Citrus Sinensis ID: 023569
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 280 | 2.2.26 [Sep-21-2011] | |||||||
| Q9MAT5 | 383 | Protein arginine N-methyl | yes | no | 1.0 | 0.731 | 0.667 | 1e-114 | |
| Q9SNQ2 | 380 | Protein arginine N-methyl | yes | no | 1.0 | 0.736 | 0.642 | 1e-113 | |
| A2Y953 | 382 | Protein arginine N-methyl | N/A | no | 1.0 | 0.732 | 0.642 | 1e-113 | |
| A2XYY8 | 379 | Probable protein arginine | N/A | no | 0.85 | 0.627 | 0.351 | 8e-38 | |
| Q7XKC0 | 391 | Probable protein arginine | no | no | 0.842 | 0.603 | 0.354 | 3e-37 | |
| Q08A71 | 435 | Probable protein arginine | no | no | 0.832 | 0.535 | 0.343 | 4e-36 | |
| Q6NWG4 | 349 | Protein arginine N-methyl | no | no | 0.817 | 0.656 | 0.358 | 3e-32 | |
| B0JYW5 | 340 | Protein arginine N-methyl | no | no | 0.832 | 0.685 | 0.338 | 9e-31 | |
| Q6VRB0 | 351 | Protein arginine N-methyl | N/A | no | 0.842 | 0.672 | 0.330 | 7e-30 | |
| Q8AV13 | 369 | Protein arginine N-methyl | N/A | no | 0.842 | 0.639 | 0.323 | 9e-30 |
| >sp|Q9MAT5|ANM10_ARATH Protein arginine N-methyltransferase PRMT10 OS=Arabidopsis thaliana GN=PRMT10 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 412 bits (1060), Expect = e-114, Method: Compositional matrix adjust.
Identities = 187/280 (66%), Positives = 227/280 (81%)
Query: 1 MSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARD 60
M+DHAR LVKANNL +VEVIEGSVEDI LPEKVDVIISEWMGYFLLRESMFDSVI ARD
Sbjct: 104 MADHARALVKANNLDHIVEVIEGSVEDISLPEKVDVIISEWMGYFLLRESMFDSVISARD 163
Query: 61 RWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTK 120
RWLKPTGVMYPSHARMW+API+S + D+K+ D++GA+ DW++F E K+YYGVDM VLTK
Sbjct: 164 RWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMADWHNFSDEIKSYYGVDMGVLTK 223
Query: 121 PFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGT 180
PF+EEQ+KYY+QT++W++L+P Q+IGT +VK +DC TA+V +I EVRS S I E T
Sbjct: 224 PFAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTASVSEIEEVRSNVTSVINMEHT 283
Query: 181 RLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNV 240
RLCGF GWFDV F G EDPAQQEIELTTAPS + THWGQQVF+ + V EGD+LN+
Sbjct: 284 RLCGFGGWFDVQFSGRKEDPAQQEIELTTAPSEQHCTHWGQQVFIMSNPINVEEGDNLNL 343
Query: 241 SFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYIE 280
M+RSKENHRL+E+E +CEI+E++G K ++IE
Sbjct: 344 GLLMSRSKENHRLMEIELNCEIKEASGNPKESFKKTYFIE 383
|
Methylates the guanidino nitrogens of arginyl residues in some proteins. Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: - |
| >sp|Q9SNQ2|ANM10_ORYSJ Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. japonica GN=PRMT10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A2Y953|ANM10_ORYSI Protein arginine N-methyltransferase PRMT10 OS=Oryza sativa subsp. indica GN=PRMT10 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A2XYY8|ANM61_ORYSI Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. indica GN=PRMT6.1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q7XKC0|ANM61_ORYSJ Probable protein arginine N-methyltransferase 6.1 OS=Oryza sativa subsp. japonica GN=PRMT6.1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q08A71|ANM6_ARATH Probable protein arginine N-methyltransferase 6 OS=Arabidopsis thaliana GN=PRMT6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6NWG4|ANM6_DANRE Protein arginine N-methyltransferase 6 OS=Danio rerio GN=prmt6 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|B0JYW5|ANM6_XENTR Protein arginine N-methyltransferase 6 OS=Xenopus tropicalis GN=prmt6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6VRB0|ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis GN=prmt1-b PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8AV13|ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis GN=prmt1-a PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 280 | ||||||
| 297738912 | 337 | unnamed protein product [Vitis vinifera] | 1.0 | 0.830 | 0.785 | 1e-131 | |
| 225445416 | 381 | PREDICTED: probable protein arginine N-m | 1.0 | 0.734 | 0.785 | 1e-131 | |
| 224114359 | 380 | hypothetical protein POPTRDRAFT_746911 [ | 1.0 | 0.736 | 0.771 | 1e-130 | |
| 449464586 | 379 | PREDICTED: probable protein arginine N-m | 1.0 | 0.738 | 0.758 | 1e-127 | |
| 363806714 | 374 | uncharacterized protein LOC100790625 [Gl | 1.0 | 0.748 | 0.746 | 1e-125 | |
| 356508346 | 374 | PREDICTED: probable protein arginine N-m | 1.0 | 0.748 | 0.739 | 1e-124 | |
| 18390448 | 383 | putative protein arginine N-methyltransf | 1.0 | 0.731 | 0.667 | 1e-113 | |
| 353251757 | 376 | Chain C, A Uniquely Open Conformation Re | 1.0 | 0.744 | 0.667 | 1e-112 | |
| 297848734 | 372 | arginine N-methyltransferase family prot | 1.0 | 0.752 | 0.671 | 1e-112 | |
| 30679024 | 280 | putative protein arginine N-methyltransf | 1.0 | 1.0 | 0.667 | 1e-112 |
| >gi|297738912|emb|CBI28157.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 472 bits (1215), Expect = e-131, Method: Compositional matrix adjust.
