi|302143763|emb|CBI22624.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|315307974|gb|ADU04390.1| SGT1 [Nicotiana attenuata] Back     alignment and taxonomy information
>gi|350535094|ref|NP_001234687.1| SGT1-2 [Solanum lycopersicum] gi|119214865|gb|ABL61264.1| SGT1-2 [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|255545142|ref|XP_002513632.1| chaperone binding protein, putative [Ricinus communis] gi|223547540|gb|EEF49035.1| chaperone binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|51511450|gb|AAU04979.1| SGT1 [Solanum tuberosum] Back     alignment and taxonomy information
>gi|62467587|gb|AAX83943.1| Sgt1b [Capsicum annuum] Back     alignment and taxonomy information
>gi|238915472|gb|ACR78249.1| SGT1 [Malus hupehensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query281
TAIR|locus:2128278358 SGT1B [Arabidopsis thaliana (t 0.935 0.734 0.620 2.2e-82
UNIPROTKB|Q0JL44367 SGT1 "Protein SGT1 homolog" [O 0.935 0.716 0.612 5.8e-82
UNIPROTKB|Q9Y2Z0365 SUGT1 "Suppressor of G2 allele 0.879 0.676 0.286 3.9e-21
CGD|CAL0004941413 SGT1 [Candida albicans (taxid: 0.434 0.295 0.341 1.3e-16
UNIPROTKB|Q59X42413 CaO19.11570 "Putative uncharac 0.434 0.295 0.341 1.3e-16
UNIPROTKB|Q2KIK0338 SUGT1 "Suppressor of G2 allele 0.758 0.630 0.274 7.5e-16
MGI|MGI:1915205336 Sugt1 "SGT1, suppressor of G2 0.708 0.592 0.256 5.6e-15
DICTYBASE|DDB_G0269292 387 sugt1 "SGS domain-contantaing 0.526 0.382 0.322 2.3e-14
TAIR|locus:2052345 538 PP5.2 "protein phosphatase 5.2 0.412 0.215 0.344 1.5e-13
RGD|1307550336 Sugt1 "SGT1, suppressor of G2 0.736 0.616 0.255 2.2e-13
TAIR|locus:2128278 SGT1B [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 826 (295.8 bits), Expect = 2.2e-82, P = 2.2e-82
 Identities = 172/277 (62%), Positives = 207/277 (74%)

Query:     1 MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADAN 60
             MA +L +KAKEAF+DD F++A DLYS+AI++ PN A  FADRAQA+IK+ NFTEAV DAN
Sbjct:     1 MAKELAEKAKEAFLDDDFDVAVDLYSKAIDLDPNCAAFFADRAQANIKIDNFTEAVVDAN 60

Query:    61 RAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEE 120
             +AIELEP+++KAY RK TACMKLEEY TAK ALEKGAS+AP + +F  +I EC+ RIAEE
Sbjct:    61 KAIELEPTLAKAYLRKGTACMKLEEYSTAKAALEKGASVAPNEPKFKKMIDECDLRIAEE 120

Query:   121 TGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQ 180
               +L  QP+   P ++ S          SST  + T  D       AAPA+P +RHEFYQ
Sbjct:   121 EKDLV-QPM---PPSLPS----------SSTTPLATEADAPPVPIPAAPAKPMFRHEFYQ 166

Query:   181 KPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVL 240
             KPEE VVT+FAK +P +NVTV+FGEQILSV IDV GEEAYH QPRLFGKIIP KCR+EVL
Sbjct:   167 KPEEAVVTIFAKKVPKENVTVEFGEQILSVVIDVAGEEAYHLQPRLFGKIIPEKCRFEVL 226

Query:   241 STKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSGM 277
             STKVEIRLAKAE I W+SLE+ KG  V  + N  S +
Sbjct:   227 STKVEIRLAKAEIITWASLEYGKGQSVLPKPNVSSAL 263




GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005515 "protein binding" evidence=IPI
GO:0050832 "defense response to fungus" evidence=RCA;IMP
GO:2000072 "regulation of defense response to fungus, incompatible interaction" evidence=IMP
GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=RCA;IMP
GO:0009734 "auxin mediated signaling pathway" evidence=IMP
GO:0009867 "jasmonic acid mediated signaling pathway" evidence=RCA;IMP
GO:0019005 "SCF ubiquitin ligase complex" evidence=TAS
GO:0030163 "protein catabolic process" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0009408 "response to heat" evidence=IMP
GO:0005829 "cytosol" evidence=IDA
GO:0010187 "negative regulation of seed germination" evidence=IMP
GO:0000165 "MAPK cascade" evidence=RCA
GO:0006612 "protein targeting to membrane" evidence=RCA
GO:0009595 "detection of biotic stimulus" evidence=RCA
GO:0009697 "salicylic acid biosynthetic process" evidence=RCA
GO:0009853 "photorespiration" evidence=RCA
GO:0009862 "systemic acquired resistance, salicylic acid mediated signaling pathway" evidence=RCA
GO:0009863 "salicylic acid mediated signaling pathway" evidence=RCA
GO:0010200 "response to chitin" evidence=RCA
GO:0010310 "regulation of hydrogen peroxide metabolic process" evidence=RCA
GO:0010363 "regulation of plant-type hypersensitive response" evidence=RCA
GO:0031348 "negative regulation of defense response" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0043069 "negative regulation of programmed cell death" evidence=RCA
GO:0043900 "regulation of multi-organism process" evidence=RCA
GO:0051707 "response to other organism" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0080129 "proteasome core complex assembly" evidence=RCA
UNIPROTKB|Q0JL44 SGT1 "Protein SGT1 homolog" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2Z0 SUGT1 "Suppressor of G2 allele of SKP1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
CGD|CAL0004941 SGT1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59X42 CaO19.11570 "Putative uncharacterized protein" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KIK0 SUGT1 "Suppressor of G2 allele of SKP1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1915205 Sugt1 "SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269292 sugt1 "SGS domain-contantaing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2052345 PP5.2 "protein phosphatase 5.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|1307550 Sugt1 "SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q0JL44SGT1_ORYSJNo assigned EC number0.60360.93950.7193yesno
Q9SUT5SGT1B_ARATHNo assigned EC number0.60640.93590.7346yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00037765001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (361 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00038500001
SubName- Full=Chromosome chr16 scaffold_94, whole genome shotgun sequence; (178 aa)
     0.947
GSVIVG00021159001
SubName- Full=Chromosome chr1 scaffold_22, whole genome shotgun sequence; (792 aa)
      0.810
GSVIVG00002550001
SubName- Full=Chromosome chr2 scaffold_132, whole genome shotgun sequence; (508 aa)
      0.808
GSVIVG00014401001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (806 aa)
      0.803
GSVIVG00033437001
SubName- Full=Chromosome chr19 scaffold_66, whole genome shotgun sequence; (207 aa)
       0.800
GSVIVG00029085001
SubName- Full=Chromosome chr12 scaffold_47, whole genome shotgun sequence; (914 aa)
       0.800
GSVIVG00016524001
SubName- Full=Chromosome chr11 scaffold_13, whole genome shotgun sequence; (903 aa)
       0.800
GSVIVG00019623001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (914 aa)
     0.409