Identities = 220/280 (78%), Positives = 245/280 (87%)
Query: 1 MSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARD 60
MS+HAR LVKANNLQD+VEVIEGSVED+ LPEKVDVIISEWMGYFLLRESMFDSVI ARD
Sbjct: 58 MSEHARELVKANNLQDIVEVIEGSVEDVTLPEKVDVIISEWMGYFLLRESMFDSVISARD 117
Query: 61 RWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTK 120
RWLKPTGVMYPSHARMW+APIRSGL DQK+ DYEG+++DW F+ ETK YGVDMSVLTK
Sbjct: 118 RWLKPTGVMYPSHARMWMAPIRSGLVDQKKNDYEGSMNDWLCFVNETKNDYGVDMSVLTK 177
Query: 121 PFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGT 180
PFSEEQ+KYYLQTSLW+NLHP QV+GTAA++K IDC TATVDDI EVRS F SSI E T
Sbjct: 178 PFSEEQRKYYLQTSLWNNLHPHQVVGTAAIIKEIDCLTATVDDICEVRSNFSSSILIENT 237
Query: 181 RLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNV 240
RLCGF GWFDVHFRG +++PAQQEIELTTAPS + THWGQQVFL P R SEGDD+NV
Sbjct: 238 RLCGFGGWFDVHFRGRSDNPAQQEIELTTAPSLDSSTHWGQQVFLLHPPFRTSEGDDVNV 297
Query: 241 SFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYIE 280
SF M RSKENHRL+EV+ CEIR+S+G++LP KNKFYIE
Sbjct: 298 SFLMNRSKENHRLMEVDLGCEIRQSSGKLLPLFKNKFYIE 337
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225445416|ref|XP_002285026.1| PREDICTED: probable protein arginine N-methyltransferase 4.2 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224114359|ref|XP_002332378.1| hypothetical protein POPTRDRAFT_746911 [Populus trichocarpa] gi|222832202|gb|EEE70679.1| hypothetical protein POPTRDRAFT_746911 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449464586|ref|XP_004150010.1| PREDICTED: probable protein arginine N-methyltransferase 4.2-like [Cucumis sativus] gi|449525602|ref|XP_004169805.1| PREDICTED: probable protein arginine N-methyltransferase 4.2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|363806714|ref|NP_001242269.1| uncharacterized protein LOC100790625 [Glycine max] gi|255644892|gb|ACU22946.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356508346|ref|XP_003522918.1| PREDICTED: probable protein arginine N-methyltransferase 4.2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|18390448|ref|NP_563720.1| putative protein arginine N-methyltransferase 4.2 [Arabidopsis thaliana] gi|75336166|sp|Q9MAT5.1|ANM10_ARATH RecName: Full=Protein arginine N-methyltransferase PRMT10 gi|7211979|gb|AAF40450.1|AC004809_8 Similar to protein arginine N-methyltransferase from Rattus norvegicus gb|U60882. ESTs gb|Z30908 and gb|Z29205 come from this gene [Arabidopsis thaliana] gi|22135775|gb|AAM91044.1| At1g04870/F13M7_12 [Arabidopsis thaliana] gi|332189633|gb|AEE27754.1| putative protein arginine N-methyltransferase 4.2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|353251757|pdb|3R0Q|C Chain C, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 gi|353251758|pdb|3R0Q|G Chain G, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 gi|353251759|pdb|3R0Q|A Chain A, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 gi|353251760|pdb|3R0Q|E Chain E, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 | Back alignment and taxonomy information |
|---|
| >gi|297848734|ref|XP_002892248.1| arginine N-methyltransferase family protein [Arabidopsis lyrata subsp. lyrata] gi|297338090|gb|EFH68507.1| arginine N-methyltransferase family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|30679024|ref|NP_849591.1| putative protein arginine N-methyltransferase 4.2 [Arabidopsis thaliana] gi|16604456|gb|AAL24234.1| At1g04870/F13M7_12 [Arabidopsis thaliana] gi|332189632|gb|AEE27753.1| putative protein arginine N-methyltransferase 4.2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 280 | ||||||
| TAIR|locus:2010607 | 383 | PRMT10 "protein arginine methy | 1.0 | 0.731 | 0.667 | 5.3e-104 | |
| UNIPROTKB|Q6VRB0 | 351 | prmt1-b "Protein arginine N-me | 0.375 | 0.299 | 0.453 | 1.8e-31 | |
| ZFIN|ZDB-GENE-030131-693 | 378 | prmt1 "protein arginine methyl | 0.375 | 0.277 | 0.445 | 1.9e-31 | |
| UNIPROTKB|Q28F07 | 351 | prmt1 "Protein arginine N-meth | 0.375 | 0.299 | 0.453 | 3.8e-31 | |
| UNIPROTKB|Q8AV13 | 369 | prmt1-a "Protein arginine N-me | 0.375 | 0.284 | 0.445 | 8.3e-31 | |
| ZFIN|ZDB-GENE-041105-1 | 512 | prmt3 "protein arginine methyl | 0.339 | 0.185 | 0.475 | 1.3e-30 | |
| UNIPROTKB|F1SKY6 | 379 | PRMT8 "Uncharacterized protein | 0.375 | 0.277 | 0.411 | 3.1e-29 | |
| UNIPROTKB|E2QWI7 | 376 | PRMT6 "Uncharacterized protein | 0.835 | 0.622 | 0.350 | 4.4e-29 | |
| MGI|MGI:3043083 | 394 | Prmt8 "protein arginine N-meth | 0.375 | 0.266 | 0.420 | 1e-28 | |
| UNIPROTKB|F1PTS0 | 394 | PRMT8 "Uncharacterized protein | 0.375 | 0.266 | 0.411 | 1.1e-28 |
| TAIR|locus:2010607 PRMT10 "protein arginine methyltransferase 10" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1030 (367.6 bits), Expect = 5.3e-104, P = 5.3e-104
Identities = 187/280 (66%), Positives = 227/280 (81%)
Query: 1 MSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARD 60
M+DHAR LVKANNL +VEVIEGSVEDI LPEKVDVIISEWMGYFLLRESMFDSVI ARD
Sbjct: 104 MADHARALVKANNLDHIVEVIEGSVEDISLPEKVDVIISEWMGYFLLRESMFDSVISARD 163
Query: 61 RWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTK 120
RWLKPTGVMYPSHARMW+API+S + D+K+ D++GA+ DW++F E K+YYGVDM VLTK
Sbjct: 164 RWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMADWHNFSDEIKSYYGVDMGVLTK 223
Query: 121 PFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGT 180
PF+EEQ+KYY+QT++W++L+P Q+IGT +VK +DC TA+V +I EVRS S I E T
Sbjct: 224 PFAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTASVSEIEEVRSNVTSVINMEHT 283
Query: 181 RLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNV 240
RLCGF GWFDV F G EDPAQQEIELTTAPS + THWGQQVF+ + V EGD+LN+
Sbjct: 284 RLCGFGGWFDVQFSGRKEDPAQQEIELTTAPSEQHCTHWGQQVFIMSNPINVEEGDNLNL 343
Query: 241 SFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYIE 280
M+RSKENHRL+E+E +CEI+E++G K ++IE
Sbjct: 344 GLLMSRSKENHRLMEIELNCEIKEASGNPKESFKKTYFIE 383
|
|
| UNIPROTKB|Q6VRB0 prmt1-b "Protein arginine N-methyltransferase 1-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-693 prmt1 "protein arginine methyltransferase 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28F07 prmt1 "Protein arginine N-methyltransferase 1" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8AV13 prmt1-a "Protein arginine N-methyltransferase 1-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041105-1 prmt3 "protein arginine methyltransferase 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SKY6 PRMT8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QWI7 PRMT6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3043083 Prmt8 "protein arginine N-methyltransferase 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PTS0 PRMT8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9MAT5 | ANM10_ARATH | 2, ., 1, ., 1, ., - | 0.6678 | 1.0 | 0.7310 | yes | no |
| Q9SNQ2 | ANM10_ORYSJ | 2, ., 1, ., 1, ., - | 0.6428 | 1.0 | 0.7368 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.1.1 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 280 | |||
| pfam05185 | 445 | pfam05185, PRMT5, PRMT5 arginine-N-methyltransfera | 3e-05 |
| >gnl|CDD|218484 pfam05185, PRMT5, PRMT5 arginine-N-methyltransferase | Back alignment and domain information |
|---|
Score = 44.5 bits (106), Expect = 3e-05
Identities = 62/244 (25%), Positives = 95/244 (38%), Gaps = 53/244 (21%)
Query: 15 QDVVEVIEGSVEDIVLPEKVDVIISEWMGYF----LLRESMFDSVICARDRWLKPTGVMY 70
D V +I + + PEK D+++SE +G F L E + D R+LKP G+
Sbjct: 240 GDKVTIISSDMREWKGPEKADILVSELLGSFGDNELSPECL-DGA----QRFLKPDGISI 294
Query: 71 PSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYY 130
P ++API S QK + S K +T Y V + K SEE +
Sbjct: 295 PQSYTSYLAPISSPKLYQKVKS--------MSDPKAFETPYVVRLKSYYK-LSEEVQ--- 342
Query: 131 LQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGTRLCGFSGWFD 190
WS HP++ + R +F G L GF+G+FD
Sbjct: 343 ---ECWSFEHPNR--------------DENSHNERYKTLEFKIKHDGV---LHGFAGYFD 382
Query: 191 VHFRGSTEDPAQQEIELTTAPSTY--NGTHWGQQVFLFRPSVRVSEGDDLNVSFSMTRSK 248
++EL+ P+T+ N W F + V V +G +L S + R
Sbjct: 383 AVLYK--------DVELSILPNTHTPNMISWFPIFFPLKKPVYVKKGQEL--SVHIWRKT 432
Query: 249 ENHR 252
+N +
Sbjct: 433 DNRK 436
|
The human homologue of yeast Skb1 (Shk1 kinase-binding protein 1) is PRMT5, an arginine-N-methyltransferase. These proteins appear to be key mitotic regulators. They play a role in Jak signalling in higher eukaryotes. Length = 445 |
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 280 | |||
| KOG1499 | 346 | consensus Protein arginine N-methyltransferase PRM | 100.0 | |
| KOG1500 | 517 | consensus Protein arginine N-methyltransferase CAR | 100.0 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 100.0 | |
| KOG0822 | 649 | consensus Protein kinase inhibitor [Cell cycle con | 99.96 | |
| PTZ00357 | 1072 | methyltransferase; Provisional | 99.89 | |
| KOG1501 | 636 | consensus Arginine N-methyltransferase [General fu | 99.83 | |
| KOG1501 | 636 | consensus Arginine N-methyltransferase [General fu | 99.55 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 98.58 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 98.01 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 97.76 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 97.51 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 97.43 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 97.39 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 97.1 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 97.03 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 96.86 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 96.84 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 96.8 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 96.73 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 96.72 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 96.71 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 96.71 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 96.61 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 96.6 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 96.6 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 96.55 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 96.52 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 96.51 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 96.49 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 96.39 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 96.3 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 96.3 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 96.28 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 96.22 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 96.13 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 96.07 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 96.06 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 96.05 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 96.02 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 96.01 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 95.97 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 95.97 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 95.93 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 95.9 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 95.83 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 95.83 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 95.75 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 95.7 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 95.67 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 95.63 | |
| PLN02476 | 278 | O-methyltransferase | 95.62 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 95.56 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 95.55 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 95.53 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 95.5 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 95.5 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 95.49 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 95.4 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 95.4 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 95.37 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 95.37 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 95.35 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 95.3 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 95.19 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 95.16 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 95.11 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 95.09 | |
| KOG4300 | 252 | consensus Predicted methyltransferase [General fun | 95.03 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 94.99 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 94.96 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 94.96 | |
| PF06962 | 140 | rRNA_methylase: Putative rRNA methylase; InterPro: | 94.86 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 94.77 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 94.7 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 94.68 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 94.63 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 94.6 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 94.59 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 94.55 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 94.46 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 94.45 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 94.44 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 94.4 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 94.3 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 94.29 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 94.29 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 94.27 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 93.92 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 93.89 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 93.67 | |