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
PLN03088356 PLN03088, PLN03088, SGT1, suppressor of G2 allele 1e-145
cd0646684 cd06466, p23_CS_SGT1_like, p23_like domain similar 4e-34
cd0646384 cd06463, p23_like, Proteins containing this p23_li 3e-23
pfam0496978 pfam04969, CS, CS domain 3e-22
cd0648984 cd06489, p23_CS_hSgt1_like, p23_like domain simila 1e-19
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-16
cd0648887 cd06488, p23_melusin_like, p23_like domain similar 2e-15
cd0646892 cd06468, p23_CacyBP, p23_like domain found in prot 4e-11
cd0029880 cd00298, ACD_sHsps_p23-like, This domain family in 2e-09
pfam1341469 pfam13414, TPR_11, TPR repeat 7e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-08
pfam1341469 pfam13414, TPR_11, TPR repeat 5e-07
TIGR00990 615 TIGR00990, 3a0801s09, mitochondrial precursor prot 8e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 3e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-05
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 1e-04
COG5010257 COG5010, TadD, Flp pilus assembly protein TadD, co 2e-04
cd0649087 cd06490, p23_NCB5OR, p23_like domain found in NAD( 6e-04
cd06465108 cd06465, p23_hB-ind1_like, p23_like domain found i 0.001
pfam08959288 pfam08959, DUF1872, Domain of unknown function (DU 0.002
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.004
>gnl|CDD|215568 PLN03088, PLN03088, SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
 Score =  410 bits (1056), Expect = e-145
 Identities = 182/276 (65%), Positives = 212/276 (76%), Gaps = 17/276 (6%)

Query: 1   MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADAN 60
           MA DLE KAKEAF+DD F LA DLY+QAI++ PN+AEL+ADRAQA+IKL NFTEAVADAN
Sbjct: 1   MAKDLEDKAKEAFVDDDFALAVDLYTQAIDLDPNNAELYADRAQANIKLGNFTEAVADAN 60

Query: 61  RAIELEPSMSKAYWRKATACMKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEE 120
           +AIEL+PS++KAY RK TACMKLEEY+TAK ALEKGASLAPGDSRFT LIKEC+E+IAEE
Sbjct: 61  KAIELDPSLAKAYLRKGTACMKLEEYQTAKAALEKGASLAPGDSRFTKLIKECDEKIAEE 120

Query: 121 TGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDVSNEAAMAAPARPKYRHEFYQ 180
             +L +      P                S+     V +      +  P++PKYRHEFYQ
Sbjct: 121 EKDLVQPVPSDLP----------------SSVTAPPVEEADA-TPVVPPSKPKYRHEFYQ 163

Query: 181 KPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVL 240
           KPEEVVVTVFAKG+PA+NV VDFGEQILSV I+VPGE+AYH QPRLFGKIIP KC+YEVL
Sbjct: 164 KPEEVVVTVFAKGVPAENVNVDFGEQILSVVIEVPGEDAYHLQPRLFGKIIPDKCKYEVL 223

Query: 241 STKVEIRLAKAEPIQWSSLEFSKGAVVPQRVNPPSG 276
           STK+EIRLAKAEPI W+SLE+ KG  V  + N  S 
Sbjct: 224 STKIEIRLAKAEPITWASLEYGKGPAVLPKPNVSSE 259


Length = 356

>gnl|CDD|107223 cd06466, p23_CS_SGT1_like, p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>gnl|CDD|107220 cd06463, p23_like, Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>gnl|CDD|218355 pfam04969, CS, CS domain Back     alignment and domain information
>gnl|CDD|107239 cd06489, p23_CS_hSgt1_like, p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|107238 cd06488, p23_melusin_like, p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>gnl|CDD|107225 cd06468, p23_CacyBP, p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>gnl|CDD|107219 cd00298, ACD_sHsps_p23-like, This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|227343 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|107240 cd06490, p23_NCB5OR, p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>gnl|CDD|107222 cd06465, p23_hB-ind1_like, p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>gnl|CDD|220081 pfam08959, DUF1872, Domain of unknown function (DUF1872) Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 281
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 100.0
cd0648887 p23_melusin_like p23_like domain similar to the C- 99.93
KOG1309196 consensus Suppressor of G2 allele of skp1 [Signal 99.92
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 99.9
KOG0553304 consensus TPR repeat-containing protein [General f 99.86
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 99.86
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 99.85
cd0646892 p23_CacyBP p23_like domain found in proteins simil 99.85
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 99.84
COG5091368 SGT1 Suppressor of G2 allele of skp1 and related p 99.83
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 99.82
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 99.77
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 99.77
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.76
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 99.75
cd0646384 p23_like Proteins containing this p23_like domain 99.75
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.73
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 99.73
PRK15359144 type III secretion system chaperone protein SscB; 99.7
KOG1667320 consensus Zn2+-binding protein Melusin/RAR1, conta 99.69
KOG3260224 consensus Calcyclin-binding protein CacyBP [Signal 99.63
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 99.63
KOG0548 539 consensus Molecular co-chaperone STI1 [Posttransla 99.63
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.62
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 99.61
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 99.59
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.59
KOG4234271 consensus TPR repeat-containing protein [General f 99.55
KOG4648 536 consensus Uncharacterized conserved protein, conta 99.54
PRK11189296 lipoprotein NlpI; Provisional 99.5
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 99.48
PRK10370198 formate-dependent nitrite reductase complex subuni 99.47
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.45
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.42
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.41
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.37
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.37
KOG3158180 consensus HSP90 co-chaperone p23 [Posttranslationa 99.37
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.36
PRK15331165 chaperone protein SicA; Provisional 99.36
KOG2265179 consensus Nuclear distribution protein NUDC [Signa 99.33
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 99.32
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.32
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.31
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.3
KOG1126638 consensus DNA-binding cell division cycle control 99.29
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.27
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.27
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.27
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 99.27
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.27
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.26
PRK12370553 invasion protein regulator; Provisional 99.26
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.25
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.25
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.24
PRK15359144 type III secretion system chaperone protein SscB; 99.24
KOG0547606 consensus Translocase of outer mitochondrial membr 99.24
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 99.24
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.24
PRK10370198 formate-dependent nitrite reductase complex subuni 99.23
KOG1125579 consensus TPR repeat-containing protein [General f 99.23
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.23
PRK12370553 invasion protein regulator; Provisional 99.23
KOG1126638 consensus DNA-binding cell division cycle control 99.21
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.21
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.19
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.18
PRK10803263 tol-pal system protein YbgF; Provisional 99.18
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.15
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 99.15
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.15
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.14
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.13
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.13
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.13
PF13512142 TPR_18: Tetratricopeptide repeat 99.11
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.11
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.1
KOG2076 895 consensus RNA polymerase III transcription factor 99.1
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.1
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.1
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.09
KOG4555175 consensus TPR repeat-containing protein [Function 99.08
PLN02789320 farnesyltranstransferase 99.06
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.04
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.04
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.02
PRK11189296 lipoprotein NlpI; Provisional 99.02
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.01
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.01
COG1729262 Uncharacterized protein conserved in bacteria [Fun 99.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.96
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.95
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.95
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.95
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.95
PF1337173 TPR_9: Tetratricopeptide repeat 98.93
PLN02789320 farnesyltranstransferase 98.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.92
PF1337173 TPR_9: Tetratricopeptide repeat 98.91
PRK11788389 tetratricopeptide repeat protein; Provisional 98.91
PRK11788389 tetratricopeptide repeat protein; Provisional 98.91
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.9
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.87
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 98.87
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.86
PF12688120 TPR_5: Tetratrico peptide repeat 98.84
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.83
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.83
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.83
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.83
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.82
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.8
KOG2003840 consensus TPR repeat-containing protein [General f 98.78
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.78
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.77
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.77
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.75
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.74
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.73
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.72
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.71
PRK14574 822 hmsH outer membrane protein; Provisional 98.69
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.69
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.68
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 98.66
KOG1128777 consensus Uncharacterized conserved protein, conta 98.65
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.65
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.63
KOG2076 895 consensus RNA polymerase III transcription factor 98.63
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.61
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.61
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.6
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.6
KOG0553304 consensus TPR repeat-containing protein [General f 98.58
PRK14574 822 hmsH outer membrane protein; Provisional 98.58
KOG1125579 consensus TPR repeat-containing protein [General f 98.58
KOG1129478 consensus TPR repeat-containing protein [General f 98.57
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.57
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.54
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.54
PRK11906458 transcriptional regulator; Provisional 98.53
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 98.52
KOG1129478 consensus TPR repeat-containing protein [General f 98.51
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.51
PRK11906458 transcriptional regulator; Provisional 98.49
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.49
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.47
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.45
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.42
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.41
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.4
KOG1310 758 consensus WD40 repeat protein [General function pr 98.39
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.38
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.35
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.34
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.33
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.3
PRK15331165 chaperone protein SicA; Provisional 98.29
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.29
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.29
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 98.26
KOG2003840 consensus TPR repeat-containing protein [General f 98.24
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.24
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.23
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.22
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.22
COG4700251 Uncharacterized protein conserved in bacteria cont 98.22
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.22
KOG1128777 consensus Uncharacterized conserved protein, conta 98.21
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.21
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.19
KOG0495913 consensus HAT repeat protein [RNA processing and m 98.18
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.15
PF12688120 TPR_5: Tetratrico peptide repeat 98.15
PF1342844 TPR_14: Tetratricopeptide repeat 98.13
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.12
KOG4234271 consensus TPR repeat-containing protein [General f 98.12
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.11
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.1
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 98.1
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 98.05
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.05
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.03
PF03704146 BTAD: Bacterial transcriptional activator domain; 98.03
PRK10803263 tol-pal system protein YbgF; Provisional 98.03
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 98.03
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.03
PF1343134 TPR_17: Tetratricopeptide repeat 98.01
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.0
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.0
COG0071146 IbpA Molecular chaperone (small heat shock protein 97.99
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.97
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.96
PF1342844 TPR_14: Tetratricopeptide repeat 97.92
PF1343134 TPR_17: Tetratricopeptide repeat 97.91
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.91
KOG4379 596 consensus Uncharacterized conserved protein (tumor 97.91
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.89
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.87
KOG4340 459 consensus Uncharacterized conserved protein [Funct 97.84
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.83
PF13512142 TPR_18: Tetratricopeptide repeat 97.8
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.8
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 97.79
KOG3785 557 consensus Uncharacterized conserved protein [Funct 97.78
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 97.78
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.77
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 97.76
KOG2376 652 consensus Signal recognition particle, subunit Srp 97.75
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.73
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.69
KOG4340459 consensus Uncharacterized conserved protein [Funct 97.63
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.62
KOG2471 696 consensus TPR repeat-containing protein [General f 97.59
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.58
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.57
KOG3364149 consensus Membrane protein involved in organellar 97.56
PRK10941269 hypothetical protein; Provisional 97.56
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.56
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 97.55
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.51
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.51
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.44
KOG4814 872 consensus Uncharacterized conserved protein [Funct 97.44
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.4
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 97.37
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.37
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.37
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 97.25
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.24
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.2
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 97.19
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.17
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.16
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.14
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.13
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.12
KOG4555175 consensus TPR repeat-containing protein [Function 97.08
COG4700251 Uncharacterized protein conserved in bacteria cont 97.08
KOG1915 677 consensus Cell cycle control protein (crooked neck 97.05
PRK10941269 hypothetical protein; Provisional 97.04
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.03
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.03
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.03
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.02
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 97.02
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.01
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 97.0
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 97.0
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.99
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 96.96
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 96.95
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 96.94
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.94
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 96.89
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.85
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 96.82
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.8
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 96.79
KOG1915677 consensus Cell cycle control protein (crooked neck 96.77
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.7
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 96.7
KOG4507886 consensus Uncharacterized conserved protein, conta 96.69
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.67
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 96.65
PF09986214 DUF2225: Uncharacterized protein conserved in bact 96.62
KOG4151 748 consensus Myosin assembly protein/sexual cycle pro 96.62
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 96.61
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 96.61
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 96.6
PRK04841 903 transcriptional regulator MalT; Provisional 96.59
PRK10743137 heat shock protein IbpA; Provisional 96.57
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 96.53
KOG1586288 consensus Protein required for fusion of vesicles 96.47
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 96.46
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.45
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.42
PRK04841 903 transcriptional regulator MalT; Provisional 96.41
PLN032181060 maturation of RBCL 1; Provisional 96.38
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 96.36
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.35
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 96.33
PLN03218 1060 maturation of RBCL 1; Provisional 96.28
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.28
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 96.27
PRK11597142 heat shock chaperone IbpB; Provisional 96.19
KOG1585308 consensus Protein required for fusion of vesicles 96.17
KOG1586288 consensus Protein required for fusion of vesicles 96.14
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 96.1
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 96.09
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.03
KOG2471 696 consensus TPR repeat-containing protein [General f 95.96
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 95.95
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 95.92
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 95.9
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 95.9
PLN03077857 Protein ECB2; Provisional 95.9
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.89
COG2912269 Uncharacterized conserved protein [Function unknow 95.89
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.85
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 95.84
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.83
KOG2610491 consensus Uncharacterized conserved protein [Funct 95.81
KOG1585308 consensus Protein required for fusion of vesicles 95.79
PLN03077857 Protein ECB2; Provisional 95.74
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.7
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 95.64
KOG0530318 consensus Protein farnesyltransferase, alpha subun 95.51
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 95.44
COG5191435 Uncharacterized conserved protein, contains HAT (H 95.23
KOG2610 491 consensus Uncharacterized conserved protein [Funct 95.22
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 95.18
KOG1941518 consensus Acetylcholine receptor-associated protei 95.15
COG2912269 Uncharacterized conserved protein [Function unknow 95.11
KOG4814 872 consensus Uncharacterized conserved protein [Funct 94.96
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 94.81
PF1286294 Apc5: Anaphase-promoting complex subunit 5 94.78
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 94.77
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 94.66
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.56
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 94.55
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 94.42
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.42
KOG3364149 consensus Membrane protein involved in organellar 94.42
PF13281374 DUF4071: Domain of unknown function (DUF4071) 94.34
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 94.19
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 94.14
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 94.09
COG3898 531 Uncharacterized membrane-bound protein [Function u 93.98
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 93.94
PF1286294 Apc5: Anaphase-promoting complex subunit 5 93.7
COG3629280 DnrI DNA-binding transcriptional activator of the 93.47
COG2976207 Uncharacterized protein conserved in bacteria [Fun 93.39
KOG2047835 consensus mRNA splicing factor [RNA processing and 93.33
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 93.25
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 93.21
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 93.06
KOG1550552 consensus Extracellular protein SEL-1 and related 93.04
KOG4507886 consensus Uncharacterized conserved protein, conta 93.01
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 92.6
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 92.51
KOG2047 835 consensus mRNA splicing factor [RNA processing and 92.47
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 92.43
KOG1550552 consensus Extracellular protein SEL-1 and related 92.42
COG3898531 Uncharacterized membrane-bound protein [Function u 92.24
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 92.22
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 91.94
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 91.92
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 91.89
PF09986214 DUF2225: Uncharacterized protein conserved in bact 91.73
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 91.38
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 91.23
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 91.19
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 91.17
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 90.94
COG3629280 DnrI DNA-binding transcriptional activator of the 90.8
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 90.74
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 90.47
PHA02537230 M terminase endonuclease subunit; Provisional 90.44
COG5191435 Uncharacterized conserved protein, contains HAT (H 90.43
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 90.36
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 90.32
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 90.04
PF10373278 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterP 89.87
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 89.4
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 89.29
KOG2422 665 consensus Uncharacterized conserved protein [Funct 89.29
KOG0530318 consensus Protein farnesyltransferase, alpha subun 89.22
KOG0546372 consensus HSP90 co-chaperone CPR7/Cyclophilin [Pos 89.2
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 88.97
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 88.76
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 88.33
KOG0529421 consensus Protein geranylgeranyltransferase type I 88.18
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 88.16
KOG2300629 consensus Uncharacterized conserved protein [Funct 88.09
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 87.88
KOG1258577 consensus mRNA processing protein [RNA processing 87.84
COG3118304 Thioredoxin domain-containing protein [Posttransla 87.72
COG4649221 Uncharacterized protein conserved in bacteria [Fun 87.66
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 87.38
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 87.36
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 87.27
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 87.16
COG4455273 ImpE Protein of avirulence locus involved in tempe 87.01
KOG0529421 consensus Protein geranylgeranyltransferase type I 86.92
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 86.81
KOG2581493 consensus 26S proteasome regulatory complex, subun 86.78
PF0421269 MIT: MIT (microtubule interacting and transport) d 86.61
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.53
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 86.4
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 86.38
COG3947361 Response regulator containing CheY-like receiver a 86.22
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 86.13
KOG2041 1189 consensus WD40 repeat protein [General function pr 86.11
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 85.7
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 85.15
COG4455273 ImpE Protein of avirulence locus involved in tempe 85.08
KOG3783546 consensus Uncharacterized conserved protein [Funct 84.97
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 84.86
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.66
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 84.28
PF07219108 HemY_N: HemY protein N-terminus; InterPro: IPR0108 84.24
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 84.21
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 84.1
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 84.09
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 83.93
KOG1310 758 consensus WD40 repeat protein [General function pr 83.82
COG4941415 Predicted RNA polymerase sigma factor containing a 83.59
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 83.59
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 83.55
cd0268475 MIT_2 MIT: domain contained within Microtubule Int 83.37
KOG2300 629 consensus Uncharacterized conserved protein [Funct 83.29
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 83.28
smart0074577 MIT Microtubule Interacting and Trafficking molecu 83.09
PF11846193 DUF3366: Domain of unknown function (DUF3366); Int 83.06
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 82.84
KOG4563400 consensus Cell cycle-regulated histone H1-binding 82.75
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 82.73
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.66
cd0265675 MIT MIT: domain contained within Microtubule Inter 82.03
cd0267775 MIT_SNX15 MIT: domain contained within Microtubule 81.9
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 81.49
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 80.79
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 80.3
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
Probab=100.00  E-value=2.1e-45  Score=333.27  Aligned_cols=248  Identities=71%  Similarity=1.115  Sum_probs=212.9