| PLN02366 | 308 | spermidine synthase | 93.52 | |
| KOG1540 | 296 | consensus Ubiquinone biosynthesis methyltransferas | 93.46 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 93.43 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 93.35 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 93.32 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 93.29 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 93.29 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 93.19 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 93.09 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 93.09 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 93.03 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 93.01 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 92.96 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 92.95 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 92.81 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 92.69 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 92.62 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 92.5 | |
| KOG1271 | 227 | consensus Methyltransferases [General function pre | 92.48 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 92.31 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 92.15 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 92.11 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 91.87 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 91.87 | |
| PRK04266 | 226 | fibrillarin; Provisional | 91.72 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 91.4 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 91.34 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 91.3 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 91.22 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 90.96 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 90.92 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 90.9 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 90.78 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 90.77 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 90.28 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 90.2 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 90.0 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 89.87 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 89.75 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 89.67 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 89.62 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 89.48 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 89.3 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 89.05 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 89.03 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 88.95 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 88.92 | |
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 88.72 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 88.72 | |
| PLN02823 | 336 | spermine synthase | 88.33 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 88.01 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 87.7 | |
| PF13578 | 106 | Methyltransf_24: Methyltransferase domain; PDB: 3S | 87.52 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 87.26 | |
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 87.18 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 86.84 | |
| PF05971 | 299 | Methyltransf_10: Protein of unknown function (DUF8 | 86.65 | |
| KOG3045 | 325 | consensus Predicted RNA methylase involved in rRNA | 85.38 | |
| KOG2904 | 328 | consensus Predicted methyltransferase [General fun | 85.37 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 85.28 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 85.16 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 85.08 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 84.91 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 84.59 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 84.58 | |
| PRK13699 | 227 | putative methylase; Provisional | 84.26 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 82.22 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 82.06 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 81.63 |
| >KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=6.9e-59 Score=417.76 Aligned_cols=238 Identities=38% Similarity=0.708 Sum_probs=223.9
Q ss_pred CHHHHHHHHHHcCCCCeEEEEecccccccCC-CcccEEEecCCCcccCCCccHHHHHHHHhcccCCCeEEEcccceEEEE
Q 023569 1 MSDHARTLVKANNLQDVVEVIEGSVEDIVLP-EKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVA 79 (280)
Q Consensus 1 ma~~A~~~i~~Ngl~~~i~vi~~~~~~~~l~-~~~DvivsE~~g~~l~~E~~l~~~~~a~~~~L~~~g~~iP~~a~ly~~ 79 (280)
||+.|+++++.|+++++|++++|+++++.|| +|||+|||||||++|++|+||+++++||++||+|||.++|++|++|++
T Consensus 94 ia~~a~~iv~~N~~~~ii~vi~gkvEdi~LP~eKVDiIvSEWMGy~Ll~EsMldsVl~ARdkwL~~~G~i~P~~a~l~l~ 173 (346)
T KOG1499|consen 94 IADFARKIVKDNGLEDVITVIKGKVEDIELPVEKVDIIVSEWMGYFLLYESMLDSVLYARDKWLKEGGLIYPDRATLYLA 173 (346)
T ss_pred HHHHHHHHHHhcCccceEEEeecceEEEecCccceeEEeehhhhHHHHHhhhhhhhhhhhhhccCCCceEccccceEEEE
Confidence 6899999999999999999999999999999 999999999999999999999999999999999999999999999999
Q ss_pred EeecCCCCchhhhhcccccchhhhhcccccccCccccccCchhhhhhhhhhccccceEecCCCcccCcceeEEEEeCCCC
Q 023569 80 PIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTA 159 (280)
Q Consensus 80 ~v~~~~~~~~~~~~~~~~~~W~~~~~~~~~~~G~d~s~l~~~~~~~~~~~~~~~p~~~~~~~~~~Ls~p~~i~~~D~~~~ 159 (280)
++++.. .+.++++||. ++||||||++.+. +..+|+++.+++.+++++|+.+.++|+.+.
T Consensus 174 ~i~d~~------~~~~~i~fW~-------~Vygfdms~~~~~--------~~~e~lv~vv~~~~l~t~~~~i~~~Dl~t~ 232 (346)
T KOG1499|consen 174 AIEDDS------YKDDKIGFWD-------DVYGFDMSCIKKI--------AIKEPLVDVVDPEQLLTEPCLIKEFDLYTV 232 (346)
T ss_pred eccCch------hhhhhcCccc-------cccccchhhhhhh--------hhcccceeccChhHhcccceeeEEeeeeee
Confidence 999973 5567789996 9999999999543 456889999999999999999999999999
Q ss_pred CcccccceeeeEEEEEEecCceEEEEEEEecceeccccCCCCCCcEEEecCCCCCCCCCeeeeEEeeCCeeecCCCCEEE
Q 023569 160 TVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLN 239 (280)
Q Consensus 160 ~~~dl~~~~~~~~~~~~~~~g~~~g~~~wfd~~l~~~~~~~~~~~v~lST~P~~~~~thW~Q~v~~l~~p~~V~~Gd~i~ 239 (280)
+.+|+ .++++|++.++ ++|.+|||++|||++|...+.+ ..+.+||+| .++.|||||+||++++|+.|+.|+.|.