Q ss_pred             ChhHHHHHHHHHHHhcCHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHcCCCcHHHHHHHHHHH
Q 023518            1 MATDLEKKAKEAFIDDYFELAYDLYSQAIEISPNSAELFADRAQASIKLQNFTEAVADANRAIELEPSMSKAYWRKATAC   80 (281)
Q Consensus         1 ma~~l~~~g~~~~~~~~y~~Al~~y~~al~~~p~~~~~~~~~a~~~~~l~~~~~A~~~~~~al~l~p~~~~a~~~~g~~~   80 (281)
                      |+..+..+|+.+|..|+|++|+.+|++++..+|+++.+|+++|.+|+++|++++|+.++++++.++|.+..+|+++|.+|
T Consensus         1 ~~~~l~~~a~~a~~~~~~~~Ai~~~~~Al~~~P~~~~a~~~~a~~~~~~g~~~eAl~~~~~Al~l~P~~~~a~~~lg~~~   80 (356)
T PLN03088          1 MAKDLEDKAKEAFVDDDFALAVDLYTQAIDLDPNNAELYADRAQANIKLGNFTEAVADANKAIELDPSLAKAYLRKGTAC   80 (356)
T ss_pred             CcHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCcCCHHHHHHHHHHH
Confidence            78899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhcHHHHHHHHHHhhhcCCCChhHHHHHHHHHHHHHhhhCcCCCCCCCCCCCccccCCCCCCCCCCCCCccchhhhcc
Q 023518           81 MKLEEYETAKVALEKGASLAPGDSRFTNLIKECEERIAEETGELQKQPLETGPTNVVSTNNVQPATNISSTEDVETVMDV  160 (281)
Q Consensus        81 ~~~g~~~~A~~~~~~a~~~~p~~~~~~~~l~~~~~~l~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  160 (281)
                      +.+|+|++|+.+|+++++++|++..+..|+.+|..++.......+...+..+ +.   +....+.+.             
T Consensus        81 ~~lg~~~eA~~~~~~al~l~P~~~~~~~~l~~~~~kl~~~~~~~~~~~~~~~-~~---~~~~~~~~~-------------  143 (356)
T PLN03088         81 MKLEEYQTAKAALEKGASLAPGDSRFTKLIKECDEKIAEEEKDLVQPVPSDL-PS---SVTAPPVEE-------------  143 (356)
T ss_pred             HHhCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHhhhccccccccccc-cc---ccccccccc-------------
Confidence            9999999999999999999999999999999999999765332221111100 00   000000000             


Q ss_pred             ccccccCCCCCCCCCcccccCCCeEEEEEEecCCCCcceEEEEeeeEEEEEEEcCCCceeeeccccccccccCcceEEEe
Q 023518          161 SNEAAMAAPARPKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVL  240 (281)
Q Consensus       161 ~~~~p~~~p~~~k~r~~w~Qt~~~V~i~v~~k~~~~~~~~v~~~~~~l~~~~~~~~~~~~~~~~~L~~~I~~~~s~~~v~  240 (281)
                      ....+..++..+++||+||||+++|+|+||+||+.++++.|+|++++|+|.|..++|..|.|.++||++|+|++|+++|.
T Consensus       144 ~~~~~~~~~~~~~~r~dWyQs~~~V~i~i~~k~~~~~~~~v~~~~~~l~v~~~~~~~~~y~~~~~L~~~I~p~~s~~~v~  223 (356)
T PLN03088        144 ADATPVVPPSKPKYRHEFYQKPEEVVVTVFAKGVPAENVNVDFGEQILSVVIEVPGEDAYHLQPRLFGKIIPDKCKYEVL  223 (356)
T ss_pred             cccCCCCCCCCCccccceeecCCEEEEEEEecCCChHHcEEEeecCEEEEEEecCCCcceeecccccccccccccEEEEe
Confidence            00112223445689999999999999999999999999999999999999999888889999999999999999999999


Q ss_pred             CcEEEEEEeecCCCCCCccccCcCc
Q 023518          241 STKVEIRLAKAEPIQWSSLEFSKGA  265 (281)
Q Consensus       241 ~~kiei~L~K~~~~~W~~l~~~~~~  265 (281)
                      ++||||+|+|+++.+|++|++....
T Consensus       224 ~~Kiei~l~K~~~~~W~~L~~~~~~  248 (356)
T PLN03088        224 STKIEIRLAKAEPITWASLEYGKGP  248 (356)
T ss_pred             cceEEEEEecCCCCCccccccCCcc
Confidence            9999999999999999999977543