T Consensus 233 ~i~d~-~F~s~f~l~v~-r~~~i~g~v~yFDv~F~~~~~~---~~~~fST~P-~~p~THWKQtVfyl~~p~~v~~ge~i~ 306 (346)
T KOG1499|consen 233 KIEDL-SFTSPFKLKVT-RNGYLHAFVAYFDVEFTGCHGK---KRLGFSTSP-SSPYTHWKQTVFYLENPLTVKEGEDIT 306 (346)
T ss_pred eccce-eeccceEEEEc-cCceEEEEEEEEEEeeccCCCC---CcceeecCC-CCCCceeeeEEEEecCccceecCceEE
Confidence 99999 69999999999 9999999999999999876322 578999999 599999999999999999999999999
Q ss_pred EEEEEEeCCCCCeEEEEEEEEEEecc
Q 023569 240 VSFSMTRSKENHRLLEVEFSCEIRES 265 (280)
Q Consensus 240 ~~~~~~~~~~~~r~~~i~~~~~~~~~ 265 (280)
|+++++++.+|+|++++.+++.++++
T Consensus 307 g~it~~~~~~~~R~l~~~l~~~~~~~ 332 (346)
T KOG1499|consen 307 GTITMKPNKKNNRDLDISLSLNFKGQ 332 (346)
T ss_pred EEEEEeeCCCCCccceEEEEEecCCc
Confidence 99999999999999999999999998
|
|
| >KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >KOG0822 consensus Protein kinase inhibitor [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00357 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1501 consensus Arginine N-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1501 consensus Arginine N-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG4300 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >KOG1271 consensus Methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >KOG3045 consensus Predicted RNA methylase involved in rRNA processing [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2904 consensus Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 280 | ||||
| 3r0q_C | 376 | A Uniquely Open Conformation Revealed In The Crysta | 1e-115 | ||
| 1or8_A | 340 | Structure Of The Predominant Protein Arginine Methy | 5e-29 | ||
| 1ori_A | 343 | Structure Of The Predominant Protein Arginine Methy | 5e-29 | ||
| 3q7e_A | 349 | Crystal Structure Of Rat Protein Arginine Methyltra | 6e-29 | ||
| 1orh_A | 353 | Structure Of The Predominant Protein Arginine Methy | 1e-28 | ||
| 2fyt_A | 340 | Human Hmt1 Hnrnp Methyltransferase-Like 3 (S. Cerev | 3e-28 | ||
| 4hc4_A | 376 | Human Hmt1 Hnrnp Methyltransferase-Like Protein 6 ( | 3e-28 | ||
| 1f3l_A | 321 | Crystal Structure Of The Conserved Core Of Protein | 7e-27 | ||
| 2v74_B | 346 | Crystal Structure Of Coactivator-Associated Arginin | 3e-24 | ||
| 3b3f_A | 341 | The 2.2 A Crystal Structure Of The Catalytic Domain | 3e-24 | ||
| 4ikp_A | 341 | Crystal Structure Of Coactivator-associated Arginin | 4e-24 | ||
| 2y1w_A | 348 | Crystal Structure Of Coactivator Associated Arginin | 4e-24 | ||
| 3b3j_A | 480 | The 2.55 A Crystal Structure Of The Apo Catalytic D | 5e-24 | ||
| 1g6q_1 | 328 | Crystal Structure Of Yeast Arginine Methyltransfera | 6e-23 |
| >pdb|3R0Q|C Chain C, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 Length = 376 | Back alignment and structure |
|
| >pdb|1OR8|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 340 | Back alignment and structure |
| >pdb|1ORI|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 343 | Back alignment and structure |
| >pdb|3Q7E|A Chain A, Crystal Structure Of Rat Protein Arginine Methyltransferase 1 (Prmt1) M48l Mutant Length = 349 | Back alignment and structure |
| >pdb|1ORH|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 353 | Back alignment and structure |
| >pdb|2FYT|A Chain A, Human Hmt1 Hnrnp Methyltransferase-Like 3 (S. Cerevisiae) Protein Length = 340 | Back alignment and structure |
| >pdb|4HC4|A Chain A, Human Hmt1 Hnrnp Methyltransferase-Like Protein 6 (S. Cerevisiae) Length = 376 | Back alignment and structure |
| >pdb|1F3L|A Chain A, Crystal Structure Of The Conserved Core Of Protein Arginine Methyltransferase Prmt3 Length = 321 | Back alignment and structure |
| >pdb|2V74|B Chain B, Crystal Structure Of Coactivator-Associated Arginine Methyltransferase 1 (Carm1), In Complex With S-Adenosyl- Homocysteine Length = 346 | Back alignment and structure |
| >pdb|3B3F|A Chain A, The 2.2 A Crystal Structure Of The Catalytic Domain Of Coactivator- Associated Arginine Methyl Transferase I(Carm1,142-478), In Complex With S-Adenosyl Homocysteine Length = 341 | Back alignment and structure |
| >pdb|4IKP|A Chain A, Crystal Structure Of Coactivator-associated Arginine Methyltransferase 1 Length = 341 | Back alignment and structure |
| >pdb|2Y1W|A Chain A, Crystal Structure Of Coactivator Associated Arginine Methyltransferase 1 (Carm1) In Complex With Sinefungin And Indole Inhibitor Length = 348 | Back alignment and structure |
| >pdb|3B3J|A Chain A, The 2.55 A Crystal Structure Of The Apo Catalytic Domain Of Coactivator-Associated Arginine Methyl Transferase I(Carm1:28-507, Residues 28-146 And 479-507 Not Ordered) Length = 480 | Back alignment and structure |
| >pdb|1G6Q|1 Chain 1, Crystal Structure Of Yeast Arginine Methyltransferase, Hmt1 Length = 328 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Length = 376 | Back alignment and structure |
|---|
Score = 268 bits (686), Expect = 6e-89
Identities = 187/280 (66%), Positives = 227/280 (81%)
Query: 1 MSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARD 60
M+DHAR LVKANNL +VEVIEGSVEDI LPEKVDVIISEWMGYFLLRESMFDSVI ARD
Sbjct: 97 MADHARALVKANNLDHIVEVIEGSVEDISLPEKVDVIISEWMGYFLLRESMFDSVISARD 156
Query: 61 RWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTK 120
RWLKPTGVMYPSHARMW+API+S + D+K+ D++GA+ DW++F E K+YYGVDM VLTK
Sbjct: 157 RWLKPTGVMYPSHARMWLAPIKSNIADRKRNDFDGAMADWHNFSDEIKSYYGVDMGVLTK 216
Query: 121 PFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEGT 180
PF+EEQ+KYY+QT++W++L+P Q+IGT +VK +DC TA+V +I EVRS S I E T
Sbjct: 217 PFAEEQEKYYIQTAMWNDLNPQQIIGTPTIVKEMDCLTASVSEIEEVRSNVTSVINMEHT 276
Query: 181 RLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLNV 240
RLCGF GWFDV F G EDPAQQEIELTTAPS + THWGQQVF+ + V EGD+LN+
Sbjct: 277 RLCGFGGWFDVQFSGRKEDPAQQEIELTTAPSEQHCTHWGQQVFIMSNPINVEEGDNLNL 336
Query: 241 SFSMTRSKENHRLLEVEFSCEIRESTGQILPPIKNKFYIE 280
M+RSKENHRL+E+E +CEI+E++G K ++IE
Sbjct: 337 GLLMSRSKENHRLMEIELNCEIKEASGNPKESFKKTYFIE 376
|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Length = 348 | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Length = 480 | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Length = 328 | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Length = 340 | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Length = 349 | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Length = 745 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 280 | |||
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 100.0 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 100.0 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 100.0 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 100.0 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 100.0 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 100.0 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 100.0 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 100.0 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 100.0 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 97.51 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 97.39 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 97.33 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 97.33 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 97.3 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 97.28 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 97.26 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 97.26 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 97.2 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 97.19 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 97.18 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 97.15 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 97.11 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 97.06 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 97.03 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 97.03 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 97.02 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 96.97 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 96.93 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 96.91 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 96.91 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 96.9 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 96.9 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 96.9 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 96.9 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 96.87 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 96.84 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 96.78 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 96.78 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 96.77 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 96.76 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 96.75 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 96.74 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 96.74 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 96.7 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 96.69 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 96.68 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 96.65 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 96.64 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 96.6 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 96.59 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 96.58 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 96.57 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 96.56 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 96.56 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 96.55 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 96.54 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 96.54 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 96.52 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 96.51 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 96.51 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 96.5 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 96.49 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 96.47 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 96.47 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 96.47 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 96.45 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 96.45 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 96.42 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 96.42 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 96.41 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 96.41 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 96.41 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 96.39 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 96.38 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 96.38 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 96.38 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 96.36 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 96.36 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 96.36 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 96.34 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 96.31 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 96.31 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 96.3 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 96.29 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 96.29 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 96.29 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 96.24 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 96.24 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 96.23 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 96.23 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 96.19 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 96.18 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 96.13 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 96.12 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 96.12 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 96.12 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 96.12 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 96.1 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 96.08 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 96.05 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 96.04 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 96.01 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 96.01 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 96.01 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 95.96 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 95.96 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 95.92 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 95.82 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 95.81 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 95.8 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 95.79 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 95.76 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 95.74 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 95.73 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 95.73 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 95.63 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 95.61 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 95.6 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 95.55 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 95.55 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 95.54 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 95.45 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 95.44 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 95.44 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 95.42 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 95.4 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 95.36 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 95.36 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 95.35 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 95.32 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 95.32 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 95.3 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 95.3 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 95.28 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 95.28 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 95.25 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 95.23 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 95.18 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 95.16 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 95.16 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 95.12 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 95.11 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 95.11 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 95.11 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 95.1 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 95.09 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 95.07 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 95.06 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 95.05 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 95.04 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 94.98 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 94.94 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 94.93 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 94.92 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 94.88 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 94.86 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 94.82 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 94.76 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 94.74 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 94.7 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 94.67 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 94.57 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 94.57 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 94.53 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 94.5 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 94.45 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 94.41 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 94.32 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 94.26 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 94.26 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 94.24 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 94.14 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 94.13 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 94.06 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 93.91 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 93.83 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 93.79 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 93.72 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 