>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>COG5091 SGT1 Suppressor of G2 allele of skp1 and related proteins [General function prediction only] Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1667 consensus Zn2+-binding protein Melusin/RAR1, contains CHORD domain [General function prediction only] Back     alignment and domain information
>KOG3260 consensus Calcyclin-binding protein CacyBP [Signal transduction mechanisms] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG3158 consensus HSP90 co-chaperone p23 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2265 consensus Nuclear distribution protein NUDC [Signal transduction mechanisms] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4379 consensus Uncharacterized conserved protein (tumor antigen CML66 in humans) [Function unknown] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4151 consensus Myosin assembly protein/sexual cycle protein and related proteins [Posttranslational modification, protein turnover, chaperones; Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF10373 EST1_DNA_bind: Est1 DNA/RNA binding domain; InterPro: IPR018834 Est1 is a protein which recruits or activates telomerase at the site of polymerisation [, ] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0546 consensus HSP90 co-chaperone CPR7/Cyclophilin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07219 HemY_N: HemY protein N-terminus; InterPro: IPR010817 This entry represents the N terminus (approximately 150 residues) of bacterial HemY porphyrin biosynthesis proteins Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>cd02684 MIT_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>PF11846 DUF3366: Domain of unknown function (DUF3366); InterPro: IPR021797 This domain is functionally uncharacterised Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG4563 consensus Cell cycle-regulated histone H1-binding protein [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>cd02656 MIT MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02677 MIT_SNX15 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
2xcm_C92 Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord 7e-38
2jki_S90 Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Leng 3e-37
1rl1_A114 Solution Structure Of Human Sgt1 Cs Domain Length = 5e-13
1wao_1 477 Pp5 Structure Length = 477 5e-11
1a17_A166 Tetratricopeptide Repeats Of Protein Phosphatase 5 4e-10
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 4e-10
2bug_A140 Solution Structure Of The Tpr Domain From Protein P 7e-10
3upv_A126 Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 2e-09
3uq3_A258 Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 3e-09
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 2e-07
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 4e-07
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 8e-07
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-06
2c2l_A281 Crystal Structure Of The Chip U-Box E3 Ubiquitin Li 4e-06
3q47_B137 Crystal Structure Of Tpr Domain Of Chip Complexed W 5e-06
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-05
2dba_A148 The Solution Structure Of The Tetratrico Peptide Re 3e-05
3sz7_A164 Crystal Structure Of The Sgt2 Tpr Domain From Asper 4e-05
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 8e-05
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 1e-04
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 2e-04
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 4e-04
3fp2_A 537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 7e-04
3lca_A 533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 7e-04
1ihg_A370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 9e-04
>pdb|2XCM|C Chain C, Complex Of Hsp90 N-Terminal, Sgt1 Cs And Rar1 Chord2 Domain Length = 92 Back     alignment and structure

Iteration: 1

Score = 154 bits (388), Expect = 7e-38, Method: Compositional matrix adjust. Identities = 71/91 (78%), Positives = 81/91 (89%) Query: 173 KYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIP 232 KYRHE+YQKPEEVVVTVFAKGIP +NV +DFGEQILSV I+VPGE+AY+ QPRLFGKIIP Sbjct: 2 KYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIP 61 Query: 233 AKCRYEVLSTKVEIRLAKAEPIQWSSLEFSK 263 KC+YEVLSTK+EI LAKA+ I W+SLE K Sbjct: 62 DKCKYEVLSTKIEICLAKADIITWASLEHGK 92
>pdb|2JKI|S Chain S, Complex Of Hsp90 N-terminal And Sgt1 Cs Domain Length = 90 Back     alignment and structure
>pdb|1RL1|A Chain A, Solution Structure Of Human Sgt1 Cs Domain Length = 114 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1A17|A Chain A, Tetratricopeptide Repeats Of Protein Phosphatase 5 Length = 166 Back     alignment and structure
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|3UPV|A Chain A, Tpr2b-Domain:phsp70-Complex Of Yeast Sti1 Length = 126 Back     alignment and structure
>pdb|3UQ3|A Chain A, Tpr2ab-Domain:phsp90-Complex Of Yeast Sti1 Length = 258 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2C2L|A Chain A, Crystal Structure Of The Chip U-Box E3 Ubiquitin Ligase Length = 281 Back     alignment and structure
>pdb|3Q47|B Chain B, Crystal Structure Of Tpr Domain Of Chip Complexed With Pseudophosphorylated Smad1 Peptide Length = 137 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|2DBA|A Chain A, The Solution Structure Of The Tetratrico Peptide Repeat Of Human Smooth Muscle Cell Associated Protein-1, Isoform 2 Length = 148 Back     alignment and structure
>pdb|3SZ7|A Chain A, Crystal Structure Of The Sgt2 Tpr Domain From Aspergillus Fumigatus Length = 164 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query281
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 1e-36
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 3e-36
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 2e-32
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 4e-04
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 1e-31
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-31
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 5e-30
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 3e-05
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 1e-29
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 3e-06
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 6e-04
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-29
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 8e-05
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-29
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 8e-07
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-28
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-07
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 1e-27
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-27
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 5e-04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 8e-26
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 3e-25
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 1e-04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 4e-22
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-20
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-05
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-20
2l6j_A111 TPR repeat-containing protein associated with HSP; 4e-05
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 2e-19
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 3e-19
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 4e-19
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-15
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 6e-10
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-18
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 6e-11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-18
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-16
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-15
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-10
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-09
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-07
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 2e-17
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 5e-05
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 2e-15
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 9e-15
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-14
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-11
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 4e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 5e-09
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-07
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-14
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-13
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-13
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 9e-11
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-10
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-04
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-04
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 5e-14
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-13
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-11
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-10
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-08
3u4t_A272 TPR repeat-containing protein; structural genomics 6e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 9e-13
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-10
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 2e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-12
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 5e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-11
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-10
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-10
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 3e-09
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-11
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-10
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-10
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 7e-09
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 8e-06
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-11
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 8e-08
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-11
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-09
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 7e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-11
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-10
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-09
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-08
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-07
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 8e-11
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 8e-06
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 9e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 9e-11
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-09
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-06
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-10
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 2e-09
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-08
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 9e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-10
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-09
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 3e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-07
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-06
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 3e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-05
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-10
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 7e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-09
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-08
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-08
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-06
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-06
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-09
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 5e-07
4eqf_A365 PEX5-related protein; accessory protein, tetratric 9e-06
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 6e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-09
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 3e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 8e-09
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 5e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-08
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 2e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-08
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 7e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-05
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-04
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 2e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-08
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 7e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-08
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 4e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 8e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 7e-08
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 5e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 4e-07
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-06
4g1t_A472 Interferon-induced protein with tetratricopeptide 6e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 7e-05
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-04
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-06
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 4e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
2o30_A131 Nuclear movement protein; MCSG, structural genomic 1e-06
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 2e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-06
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 4e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 1e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 7e-06
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 8e-06
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 5e-05
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 4e-04
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Length = 92 Back     alignment and structure
 Score =  124 bits (314), Expect = 1e-36
 Identities = 71/91 (78%), Positives = 81/91 (89%)