93.69 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 93.65 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 93.64 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 93.49 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 93.46 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 93.46 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 93.36 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 93.36 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 93.22 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 93.22 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 93.2 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 93.2 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 93.09 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 92.89 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 92.85 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 92.78 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 92.64 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 92.59 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 92.52 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 92.43 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 92.39 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 92.14 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 92.14 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 92.09 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 92.06 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 92.02 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 91.85 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 91.68 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 91.53 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 91.46 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 91.25 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 91.14 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 91.0 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 90.95 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 90.93 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 90.92 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 90.88 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 90.87 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 90.85 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 90.59 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 90.28 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 90.1 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 90.04 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 89.91 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 89.76 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 89.74 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 89.69 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 89.68 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 89.66 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 89.54 | |
| 2wk1_A | 282 | NOVP; transferase, O-methyltransferase, novobiocin | 89.49 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 88.62 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 88.57 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 88.39 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 87.79 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 87.66 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 87.42 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 87.41 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 87.37 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 87.0 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 86.63 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 86.31 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 85.94 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 85.78 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 85.41 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 84.81 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 84.39 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 83.85 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 83.76 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 83.74 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 83.39 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 82.13 | |
| 3r24_A | 344 | NSP16, 2'-O-methyl transferase; methyltransferase, | 81.37 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 81.35 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 80.95 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 80.28 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 80.17 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 80.07 |
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.8e-54 Score=401.35 Aligned_cols=251 Identities=32% Similarity=0.545 Sum_probs=218.0
Q ss_pred CHHHHHHHHHHcCCCCeEEEEecccccccCCCcccEEEecCCCcccCCCccHHHHHHHHhcccCCCeEEEcccceEEEEE
Q 023569 1 MSDHARTLVKANNLQDVVEVIEGSVEDIVLPEKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVAP 80 (280)
Q Consensus 1 ma~~A~~~i~~Ngl~~~i~vi~~~~~~~~l~~~~DvivsE~~g~~l~~E~~l~~~~~a~~~~L~~~g~~iP~~a~ly~~~ 80 (280)
|++.|++++++||++++|++++++++++++|+++|+|||||||++|++|++++++++||+|||||||++||++|++|++|
T Consensus 117 ~~~~a~~~~~~n~~~~~i~~i~~~~~~~~lpe~~DvivsE~~~~~l~~e~~l~~~l~a~~r~Lkp~G~~iP~~atly~ap 196 (376)
T 4hc4_A 117 IWQQAREVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIVP 196 (376)
T ss_dssp THHHHHHHHHHTTCTTTEEEEESCTTTCCCSSCEEEEECCCCBTTBTTTCSHHHHHHHHHHHEEEEEEEESCEEEEEEEE
T ss_pred HHHHHHHHHHHcCCCceEEEEeeeeeeecCCccccEEEeecccccccccchhhhHHHHHHhhCCCCceECCccceEEEEE
Confidence 78999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred eecCCCCchhhhhcccccchhhhhcccccccCccccccCchhhhhhhhhhccccceEecCCCcccCcceeEEEEeCCCCC
Q 023569 81 IRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTAT 160 (280)
Q Consensus 81 v~~~~~~~~~~~~~~~~~~W~~~~~~~~~~~G~d~s~l~~~~~~~~~~~~~~~p~~~~~~~~~~Ls~p~~i~~~D~~~~~ 160 (280)
|+++ ....++.+|. ++++.|||||+++........ ....+|+++.+++..+||+|+.+++|||.+++
T Consensus 197 ie~~-------~l~~~i~~w~----~v~~~yGfd~s~~~~~~~~~~--~~~~e~~v~~~~~~~~Ls~p~~i~~~D~~~~~ 263 (376)
T 4hc4_A 197 ISDQ-------MLEWRLGFWS----QVKQHYGVDMSCLEGFATRCL--MGHSEIVVQGLSGEDVLARPQRFAQLELSRAG 263 (376)
T ss_dssp ECCH-------HHHHHHHGGG----GHHHHHSCCCGGGHHHHHHHH--HSSCEEEEECCCGGGBCSCCEEEEEEETTCTT
T ss_pred eccc-------hhhhhhcchh----ccccccCcCchhhhhhhhhhh--cccCceEEEeecccccccCCEEEEEEECCCCC
Confidence 9985 2334567886 234559999999965432111 12347888889999999999999999999987
Q ss_pred ccccc--ceeeeEEEEEEecCceEEEEEEEecceeccccCCCCCCcEEEecCCCCCCCCCeeeeEEeeCCeeecCCCCEE
Q 023569 161 VDDIR--EVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDL 238 (280)
Q Consensus 161 ~~dl~--~~~~~~~~~~~~~~g~~~g~~~wfd~~l~~~~~~~~~~~v~lST~P~~~~~thW~Q~v~~l~~p~~V~~Gd~i 238 (280)
.++.. .+..+|++++. ++|.+|||++|||+.|++.. .+.++.|||+| .++.|||+|++|+|++|+.|++||+|
T Consensus 264 ~~~~~~~~~~~~f~~~~~-~~g~vhg~~~WFd~~f~~~~---~~~~v~lST~P-~~~~THW~Q~v~~L~~Pi~V~~G~~I 338 (376)
T 4hc4_A 264 LEQELEAGVGGRFRCSCY-GSAPMHGFAIWFQVTFPGGE---SEKPLVLSTSP-FHPATHWKQALLYLNEPVQVEQDTDV 338 (376)
T ss_dssp HHHHHHHCEEEEEEEECC-SSEEEEEEEEEEEEEECCCC-----CCEEEECCT-TSCCCTTCEEEEEEEEEEEECTTCEE
T ss_pred ccccccccceeEEEEEec-CCcEEEEEEEEEEEEecCCC---CCCceEEeCCC-CcCCCceeeEEEEeCCceEeCCCCEE
Confidence 65321 46778999998 99999999999999997521 13469999999 68999999999999999999999999
Q ss_pred EEEEEEEeCCCCCeEEEEEEEEEEecccccc
Q 023569 239 NVSFSMTRSKENHRLLEVEFSCEIRESTGQI 269 (280)
Q Consensus 239 ~~~~~~~~~~~~~r~~~i~~~~~~~~~~~~~ 269 (280)
+|+++|.++.+|+|+|+|+++|+++++.+..
T Consensus 339 ~g~i~~~~~~~n~R~~~i~i~~~~~~~~~~~ 369 (376)
T 4hc4_A 339 SGEITLLPSRDNPRRLRVLLRYKVGDQEEKT 369 (376)
T ss_dssp EEEEEEEECSSCTTSEEEEEEEEETTSCCEE
T ss_pred EEEEEEEECCCCCceeEEEEEEEeCCCCcce
Confidence 9999999999999999999999998776543
|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 280 | ||||
| d1oria_ | 316 | c.66.1.6 (A:) Protein arginine N-methyltransferase | 4e-43 | |
| d1g6q1_ | 328 | c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba | 4e-42 | |
| d2fyta1 | 311 | c.66.1.6 (A:238-548) Protein arginine N-methyltran | 5e-40 |
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Arginine methyltransferase domain: Protein arginine N-methyltransferase 1, PRMT1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 147 bits (372), Expect = 4e-43
Identities = 77/264 (29%), Positives = 130/264 (49%), Gaps = 30/264 (11%)
Query: 1 MSDHARTLVKANNLQDVVEVIEGSVEDI-VLPEKVDVIISEWMGYFLLRESMFDSVICAR 59
+SD+A +VKAN L VV +I+G VE++ + EKVD+IISEWMGY L ESM ++V+ AR
Sbjct: 67 ISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHAR 126