Query: 173 KYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIP 232
           KYRHE+YQKPEEVVVTVFAKGIP +NV +DFGEQILSV I+VPGE+AY+ QPRLFGKIIP
Sbjct: 2   KYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIP 61

Query: 233 AKCRYEVLSTKVEIRLAKAEPIQWSSLEFSK 263
            KC+YEVLSTK+EI LAKA+ I W+SLE  K
Sbjct: 62  DKCKYEVLSTKIEICLAKADIITWASLEHGK 92


>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Length = 114 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Length = 134 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Length = 125 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Length = 150 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Length = 131 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Length = 159 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Length = 158 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Length = 99 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Length = 124 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.91
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 99.9
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.9
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 99.89
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.86
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 99.84
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 99.84
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 99.83
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.81
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.8
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.79
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.79
2o30_A131 Nuclear movement protein; MCSG, structural genomic 99.78
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 99.78
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 99.77
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.76
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.76
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.75
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.75
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 99.75
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.73
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.71
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 99.71
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.69
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.69
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.69
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.68
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.68
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.67
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.67
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.67
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.67
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.65
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.65
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.64
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.63
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.63
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.63
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.62
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.61
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.61
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.6
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.6
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.6
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.6
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.59
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.58
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.58
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.57
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.56
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.56
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.55
3k9i_A117 BH0479 protein; putative protein binding protein, 99.54
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.52
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.51
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.51
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.5
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.5
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.5
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.48
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.48
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.48
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.48
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.47
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.45
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.44
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.44
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.44
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.44
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.44
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.43
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.43
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.43
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.43
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.43
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.43
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.43
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.42
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.42
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.42
3u4t_A272 TPR repeat-containing protein; structural genomics 99.41
3u4t_A272 TPR repeat-containing protein; structural genomics 99.4
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.4
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.4
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.39
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.39
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.39
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.39
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.39
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.38
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.38
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.38
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.38
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.37
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.36
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.36
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.36
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.36
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.36
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.36
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.35
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.34
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.34
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.33
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.33
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.31
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.31
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.29
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.29
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.29
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.28
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.27
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.26
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.25
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.24
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.24
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.22
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.22
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.21
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.21
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.21
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.21
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.21
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.2
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.19
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.18
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.16
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.15
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.15
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.14
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.14
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.14
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.14
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.13
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.13
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.12
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.12
1pc2_A152 Mitochondria fission protein; unknown function; NM 99.12
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.12
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.12
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.1
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.1
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.1
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.1
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.1
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.09
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.08
3k9i_A117 BH0479 protein; putative protein binding protein, 99.06
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.05
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.05
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.04
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.04
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.03
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.02
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.02
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.02
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.02
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.02
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.02
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.0
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.0
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.99
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.98
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.98
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.98
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.98
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.98
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.98
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.98
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.97
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.97
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.96
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.95
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.94
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.94
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.93
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.93
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.93
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.92
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.91
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.91
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.9
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.9
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.89
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.89
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.89
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.88
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.88
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.87
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.86
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.85
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.82
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.81
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.8
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.8
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.8
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.79
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.77
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.75
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.75
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.65
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.64
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.6
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.55
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.53
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.5
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.49
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.47
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.47
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.39
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.39
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.39
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.39
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.37
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.36
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.31
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 98.25
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.22
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 98.21
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 98.19
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.16
4fei_A102 Heat shock protein-related protein; stress respons 98.16
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 98.13
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.11
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.05
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 98.03
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.98
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.98
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 97.88
1gme_A151 Heat shock protein 16.9B; small heat shock protein 97.85
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 97.78
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.78
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.67
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.67
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.63
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 97.58
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.5
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 97.49
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 97.44
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 97.43
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.42
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 97.37
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 97.35
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.34
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.32
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 97.3
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 97.2
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 96.9
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 96.77
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 96.76
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.67
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 96.2
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 95.95
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.92
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 95.75
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.63
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.57
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 95.26
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.51
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 94.36
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 94.28
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 94.12
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 93.7
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.66
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 93.04
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 92.79
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 92.46
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 92.22
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 91.86
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 89.75
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 89.32
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 88.8
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 88.66
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 87.74
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 87.69
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 87.19
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 85.9
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 85.84
2ijq_A161 Hypothetical protein; structural genomics, PSI, pr 85.35
2cfu_A658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 84.13
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 83.76
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 80.77
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 80.49
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 80.29
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
Probab=99.91  E-value=1.2e-24  Score=158.91  Aligned_cols=91  Identities=77%  Similarity=1.247  Sum_probs=85.8