Query: 60 DRWLKPTGVMYPSHARMWVAPIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLT 119
D+WL P G+++P A ++V I +Q + + W + YG DMS +
Sbjct: 127 DKWLAPDGLIFPDRATLYVTAIED------RQYKDYKIHWW-------ENVYGFDMSCI- 172
Query: 120 KPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTATVDDIREVRSKFLSSIRGEG 179
K ++ L + P Q++ A ++K +D T V+D S F ++
Sbjct: 173 -------KDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVED-LTFTSPFCLQVKRND 224
Query: 180 TRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLN 239
+ +F++ F + +T+P + THW Q VF + V G+++
Sbjct: 225 Y-VHALVAYFNIEFTRCHKR-----TGFSTSPESPY-THWKQTVFYMEDYLTVKTGEEIF 277
Query: 240 VSFSMTRSKENHRLLEVEFSCEIR 263
+ M + +N+R L+ + +
Sbjct: 278 GTIGMRPNAKNNRDLDFTIDLDFK 301
|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 280 | |||
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 100.0 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 100.0 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 100.0 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 97.66 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 97.58 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 97.48 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 97.42 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 97.41 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 97.4 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 97.4 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 97.13 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 97.1 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 97.0 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 96.92 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 96.81 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 96.67 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 96.66 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 96.6 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 96.53 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 96.51 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 96.39 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 96.35 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 96.34 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 96.3 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 96.25 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 96.17 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 96.14 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 96.12 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 96.12 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 96.07 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 95.97 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 95.7 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 95.39 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 95.36 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 95.26 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 95.2 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 95.16 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 94.91 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 94.84 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 94.83 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 94.64 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 94.37 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 94.19 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 94.02 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 93.95 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 93.6 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 93.41 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 93.35 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 93.17 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 92.23 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 91.51 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 91.29 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 91.27 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 90.56 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 89.8 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 89.15 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 88.56 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 87.98 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 87.39 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 87.34 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 86.64 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 86.27 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 85.6 | |
| d1sdwa2 | 158 | Peptidylglycine alpha-hydroxylating monooxygenase, | 85.59 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 85.59 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 85.12 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 84.95 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 84.19 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 83.79 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 81.87 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 81.31 |
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Arginine methyltransferase domain: Protein arginine N-methyltransferase 1, PRMT1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00 E-value=9.2e-48 Score=348.65 Aligned_cols=241 Identities=32% Similarity=0.612 Sum_probs=218.1
Q ss_pred CHHHHHHHHHHcCCCCeEEEEecccccccCC-CcccEEEecCCCcccCCCccHHHHHHHHhcccCCCeEEEcccceEEEE
Q 023569 1 MSDHARTLVKANNLQDVVEVIEGSVEDIVLP-EKVDVIISEWMGYFLLRESMFDSVICARDRWLKPTGVMYPSHARMWVA 79 (280)
Q Consensus 1 ma~~A~~~i~~Ngl~~~i~vi~~~~~~~~l~-~~~DvivsE~~g~~l~~E~~l~~~~~a~~~~L~~~g~~iP~~a~ly~~ 79 (280)
++..|++++++||+.++|++++++++++++| +++|+|+||++++++.+|++++.++++++|+|||||++||+++++|++
T Consensus 67 ~~~~a~~~~~~n~~~~~v~~~~~~~~~~~~~~~~~D~ivs~~~~~~l~~e~~~~~~l~~~~r~Lkp~G~iiP~~~~~~~~ 146 (316)
T d1oria_ 67 ISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDGLIFPDRATLYVT 146 (316)
T ss_dssp THHHHHHHHHHTTCTTTEEEEESCTTTCCCSSSCEEEEEECCCBBTBTBTCCHHHHHHHHHHHEEEEEEEESCEEEEEEE
T ss_pred HHhhhhhHHHHhCCccccceEeccHHHcccccceeEEEeeeeeeeeeccHHHHHHHHHHHHhcCCCCeEEEeeeEEEEEE
Confidence 4678899999999999999999999999988 899999999999999999999999999999999999999999999999
Q ss_pred EeecCCCCchhhhhcccccchhhhhcccccccCccccccCchhhhhhhhhhccccceEecCCCcccCcceeEEEEeCCCC
Q 023569 80 PIRSGLGDQKQQDYEGALDDWYSFLKETKTYYGVDMSVLTKPFSEEQKKYYLQTSLWSNLHPDQVIGTAAVVKNIDCSTA 159 (280)
Q Consensus 80 ~v~~~~~~~~~~~~~~~~~~W~~~~~~~~~~~G~d~s~l~~~~~~~~~~~~~~~p~~~~~~~~~~Ls~p~~i~~~D~~~~ 159 (280)
||+++. .+.....+|. ++||+||+++.. ....+|.+....+.++||+|+.+++|||.+.
T Consensus 147 ~v~~~~------~~~~~~~~~~-------~~~g~d~~~~~~--------~~~~~~~v~~~~~~~~ls~p~~~~~~d~~~~ 205 (316)
T d1oria_ 147 AIEDRQ------YKDYKIHWWE-------NVYGFDMSCIKD--------VAIKEPLVDVVDPKQLVTNACLIKEVDIYTV 205 (316)
T ss_dssp EECCHH------HHHHHTTTTT-------CBTTBCCHHHHH--------HHHTSCEEECCCGGGEEEEEEEEEEEETTTC
T ss_pred EecCHH------HHhhhccccc-------ccccccchhhhh--------hhccccEEEEecCceEeeCCEEeEEEcCCCC
Confidence 999863 3344567774 899999999853 2345788888889999999999999999999
Q ss_pred CcccccceeeeEEEEEEecCceEEEEEEEecceeccccCCCCCCcEEEecCCCCCCCCCeeeeEEeeCCeeecCCCCEEE
Q 023569 160 TVDDIREVRSKFLSSIRGEGTRLCGFSGWFDVHFRGSTEDPAQQEIELTTAPSTYNGTHWGQQVFLFRPSVRVSEGDDLN 239 (280)
Q Consensus 160 ~~~dl~~~~~~~~~~~~~~~g~~~g~~~wfd~~l~~~~~~~~~~~v~lST~P~~~~~thW~Q~v~~l~~p~~V~~Gd~i~ 239 (280)
+.+++ .+...+++++. ++|++|||++||+++|+.+ .+++.|||+| .++.|||+|++|+|++|+.|++||.|+
T Consensus 206 ~~~~l-~~~~~~~~~~~-~~g~~hg~~~wFd~~l~~~-----~~~v~lST~P-~~~~thW~Q~v~~l~~p~~v~~g~~i~ 277 (316)
T d1oria_ 206 KVEDL-TFTSPFCLQVK-RNDYVHALVAYFNIEFTRC-----HKRTGFSTSP-ESPYTHWKQTVFYMEDYLTVKTGEEIF 277 (316)
T ss_dssp CGGGG-SEEEEEEEEBC-SSEEEEEEEEEEEEECTTS-----SSCCEEECST-TSCCCTTCEEEEEEEEEEEECTTCEEE
T ss_pred cccCc-cEEEEEEEeec-CCceEEEEEEEEEEEeeCC-----CCCeEEECCC-CcCCCceecEEEEcCCceEcCCCCEEE
Confidence 88888 67889999998 9999999999999999864 4568999999 588999999999999999999999999
Q ss_pred EEEEEEeCCCCCeEEEEEEEEEEeccccccC
Q 023569 240 VSFSMTRSKENHRLLEVEFSCEIRESTGQIL 270 (280)
Q Consensus 240 ~~~~~~~~~~~~r~~~i~~~~~~~~~~~~~~ 270 (280)
+++++.++.+++|+++|+++|+++++.+...
T Consensus 278 ~~i~~~~~~~~~r~~~~~~~~~~~~~~~~~~ 308 (316)
T d1oria_ 278 GTIGMRPNAKNNRDLDFTIDLDFKGQLCELS 308 (316)
T ss_dssp EEEEEEECSSSTTCEEEEEEEEEECSSCEEE
T ss_pred EEEEEEECCCCCceEEEEEEEEecCeeeccc
Confidence 9999999999999999999999999876654
|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1sdwa2 b.121.1.2 (A:199-356) Peptidylglycine alpha-hydroxylating monooxygenase, PHM {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|