Q ss_pred             CCCCcccccCCCeEEEEEEecCCCCcceEEEEeeeEEEEEEEcCCCceeeeccccccccccCcceEEEeCcEEEEEEeec
Q 023518          172 PKYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKA  251 (281)
Q Consensus       172 ~k~r~~w~Qt~~~V~i~v~~k~~~~~~~~v~~~~~~l~~~~~~~~~~~~~~~~~L~~~I~~~~s~~~v~~~kiei~L~K~  251 (281)
                      +++||+||||.++|+|+|+++|+.++++.|+|++++|+|.+...++..|.++++||++|+|++|+|++.+++|||+|+|+
T Consensus         1 ~~~~~~W~Qt~~~V~v~i~~~~v~~~~v~v~~~~~~l~v~~~~~~~~~y~~~~~L~~~I~~~~s~~~~~~~~l~i~L~K~   80 (92)
T 2xcm_C            1 AKYRHEYYQKPEEVVVTVFAKGIPKQNVNIDFGEQILSVVIEVPGEDAYYLQPRLFGKIIPDKCKYEVLSTKIEICLAKA   80 (92)
T ss_dssp             CCSEEEEEEETTEEEEEEECCSCCGGGEEEEECSSBEEEEECCTTSCCEEECCBBSSCBCGGGCEEEECSSCEEEEEEBS
T ss_pred             CCccccEEeCCCEEEEEEEECCCChHHeEEEEECCEEEEEEEcCCCcEEEEeeEcCCccCchhEEEEEECCEEEEEEEcC
Confidence            36799999999999999999999999999999999999998776677899999999999999999999999999999999


Q ss_pred             CCCCCCccccC
Q 023518          252 EPIQWSSLEFS  262 (281)
Q Consensus       252 ~~~~W~~l~~~  262 (281)
                      ++..|++|+++
T Consensus        81 ~~~~W~~L~~~   91 (92)
T 2xcm_C           81 DIITWASLEHG   91 (92)
T ss_dssp             SSCCCSCSBTT
T ss_pred             CCCcchhcccC
Confidence            98999999865



>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2ijq_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.88A {Haloarcula marismortui} SCOP: a.246.2.1 Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 281
d1wh0a_134 b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolas 8e-28
d1rl1a_92 b.15.1.3 (A:) Suppressor of G2 allele of skp1 homo 3e-27
d1ejfa_110 b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapien 7e-13
d1wgva_124 b.15.1.4 (A:) NudC domain containing protein 3, NU 3e-12
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-10
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-10
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 9e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-08
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-07
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-05
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 8e-10
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 2e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-07
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-05
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 5e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 4e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 2e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 9e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.001
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 2e-04
d1hz4a_ 366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-04
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 8e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.002
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.001
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 0.003
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 0.002
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure

class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: GS domain
domain: Ubiquitin carboxyl-terminal hydrolase 19, USP19
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  101 bits (254), Expect = 8e-28
 Identities = 29/127 (22%), Positives = 52/127 (40%), Gaps = 14/127 (11%)

Query: 163 EAAMAAPARPKYRHEFYQK-PEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVP------ 215
           +   +       +++ Y+K P+ VVV V+ K I      V F EQ  ++           
Sbjct: 9   DEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLR 68

Query: 216 ------GEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAEPIQWSSLEFSKGAVVPQ 269
                     + +Q +L   I P +C +   +++++I L K +  +W  LE +  A V  
Sbjct: 69  LHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQSQRWGGLE-APAARVGG 127

Query: 270 RVNPPSG 276
              P SG
Sbjct: 128 ASGPSSG 134


>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query281
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 99.93
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 99.93
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.83
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.79
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 99.79
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.78
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.78
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.76
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.74
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 99.73
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.7
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.68
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.66
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 99.65
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.59
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.54
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.53
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.53
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.51
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.5
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.48
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.48
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.46
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.39
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.32
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.29
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.25
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.25
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.23
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.22
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.21
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.21
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.2
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 99.18
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.97
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.94
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.94
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.83
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.81
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.77
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.76
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.73
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.61
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.48
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.43
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.41
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.36
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.36
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.26
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.21
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.15
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 98.1
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 97.85
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.74
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 97.61
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.49
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.42
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 89.1
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 87.43
d2ijqa1145 Hypothetical protein rrnAC1037 {Haloarcula marismo 84.65
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 83.41
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 81.27
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: GS domain
domain: Suppressor of G2 allele of skp1 homolog, gst1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93  E-value=1e-26  Score=168.12  Aligned_cols=91  Identities=36%  Similarity=0.672  Sum_probs=87.3

Q ss_pred             CCCcccccCCCeEEEEEEecCCCCcceEEEEeeeEEEEEEEcCCCceeeeccccccccccCcceEEEeCcEEEEEEeecC
Q 023518          173 KYRHEFYQKPEEVVVTVFAKGIPAKNVTVDFGEQILSVSIDVPGEEAYHFQPRLFGKIIPAKCRYEVLSTKVEIRLAKAE  252 (281)
Q Consensus       173 k~r~~w~Qt~~~V~i~v~~k~~~~~~~~v~~~~~~l~~~~~~~~~~~~~~~~~L~~~I~~~~s~~~v~~~kiei~L~K~~  252 (281)
                      |+||+||||++.|+|+|+++|+.++++.|+|++++|++.+...++..|.++++||++|+|++|+|++.+++|||+|+|++
T Consensus         2 k~ry~W~Qt~~~V~i~i~~~~~~~~~v~v~~~~~~l~v~~~~~~~~~y~~~~~L~~~I~p~~s~~~~~~~kiei~L~K~~   81 (92)
T d1rl1a_           2 KIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPE   81 (92)
T ss_dssp             CCCEEEEECSSEEEEEECCCSCCGGGEEEECSSSCEEEEEECTTSSEEEEEECBSSCCCGGGEEEEECSSSEEEEEECSS
T ss_pred             CCceeEEeCCCEEEEEEEeCCCChHheEEEEecCEEEEEEEcCCCcEEEEEEEcCcccCchhcEEEEeCCEEEEEEEECC
Confidence            78999999999999999999999999999999999999998888889999999999999999999999999999999999


Q ss_pred             CCCCCccccCc
Q 023518          253 PIQWSSLEFSK  263 (281)
Q Consensus       253 ~~~W~~l~~~~  263 (281)
                      +..|++|++++
T Consensus        82 ~~~W~~L~~~G   92 (92)
T d1rl1a_          82 AVRWEKLEGQG   92 (92)
T ss_dssp             CCCCSSSBTTC
T ss_pred             CCcCcCcccCC
Confidence            99999999763



>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ijqa1 a.246.2.1 (A:14-158) Hypothetical protein rrnAC1037 {Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure